| Basic Information | |
|---|---|
| Family ID | F101655 |
| Family Type | Metagenome |
| Number of Sequences | 102 |
| Average Sequence Length | 45 residues |
| Representative Sequence | IARGTLPEAVGLWWTHAVVALLALLVILGPGLANRLRYRMRGL |
| Number of Associated Samples | 95 |
| Number of Associated Scaffolds | 102 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | No |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 0.00 % |
| % of genes near scaffold ends (potentially truncated) | 97.06 % |
| % of genes from short scaffolds (< 2000 bps) | 84.31 % |
| Associated GOLD sequencing projects | 93 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.52 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (100.000 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil (27.451 % of family members) |
| Environment Ontology (ENVO) | Unclassified (29.412 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (42.157 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Transmembrane (alpha-helical) | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 49.30% β-sheet: 0.00% Coil/Unstructured: 50.70% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.52 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 102 Family Scaffolds |
|---|---|---|
| PF03739 | LptF_LptG | 93.14 |
| PF04828 | GFA | 3.92 |
| PF02146 | SIR2 | 0.98 |
| PF05299 | Peptidase_M61 | 0.98 |
| COG ID | Name | Functional Category | % Frequency in 102 Family Scaffolds |
|---|---|---|---|
| COG0795 | Lipopolysaccharide export LptBFGC system, permease protein LptF | Cell wall/membrane/envelope biogenesis [M] | 93.14 |
| COG3791 | Uncharacterized conserved protein | Function unknown [S] | 3.92 |
| COG0308 | Aminopeptidase N, contains DUF3458 domain | Amino acid transport and metabolism [E] | 0.98 |
| COG0846 | NAD-dependent protein deacetylase, SIR2 family | Posttranslational modification, protein turnover, chaperones [O] | 0.98 |
| COG3975 | Predicted metalloprotease, contains C-terminal PDZ domain | General function prediction only [R] | 0.98 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 100.00 % |
| Unclassified | root | N/A | 0.00 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300004635|Ga0062388_102934328 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 503 | Open in IMG/M |
| 3300005334|Ga0068869_101670943 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 568 | Open in IMG/M |
| 3300005459|Ga0068867_100803262 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Chromatiales | 839 | Open in IMG/M |
| 3300005538|Ga0070731_10609868 | All Organisms → cellular organisms → Bacteria | 726 | Open in IMG/M |
| 3300005541|Ga0070733_10279123 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 1102 | Open in IMG/M |
| 3300005591|Ga0070761_10590554 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 690 | Open in IMG/M |
| 3300005712|Ga0070764_10117195 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1438 | Open in IMG/M |
| 3300005993|Ga0080027_10467328 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 511 | Open in IMG/M |
| 3300006175|Ga0070712_100111334 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 2044 | Open in IMG/M |
| 3300006176|Ga0070765_101131842 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 739 | Open in IMG/M |
| 3300007788|Ga0099795_10039969 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1664 | Open in IMG/M |
| 3300009545|Ga0105237_12020083 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 585 | Open in IMG/M |
| 3300009551|Ga0105238_10237779 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 1799 | Open in IMG/M |
| 3300009826|Ga0123355_10989313 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 895 | Open in IMG/M |
| 3300010043|Ga0126380_10855176 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 750 | Open in IMG/M |
| 3300010046|Ga0126384_10318406 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1285 | Open in IMG/M |
| 3300010048|Ga0126373_12611371 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 563 | Open in IMG/M |
| 3300010049|Ga0123356_14079864 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 503 | Open in IMG/M |
| 3300010303|Ga0134082_10091369 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 1199 | Open in IMG/M |
| 3300010361|Ga0126378_10992212 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 944 | Open in IMG/M |
| 3300010376|Ga0126381_102626259 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 721 | Open in IMG/M |
| 3300012189|Ga0137388_11134213 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 719 | Open in IMG/M |
| 3300012205|Ga0137362_10137328 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2083 | Open in IMG/M |
| 3300012362|Ga0137361_10070184 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2965 | Open in IMG/M |
| 3300012362|Ga0137361_10522591 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1090 | Open in IMG/M |
| 3300012582|Ga0137358_10326094 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Chromatiales | 1041 | Open in IMG/M |
| 3300012918|Ga0137396_10063293 | All Organisms → cellular organisms → Bacteria | 2569 | Open in IMG/M |
| 3300012924|Ga0137413_11417769 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 562 | Open in IMG/M |
| 3300012971|Ga0126369_12146407 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 646 | Open in IMG/M |
| 3300016341|Ga0182035_11656772 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 577 | Open in IMG/M |
| 3300016422|Ga0182039_10080560 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2338 | Open in IMG/M |
| 3300016445|Ga0182038_11566512 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 592 | Open in IMG/M |
| 3300017924|Ga0187820_1066783 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 994 | Open in IMG/M |
| 3300017973|Ga0187780_10439578 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 928 | Open in IMG/M |
| 3300017993|Ga0187823_10340941 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 531 | Open in IMG/M |
| 3300018058|Ga0187766_11268747 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 536 | Open in IMG/M |
| 3300018085|Ga0187772_10017164 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 4091 | Open in IMG/M |
| 3300018086|Ga0187769_10374625 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1069 | Open in IMG/M |
| 3300019866|Ga0193756_1000185 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 4402 | Open in IMG/M |
| 3300020022|Ga0193733_1143216 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 650 | Open in IMG/M |
| 3300020581|Ga0210399_11263646 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 583 | Open in IMG/M |
| 3300021086|Ga0179596_10311767 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 786 | Open in IMG/M |
| 3300021168|Ga0210406_10337995 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1217 | Open in IMG/M |
| 3300021372|Ga0213877_10221752 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 620 | Open in IMG/M |
| 3300021406|Ga0210386_10333603 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1303 | Open in IMG/M |
| 3300021432|Ga0210384_10380979 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 1270 | Open in IMG/M |
| 3300021432|Ga0210384_11229462 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 653 | Open in IMG/M |
| 3300021439|Ga0213879_10203032 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 590 | Open in IMG/M |
| 3300021477|Ga0210398_11122875 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 623 | Open in IMG/M |
| 3300021477|Ga0210398_11323348 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 565 | Open in IMG/M |
| 3300023259|Ga0224551_1008007 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 1760 | Open in IMG/M |
| 3300025898|Ga0207692_10067726 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1870 | Open in IMG/M |
| 3300025903|Ga0207680_11234239 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Vicinamibacteria → Vicinamibacterales → Vicinamibacteraceae → Luteitalea → unclassified Luteitalea → Luteitalea sp. | 533 | Open in IMG/M |
| 3300025906|Ga0207699_10229183 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1272 | Open in IMG/M |
| 3300025906|Ga0207699_10324797 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1080 | Open in IMG/M |
| 3300025929|Ga0207664_10612487 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 978 | Open in IMG/M |
| 3300025949|Ga0207667_11963817 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 546 | Open in IMG/M |
| 3300026281|Ga0209863_10048813 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Chromatiales | 1259 | Open in IMG/M |
| 3300027505|Ga0209218_1142054 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 507 | Open in IMG/M |
| 3300027548|Ga0209523_1024057 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1201 | Open in IMG/M |
| 3300027648|Ga0209420_1156651 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 622 | Open in IMG/M |
| 3300027725|Ga0209178_1436899 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 502 | Open in IMG/M |
| 3300027855|Ga0209693_10273237 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 826 | Open in IMG/M |
| 3300027874|Ga0209465_10479936 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 621 | Open in IMG/M |
| 3300027965|Ga0209062_1136306 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 970 | Open in IMG/M |
| 3300029943|Ga0311340_11009377 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 683 | Open in IMG/M |
| 3300031543|Ga0318516_10838663 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 518 | Open in IMG/M |
| 3300031544|Ga0318534_10064711 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2063 | Open in IMG/M |
| 3300031564|Ga0318573_10025950 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2693 | Open in IMG/M |
| 3300031682|Ga0318560_10771622 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 519 | Open in IMG/M |
| 3300031720|Ga0307469_10033600 | All Organisms → cellular organisms → Bacteria | 3015 | Open in IMG/M |
| 3300031724|Ga0318500_10496035 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 613 | Open in IMG/M |
| 3300031736|Ga0318501_10020413 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2776 | Open in IMG/M |
| 3300031740|Ga0307468_100692297 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 850 | Open in IMG/M |
| 3300031744|Ga0306918_10513916 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 938 | Open in IMG/M |
| 3300031747|Ga0318502_10910312 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 535 | Open in IMG/M |
| 3300031753|Ga0307477_10535093 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 794 | Open in IMG/M |
| 3300031764|Ga0318535_10114679 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Nevskiales → Sinobacteraceae | 1187 | Open in IMG/M |
| 3300031771|Ga0318546_11109609 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 556 | Open in IMG/M |
| 3300031781|Ga0318547_10392103 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 851 | Open in IMG/M |
| 3300031819|Ga0318568_10030622 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 3000 | Open in IMG/M |
| 3300031819|Ga0318568_10946634 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 532 | Open in IMG/M |
| 3300031823|Ga0307478_10189344 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1651 | Open in IMG/M |
| 3300031859|Ga0318527_10127026 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1060 | Open in IMG/M |
| 3300031890|Ga0306925_12166858 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 518 | Open in IMG/M |
| 3300031941|Ga0310912_11376402 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 533 | Open in IMG/M |
| 3300031942|Ga0310916_10375738 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1208 | Open in IMG/M |
| 3300031946|Ga0310910_10571739 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 896 | Open in IMG/M |
| 3300031954|Ga0306926_10873713 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1079 | Open in IMG/M |
| 3300031954|Ga0306926_12436117 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 576 | Open in IMG/M |
| 3300032035|Ga0310911_10281739 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 955 | Open in IMG/M |
| 3300032044|Ga0318558_10583900 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Chromatiales | 558 | Open in IMG/M |
| 3300032054|Ga0318570_10024893 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2316 | Open in IMG/M |
| 3300032065|Ga0318513_10017974 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2909 | Open in IMG/M |
| 3300032180|Ga0307471_100736274 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1151 | Open in IMG/M |
| 3300032205|Ga0307472_101642333 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 633 | Open in IMG/M |
| 3300032261|Ga0306920_100397795 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2048 | Open in IMG/M |
| 3300032261|Ga0306920_101853940 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 849 | Open in IMG/M |
| 3300032892|Ga0335081_10258467 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 2344 | Open in IMG/M |
| 3300033134|Ga0335073_11486843 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 655 | Open in IMG/M |
| 3300033289|Ga0310914_10281349 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1498 | Open in IMG/M |
| 3300033807|Ga0314866_003593 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1742 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 27.45% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 8.82% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 8.82% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 5.88% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 5.88% |
| Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 3.92% |
| Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil | 3.92% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 3.92% |
| Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 2.94% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 2.94% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment | 1.96% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 1.96% |
| Bulk Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Bulk Soil | 1.96% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 1.96% |
| Prmafrost Soil | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Prmafrost Soil | 1.96% |
| Termite Gut | Host-Associated → Arthropoda → Digestive System → Gut → Unclassified → Termite Gut | 1.96% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 1.96% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 1.96% |
| Bog Forest Soil | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil | 0.98% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 0.98% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 0.98% |
| Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Peatland | 0.98% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 0.98% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Agricultural Soil | 0.98% |
| Soil | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Soil | 0.98% |
| Palsa | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa | 0.98% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 0.98% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 0.98% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300004635 | Coassembly of ECP03_0M1, ECP03_OM2, ECP03_OM3, ECP04_OM1, ECP04_OM2, ECP04_OM3 | Environmental | Open in IMG/M |
| 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Host-Associated | Open in IMG/M |
| 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Host-Associated | Open in IMG/M |
| 3300005538 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen03_05102014_R1 | Environmental | Open in IMG/M |
| 3300005541 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen05_05102014_R1 | Environmental | Open in IMG/M |
| 3300005591 | Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF1 | Environmental | Open in IMG/M |
| 3300005712 | Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 4 | Environmental | Open in IMG/M |
| 3300005993 | Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil replicate 1 DNA2013-046 | Environmental | Open in IMG/M |
| 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Environmental | Open in IMG/M |
| 3300006176 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5 | Environmental | Open in IMG/M |
| 3300007788 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 | Environmental | Open in IMG/M |
| 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Host-Associated | Open in IMG/M |
| 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Host-Associated | Open in IMG/M |
| 3300009826 | Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 | Host-Associated | Open in IMG/M |
| 3300010043 | Tropical forest soil microbial communities from Panama - MetaG Plot_26 | Environmental | Open in IMG/M |
| 3300010046 | Tropical forest soil microbial communities from Panama - MetaG Plot_36 | Environmental | Open in IMG/M |
| 3300010048 | Tropical forest soil microbial communities from Panama - MetaG Plot_11 | Environmental | Open in IMG/M |
| 3300010049 | Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 | Host-Associated | Open in IMG/M |
| 3300010303 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_5_09182015 | Environmental | Open in IMG/M |
| 3300010361 | Tropical forest soil microbial communities from Panama - MetaG Plot_23 | Environmental | Open in IMG/M |
| 3300010376 | Tropical forest soil microbial communities from Panama - MetaG Plot_28 | Environmental | Open in IMG/M |
| 3300012189 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4A metaG | Environmental | Open in IMG/M |
| 3300012205 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_100_16 metaG | Environmental | Open in IMG/M |
| 3300012362 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_80_16 metaG | Environmental | Open in IMG/M |
| 3300012582 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_20_16 metaG | Environmental | Open in IMG/M |
| 3300012918 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czcobulk3.16 metaG | Environmental | Open in IMG/M |
| 3300012924 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012971 | Tropical forest soil microbial communities from Panama - MetaG Plot_1 | Environmental | Open in IMG/M |
| 3300016341 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 | Environmental | Open in IMG/M |
| 3300016422 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111 | Environmental | Open in IMG/M |
| 3300016445 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108 | Environmental | Open in IMG/M |
| 3300017924 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_5 | Environmental | Open in IMG/M |
| 3300017973 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP10_20_MG | Environmental | Open in IMG/M |
| 3300017993 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SourceSoil_3 | Environmental | Open in IMG/M |
| 3300018058 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_QUI02_MP05_20_MG | Environmental | Open in IMG/M |
| 3300018085 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP15_20_MG | Environmental | Open in IMG/M |
| 3300018086 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP02_10_MG | Environmental | Open in IMG/M |
| 3300019866 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? H1m1 | Environmental | Open in IMG/M |
| 3300020022 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U1s2 | Environmental | Open in IMG/M |
| 3300020581 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-M | Environmental | Open in IMG/M |
| 3300021086 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_1_08_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300021168 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-30-M | Environmental | Open in IMG/M |
| 3300021372 | Vellozia epidendroides bulk soil microbial communities from rupestrian grasslands, the National Park of Serra do Cipo, Brazil - BS_R01 | Environmental | Open in IMG/M |
| 3300021406 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-O | Environmental | Open in IMG/M |
| 3300021432 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-M | Environmental | Open in IMG/M |
| 3300021439 | Vellozia epidendroides bulk soil microbial communities from rupestrian grasslands, the National Park of Serra do Cipo, Brazil - BS_R03 | Environmental | Open in IMG/M |
| 3300021477 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-4-O | Environmental | Open in IMG/M |
| 3300023259 | Peat soil microbial communities from Stordalen Mire, Sweden - 717 P3 20-24 | Environmental | Open in IMG/M |
| 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026281 | Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil replicate 1 DNA2013-046 (SPAdes) | Environmental | Open in IMG/M |
| 3300027505 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM1H0_O3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027548 | Forest soil microbial communities from Davy Crockett National Forest, Groveton, Texas, USA - Texas A ecozone_OM3H0_M1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027648 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM1_O1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027725 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS200 (SPAdes) | Environmental | Open in IMG/M |
| 3300027855 | Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027874 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 1 MoBio (SPAdes) | Environmental | Open in IMG/M |
| 3300027965 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen12_06102014_R2 (SPAdes) | Environmental | Open in IMG/M |
| 3300029943 | I_Palsa_N3 coassembly | Environmental | Open in IMG/M |
| 3300031543 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f20 | Environmental | Open in IMG/M |
| 3300031544 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.117b4f26 | Environmental | Open in IMG/M |
| 3300031564 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f21 | Environmental | Open in IMG/M |
| 3300031682 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f22 | Environmental | Open in IMG/M |
| 3300031720 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM2C_515 | Environmental | Open in IMG/M |
| 3300031724 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.174b1f20 | Environmental | Open in IMG/M |
| 3300031736 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.174b1f21 | Environmental | Open in IMG/M |
| 3300031740 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gases AM2C_05 | Environmental | Open in IMG/M |
| 3300031744 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.00H (v2) | Environmental | Open in IMG/M |
| 3300031747 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.174b1f22 | Environmental | Open in IMG/M |
| 3300031753 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM2C_515 | Environmental | Open in IMG/M |
| 3300031764 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.117b4f27 | Environmental | Open in IMG/M |
| 3300031771 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f19 | Environmental | Open in IMG/M |
| 3300031781 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f20 | Environmental | Open in IMG/M |
| 3300031819 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f21 | Environmental | Open in IMG/M |
| 3300031823 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_05 | Environmental | Open in IMG/M |
| 3300031859 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f25 | Environmental | Open in IMG/M |
| 3300031890 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176 (v2) | Environmental | Open in IMG/M |
| 3300031941 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.OX080 | Environmental | Open in IMG/M |
| 3300031942 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.LF176 | Environmental | Open in IMG/M |
| 3300031946 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.HF172 | Environmental | Open in IMG/M |
| 3300031954 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178 (v2) | Environmental | Open in IMG/M |
| 3300032035 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.HF170 | Environmental | Open in IMG/M |
| 3300032044 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f20 | Environmental | Open in IMG/M |
| 3300032054 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f23 | Environmental | Open in IMG/M |
| 3300032065 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.171b2f20 | Environmental | Open in IMG/M |
| 3300032180 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515 | Environmental | Open in IMG/M |
| 3300032205 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_05 | Environmental | Open in IMG/M |
| 3300032261 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 (v2) | Environmental | Open in IMG/M |
| 3300032892 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.5 | Environmental | Open in IMG/M |
| 3300033134 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.2 | Environmental | Open in IMG/M |
| 3300033289 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.AN108 | Environmental | Open in IMG/M |
| 3300033807 | Tropical peat soil microbial communities from peatlands in Loreto, Peru - MAQ_100_10 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| Ga0062388_1029343282 | 3300004635 | Bog Forest Soil | QLISVGKVLIARGALPQFLGLWWTHAFVVLFALLVIFGPGVAHRLRYRWQGL* |
| Ga0068869_1016709431 | 3300005334 | Miscanthus Rhizosphere | LLYTQLISVGKVWIAHGTLPGFLGLWWTHAAVVLLALLVILGPRFANRLRYRVRGL* |
| Ga0068867_1008032622 | 3300005459 | Miscanthus Rhizosphere | VGKVWIAHGTLPGFLGLWWTHAAVVLLALLVILGPRFANRLRYRVRGL* |
| Ga0070731_106098682 | 3300005538 | Surface Soil | SVPAFLGLWWTHVVVIGFGLLVWLGPRLATRLRYRLRGL* |
| Ga0070733_102791231 | 3300005541 | Surface Soil | GKTWIARGTVPESFGLWWTHAVVALLACAVIFGPRLRTLLHYRWRRL* |
| Ga0070761_105905541 | 3300005591 | Soil | YFLYQNLITVGKVWISRGTVPEVAGLWWTHAAVVLLALTVILGPTVATRVRYRVRGL* |
| Ga0070764_101171953 | 3300005712 | Soil | GTLPPFLGLWWTHAVVVALALLVIFGPTFANRLRYRVRGL* |
| Ga0080027_104673282 | 3300005993 | Prmafrost Soil | GKVWIARGTAPYYLGLWWTHAVVIIIALAVILGPGYVNRLRYRMRGL* |
| Ga0070712_1001113341 | 3300006175 | Corn, Switchgrass And Miscanthus Rhizosphere | YYNLATTGKTWIARGTVPEVVGLWWTHVVVALLALGVILAPGLINRLRYRMRGL* |
| Ga0070765_1011318421 | 3300006176 | Soil | YSQLISVGKVLLGRDTLPLFLGLWWTHAVVVALALLVIFGPTLANRLRYRVRGL* |
| Ga0099795_100399693 | 3300007788 | Vadose Zone Soil | GKVWIARGTIPEFLGLWWTHAAVVLLALMVIVGPGLGNRLRYRMRGL* |
| Ga0105237_120200832 | 3300009545 | Corn Rhizosphere | VGLWWTHAAVVLLALLVIWGPTLSTRLRYRIRGL* |
| Ga0105238_102377791 | 3300009551 | Corn Rhizosphere | NLITVGKSWIARGKVPEFVGLWWTHAAVALLALFVVMGPTVANRIRYRVRGL* |
| Ga0123355_109893131 | 3300009826 | Termite Gut | PEVVGLWWTHVAVVLLALLVIFGPGLVNRLRYRRRRQ* |
| Ga0126380_108551762 | 3300010043 | Tropical Forest Soil | EVVGLWWTHVVVALLALAVIVAPGLINRLRYRLRYGTRGL* |
| Ga0126384_103184062 | 3300010046 | Tropical Forest Soil | VYYNLATTGRTWIAHGKLPEVVGLWWTHVVVALLALAVIVGPGIANRVRYRMRGL* |
| Ga0126373_126113712 | 3300010048 | Tropical Forest Soil | PEVVGLWWTHVVVALLALGVIVGPGLIHRLRYRMRHR* |
| Ga0123356_140798642 | 3300010049 | Termite Gut | GTVPPVVGLWWTHVVVALLALLVIVGPGLLNRLRYRLRGL* |
| Ga0134082_100913692 | 3300010303 | Grasslands Soil | VIFFLYVNLISVGKVWIARGTIPEFLGLWWTHAAVVLLALMVIVGPGLSNRLRYRVRGL* |
| Ga0126378_109922121 | 3300010361 | Tropical Forest Soil | IFFVYYNLATTGRTWIAHGKLPEVVGLWWTHVVVALLAVAVIVGPGIANRVRYRMRGL* |
| Ga0126381_1026262591 | 3300010376 | Tropical Forest Soil | GTLPEVVGLWWTHLVVALLALAVILGPGIATRLRYRMRSP* |
| Ga0137388_111342132 | 3300012189 | Vadose Zone Soil | FLYVNLISVGKVWIARATIPEFLGLWWTHAAVVLLALMVIVGPGLSNRLRYRVRGL* |
| Ga0137362_101373284 | 3300012205 | Vadose Zone Soil | VNLISVGKVWIARGTIPEFLGLWWTHAVVVLLALMVIVGPGLGNRLRYRVRGL* |
| Ga0137361_100701841 | 3300012362 | Vadose Zone Soil | ISVGKVWIARGTIPEFLGLWWTHAVVVLLALMVIVGPGLANRLRYRVRGL* |
| Ga0137361_105225912 | 3300012362 | Vadose Zone Soil | KVWIARGTIPEFLGLWWTHAVVVLLALMVIVGPGLGNRLRYRMRGL* |
| Ga0137358_103260942 | 3300012582 | Vadose Zone Soil | VGKVWIARGTIPEFLGLWWTHAVVVLLALMVIVGPGLGNRLRYRVRGL* |
| Ga0137396_100632934 | 3300012918 | Vadose Zone Soil | ARGTIPEFLGLWWTHAVVVLLALMVIVGPGLGNRLRYRMRGL* |
| Ga0137413_114177692 | 3300012924 | Vadose Zone Soil | RGTVPEALGLWWTHAAVVLLALAVIAGPGLATRLRYRIRGL* |
| Ga0126369_121464071 | 3300012971 | Tropical Forest Soil | IWLARGSVPSPLGLWWTHLVVIALALLVILGPTLANRLRYRWQGL* |
| Ga0182035_116567722 | 3300016341 | Soil | ATTGKTWIARGTLPEAVGLWWTHAVVALLALLVILGPGLVNRLRYRMRGL |
| Ga0182039_100805604 | 3300016422 | Soil | IARGTLPEAVGLWWTHAVVALLALLVILGPGLANRLRYRMRGL |
| Ga0182038_115665121 | 3300016445 | Soil | NLAAAGKTGIARGRLPELVGLWWTHIAVTLLALLVIAGPRLTYRLRYRMRNP |
| Ga0187820_10667832 | 3300017924 | Freshwater Sediment | IAVVIFFLYYALASAGKTWIARGTAPELLGLWWTHAVVLVLALAVIMGPRLAERVRYRVRGL |
| Ga0187780_104395782 | 3300017973 | Tropical Peatland | GTLPEVVGLWWTHVVVALLALAVILGPGIANRVRYRMRGL |
| Ga0187823_103409411 | 3300017993 | Freshwater Sediment | KVWIARGTVPATLGLWWTHAVVLLLALVVLVGPGLSTRLRYRFQRL |
| Ga0187766_112687471 | 3300018058 | Tropical Peatland | ARGTIPEAAGLWWTHVIVVLFALIIIASPGLAQRLRYRMRGP |
| Ga0187772_100171645 | 3300018085 | Tropical Peatland | VSLGLWWTHAVVGLLALAIIVGPGLMNRLRYRVRRL |
| Ga0187769_103746251 | 3300018086 | Tropical Peatland | RGTLPESLGLWWTHAVVALLALAVILTPKILQRLRYRVRGL |
| Ga0193756_10001855 | 3300019866 | Soil | IFFLYVNLISVGKVWIARGTIPEFLGLWWTHAVVVLLALMVMVGPGLGNRLRYRVRGL |
| Ga0193733_11432161 | 3300020022 | Soil | IARGTIPEFLGLWWTHAAVVLLALMVIVGPGLRNRLRYRVRGL |
| Ga0210399_112636461 | 3300020581 | Soil | ARGTVPVALGLWWTHAAVVLLALAVIVGPGLVNRLRYRVRRL |
| Ga0179596_103117672 | 3300021086 | Vadose Zone Soil | TVGKVWISRGTLPEIAGLWWTHAAVLLLALVVILGPALGTRLRYRARGL |
| Ga0210406_103379951 | 3300021168 | Soil | IAGLWWTHAAVLLLALVVILGPTLGTRLRYRIRGL |
| Ga0213877_102217521 | 3300021372 | Bulk Soil | LPEALGLWWTHAAVALLALGVILGPGVAHRLRHRMRAS |
| Ga0210386_103336033 | 3300021406 | Soil | RGSVPEIAGLWWTHAAVILLAFAVISGPNIATRFRYRVRGL |
| Ga0210384_103809791 | 3300021432 | Soil | YLNLVSAGKVWIGRGTVPVVLGLWWTHAAVVLLALAVILGPGLANRLRYRVRRL |
| Ga0210384_112294621 | 3300021432 | Soil | PQVLGLWWTHAVVVALALLIILGPGLRNRMRYRMRGL |
| Ga0213879_102030321 | 3300021439 | Bulk Soil | VPEAIGLWWTHVLVALLALAVILGPGLLNRLRYRLRGL |
| Ga0210398_111228752 | 3300021477 | Soil | LISVGKVWIARGTLPLFLGLWWTHAVVVLIALMVIFGPVLAQRLRYRWAGL |
| Ga0210398_113233481 | 3300021477 | Soil | TVPAEFGLWWTHAVVVLLAGAVIFAPGLRVRLRYRRTAT |
| Ga0224551_10080071 | 3300023259 | Soil | VPEVLGLWWAHGAVVLLALAVIYAPGRLARLRNKSPA |
| Ga0207692_100677263 | 3300025898 | Corn, Switchgrass And Miscanthus Rhizosphere | VRSALISVGKVMIAHGKAPQVLGLWWTHAVVVALALLIILGPGLRSRLRYRMRGL |
| Ga0207680_112342392 | 3300025903 | Switchgrass Rhizosphere | VVIYFLYQNLINIGKTWIARGKLPEIAGLWWTHAAVALLALVVIYGPVLSHWIRYRIRGL |
| Ga0207699_102291832 | 3300025906 | Corn, Switchgrass And Miscanthus Rhizosphere | WISRGAVPEVVGLWWTHAAVVLLALLVISGPTLANRIRYRLRGL |
| Ga0207699_103247971 | 3300025906 | Corn, Switchgrass And Miscanthus Rhizosphere | LARGSVPEVVGLWWTHVVVALLALAVILGPGIATRLRYRWRGS |
| Ga0207664_106124871 | 3300025929 | Agricultural Soil | VPAAVGLWWTHVVVVLLTLAVVLGPTSLQRLRYRTART |
| Ga0207667_119638171 | 3300025949 | Corn Rhizosphere | TVGKVWISRGAVPEVVGLWWTHAAVAILALLVVSGPTLANRIRYRVRGL |
| Ga0209863_100488134 | 3300026281 | Prmafrost Soil | GKVWIARGTAPYYLGLWWTHAVVIIIALAVILGPGYVNRLRYRMRGL |
| Ga0209218_11420542 | 3300027505 | Forest Soil | PEAIGLWWTHVVVALIALAVILGPGAANRLRYRMRGL |
| Ga0209523_10240571 | 3300027548 | Forest Soil | IPEFLGLWWTHAVVVLVALGVMVGPGLAYRVRYRIRGL |
| Ga0209420_11566512 | 3300027648 | Forest Soil | WLGLWWTHVAVVLLALAVIALPRVANRLRYRVRTA |
| Ga0209178_14368991 | 3300027725 | Agricultural Soil | IPAVIGLWWTHIAVALLALAVIFAPQGAQRLRYRMRRA |
| Ga0209693_102732372 | 3300027855 | Soil | VLLGRDTLPLFLGLWWTHAVVVALALLVIFGPTLANRLRYRVRGL |
| Ga0209465_104799362 | 3300027874 | Tropical Forest Soil | EVVGLWWTHVVVALLALAVIVGPGIANRVRYRMRGL |
| Ga0209062_11363061 | 3300027965 | Surface Soil | PVALGLWWAHAAVILLALAVIFAPQAAQRLRYRLAGTA |
| Ga0311340_110093772 | 3300029943 | Palsa | WIARGTLPEVVGLWWTHVAVALVALAVIVGPGVANRLRYRMRGL |
| Ga0318516_108386631 | 3300031543 | Soil | WLGLWWTHVAVVLLALLVIAAPGLRNRMRYRMRGA |
| Ga0318534_100647115 | 3300031544 | Soil | NLATTGKTWIVRGTLPEAVGLWWTHAVVALLALLVILGPGLAHRLRYRMRGL |
| Ga0318573_100259505 | 3300031564 | Soil | PEAVGLWWTHVAVALLALAVIVGPRIAHRLRYRMRGL |
| Ga0318560_107716222 | 3300031682 | Soil | TWIARGTLPEAVGLWWTHMVVALLALVVIVGPRIANRLRYRMRGL |
| Ga0307469_100336004 | 3300031720 | Hardwood Forest Soil | KVWIARGTIPEFLGLWWTHAVVVLLALMVIVGPGLANRLRYRVRGL |
| Ga0318500_104960351 | 3300031724 | Soil | YYNLATTARTWIARGTLPEVVGLWWTHVVVALLALAVIMGPRIAHRVRYRMRGL |
| Ga0318501_100204135 | 3300031736 | Soil | TGRTWIARGTLPEAVGLWWTHVAVALLALAVIVGPRIAHRLRYRMRGL |
| Ga0307468_1006922971 | 3300031740 | Hardwood Forest Soil | VIFFLYVNLISVGKVWIARGTIPEFLGLWWTHAVVVLLALMVIVGPGLANRLRYRVRGL |
| Ga0306918_105139162 | 3300031744 | Soil | VRGTLPEAVGLWWTHAVVALLALLVILGPGLAHRLRYRMRGL |
| Ga0318502_109103122 | 3300031747 | Soil | LIFFIYYNLATTGRTLIARNTVPEVVGLWWTHVVVGLLALGVILGPGLIHRLRYRMRRQ |
| Ga0307477_105350931 | 3300031753 | Hardwood Forest Soil | IARGALPQALGLWWTHAAVALLALAVVLGPRLAHRLRYRMGRL |
| Ga0318535_101146791 | 3300031764 | Soil | FVYYNLATTGKTWIARGTVPEVVGLWWTHVVVALLALAVIVVPGLINRLRYRLRYGTRGV |
| Ga0318546_111096092 | 3300031771 | Soil | NLATTGKTWIVRGTLPEAVGLWWTHAVVALLALLVILGPGLANRLRYRMRGL |
| Ga0318547_103921032 | 3300031781 | Soil | QAVGLWWTHLVVALLALAVIVGPRIAHRVRYRMRGL |
| Ga0318568_100306221 | 3300031819 | Soil | TWIARGTLPEWVGLWWTHVAVTLLALAVILGPRIANRVRYRMRGL |
| Ga0318568_109466342 | 3300031819 | Soil | VPEALGLWWTHAVVALLALAFIMGPGLVTRLRYRFSRL |
| Ga0307478_101893443 | 3300031823 | Hardwood Forest Soil | YFLYQNLITVGKVWISRGTIPEVAGLWWTHAAVVLLALTVILGPTVATRVRNRVRGL |
| Ga0318527_101270261 | 3300031859 | Soil | EAVGLWWTHAVVALLALLVILGPGLANRLRYRMRGL |
| Ga0306925_121668581 | 3300031890 | Soil | RGTLPEVMGLWWTHVAVVLIALLVIFAPGLAHRLRYRMRSP |
| Ga0310912_113764021 | 3300031941 | Soil | EAVGLWWTHVAVALLALAVIVGPRIAHRLRYRMRGL |
| Ga0310916_103757382 | 3300031942 | Soil | VVGLWWTHVVVALLALAVIVVPGLINRLRYRLRYGTRGV |
| Ga0310910_105717392 | 3300031946 | Soil | IARGTLPQAVGLWWTHLVVALLALAVIVGPRIAHRVRYRMRGL |
| Ga0306926_108737131 | 3300031954 | Soil | GSLPEFVGLWWTHIAVTLLALLVIVSPRLTYRLRYRMRNP |
| Ga0306926_124361171 | 3300031954 | Soil | VVGLWWTHAVVVLLALLVILGPGVANRLRYRLRGL |
| Ga0310911_102817392 | 3300032035 | Soil | IFFIYYNLATTARTWIARGTLPEVVGLWWTHVVVALLALAVIVGPRIAHRVRYRMRGL |
| Ga0318558_105839001 | 3300032044 | Soil | YYNLATTGRTWIARGTLPEWVGLWWTHVVVTLLALAVILGPGIAHRVRYRMRGL |
| Ga0318570_100248931 | 3300032054 | Soil | ATTGRTWIARGTLPEAVGLWWTHAVVALLALAVILGPGIANRLRYRMRGL |
| Ga0318513_100179745 | 3300032065 | Soil | AVGLWWTHAVVALLALLVILGPGLANRLRYRMRGL |
| Ga0307471_1007362741 | 3300032180 | Hardwood Forest Soil | GTVPVALGLWWTHAAVVLLALAVIVGPGLVNRLRYRVRRL |
| Ga0307472_1016423331 | 3300032205 | Hardwood Forest Soil | VLIFFLYYALASTGKTWIARGTAPEVLGLWWTHLVVGLLALAVILGPGVANRVRYRMRGL |
| Ga0306920_1003977951 | 3300032261 | Soil | VVGLWWTHVVVALLALAVIMGPRIAHRVRYRMRGL |
| Ga0306920_1018539402 | 3300032261 | Soil | APPWLGLWWTHVAVVLLALLVIAAPGLRNRMRYRMRGA |
| Ga0335081_102584674 | 3300032892 | Soil | RGTVPAVLGLWWTHAAVALLALAVILGPMLANRLRYRVRRL |
| Ga0335073_114868432 | 3300033134 | Soil | GQQWIVHGEVPVAVGLWWTHAAVALLAVAVIFGPHLAQRLRYRMAAR |
| Ga0310914_102813493 | 3300033289 | Soil | AVGLWWTHAVVALLALAVILGPGIANRLRYRMRGL |
| Ga0314866_003593_1619_1729 | 3300033807 | Peatland | VVLGLWWTHAVVVLLALAVIVGPGLMNRLRYRVRRQ |
| ⦗Top⦘ |