| Basic Information | |
|---|---|
| Family ID | F101643 |
| Family Type | Metagenome |
| Number of Sequences | 102 |
| Average Sequence Length | 45 residues |
| Representative Sequence | MIWWFLIVAVAAGAVLWAALSAYVWVRQRLRNAENRPPDPEQPQV |
| Number of Associated Samples | 85 |
| Number of Associated Scaffolds | 102 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | No |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 30.00 % |
| % of genes near scaffold ends (potentially truncated) | 39.22 % |
| % of genes from short scaffolds (< 2000 bps) | 69.61 % |
| Associated GOLD sequencing projects | 75 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.44 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (88.235 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere (11.765 % of family members) |
| Environment Ontology (ENVO) | Unclassified (28.431 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Host-associated → Plant → Plant rhizosphere (46.078 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 46.58% β-sheet: 0.00% Coil/Unstructured: 53.42% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.44 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 102 Family Scaffolds |
|---|---|---|
| PF02632 | BioY | 30.39 |
| PF02621 | VitK2_biosynth | 19.61 |
| PF00557 | Peptidase_M24 | 12.75 |
| PF11306 | DUF3108 | 7.84 |
| PF09335 | SNARE_assoc | 1.96 |
| PF14329 | DUF4386 | 1.96 |
| PF00326 | Peptidase_S9 | 1.96 |
| PF13407 | Peripla_BP_4 | 0.98 |
| PF12697 | Abhydrolase_6 | 0.98 |
| PF12840 | HTH_20 | 0.98 |
| PF05195 | AMP_N | 0.98 |
| PF03571 | Peptidase_M49 | 0.98 |
| PF05076 | SUFU | 0.98 |
| PF05988 | DUF899 | 0.98 |
| PF01850 | PIN | 0.98 |
| PF13598 | DUF4139 | 0.98 |
| PF00271 | Helicase_C | 0.98 |
| PF03544 | TonB_C | 0.98 |
| PF00583 | Acetyltransf_1 | 0.98 |
| PF06224 | HTH_42 | 0.98 |
| COG ID | Name | Functional Category | % Frequency in 102 Family Scaffolds |
|---|---|---|---|
| COG1268 | Biotin transporter BioY | Coenzyme transport and metabolism [H] | 30.39 |
| COG1427 | Chorismate dehydratase (menaquinone biosynthesis, futalosine pathway) | Coenzyme transport and metabolism [H] | 19.61 |
| COG0398 | Uncharacterized membrane protein YdjX, related to fungal oxalate transporter, TVP38/TMEM64 family | Function unknown [S] | 1.96 |
| COG0586 | Membrane integrity protein DedA, putative transporter, DedA/Tvp38 family | Cell wall/membrane/envelope biogenesis [M] | 1.96 |
| COG1238 | Uncharacterized membrane protein YqaA, VTT domain | Function unknown [S] | 1.96 |
| COG0006 | Xaa-Pro aminopeptidase | Amino acid transport and metabolism [E] | 0.98 |
| COG0810 | Periplasmic protein TonB, links inner and outer membranes | Cell wall/membrane/envelope biogenesis [M] | 0.98 |
| COG3214 | DNA glycosylase YcaQ, repair of DNA interstrand crosslinks | Replication, recombination and repair [L] | 0.98 |
| COG4312 | Predicted dithiol-disulfide oxidoreductase, DUF899 family | General function prediction only [R] | 0.98 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 88.24 % |
| Unclassified | root | N/A | 11.76 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300003321|soilH1_10003762 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 12543 | Open in IMG/M |
| 3300003321|soilH1_10038049 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia | 1947 | Open in IMG/M |
| 3300003324|soilH2_10129890 | Not Available | 1745 | Open in IMG/M |
| 3300003324|soilH2_10129891 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 6735 | Open in IMG/M |
| 3300004114|Ga0062593_100000206 | All Organisms → cellular organisms → Bacteria | 18170 | Open in IMG/M |
| 3300005332|Ga0066388_100158155 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter | 2853 | Open in IMG/M |
| 3300005332|Ga0066388_102034407 | Not Available | 1031 | Open in IMG/M |
| 3300005364|Ga0070673_100278514 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1466 | Open in IMG/M |
| 3300005434|Ga0070709_10068008 | All Organisms → cellular organisms → Bacteria | 2289 | Open in IMG/M |
| 3300005434|Ga0070709_10108892 | Not Available | 1859 | Open in IMG/M |
| 3300005434|Ga0070709_10915159 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 694 | Open in IMG/M |
| 3300005435|Ga0070714_100140033 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 2170 | Open in IMG/M |
| 3300005435|Ga0070714_100289796 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter | 1523 | Open in IMG/M |
| 3300005436|Ga0070713_102306861 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 521 | Open in IMG/M |
| 3300005447|Ga0066689_10226748 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1142 | Open in IMG/M |
| 3300005456|Ga0070678_100895572 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 811 | Open in IMG/M |
| 3300005458|Ga0070681_11749906 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 548 | Open in IMG/M |
| 3300005468|Ga0070707_101028981 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 789 | Open in IMG/M |
| 3300005529|Ga0070741_10063080 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 4281 | Open in IMG/M |
| 3300005529|Ga0070741_10705673 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 889 | Open in IMG/M |
| 3300005536|Ga0070697_100842092 | All Organisms → cellular organisms → Bacteria | 812 | Open in IMG/M |
| 3300005541|Ga0070733_10198000 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1313 | Open in IMG/M |
| 3300005542|Ga0070732_10009098 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → unclassified Acidobacteriaceae → Acidobacteriaceae bacterium KBS 89 | 5421 | Open in IMG/M |
| 3300005542|Ga0070732_10102327 | All Organisms → cellular organisms → Bacteria | 1687 | Open in IMG/M |
| 3300005557|Ga0066704_11000086 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 516 | Open in IMG/M |
| 3300005614|Ga0068856_101455268 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 699 | Open in IMG/M |
| 3300005719|Ga0068861_100067410 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 2762 | Open in IMG/M |
| 3300005764|Ga0066903_103505100 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 846 | Open in IMG/M |
| 3300005841|Ga0068863_100016840 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia | 7010 | Open in IMG/M |
| 3300005944|Ga0066788_10164334 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 569 | Open in IMG/M |
| 3300005993|Ga0080027_10011187 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 3211 | Open in IMG/M |
| 3300006175|Ga0070712_100363733 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1187 | Open in IMG/M |
| 3300006796|Ga0066665_10760525 | All Organisms → cellular organisms → Bacteria | 766 | Open in IMG/M |
| 3300006893|Ga0073928_10991176 | Not Available | 572 | Open in IMG/M |
| 3300006903|Ga0075426_11561182 | Not Available | 502 | Open in IMG/M |
| 3300007255|Ga0099791_10431293 | All Organisms → cellular organisms → Bacteria | 636 | Open in IMG/M |
| 3300009012|Ga0066710_100584581 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1693 | Open in IMG/M |
| 3300009038|Ga0099829_10051430 | All Organisms → cellular organisms → Bacteria | 3055 | Open in IMG/M |
| 3300009093|Ga0105240_10162870 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia | 2648 | Open in IMG/M |
| 3300009143|Ga0099792_10801085 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 617 | Open in IMG/M |
| 3300009551|Ga0105238_10434040 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1309 | Open in IMG/M |
| 3300010048|Ga0126373_10017910 | All Organisms → cellular organisms → Bacteria | 5923 | Open in IMG/M |
| 3300010048|Ga0126373_10102235 | All Organisms → cellular organisms → Bacteria | 2653 | Open in IMG/M |
| 3300010048|Ga0126373_10917422 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 940 | Open in IMG/M |
| 3300010048|Ga0126373_11431654 | Not Available | 757 | Open in IMG/M |
| 3300010358|Ga0126370_10097171 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 2027 | Open in IMG/M |
| 3300010358|Ga0126370_10910520 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 795 | Open in IMG/M |
| 3300010361|Ga0126378_10017252 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 6127 | Open in IMG/M |
| 3300010366|Ga0126379_11019362 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 933 | Open in IMG/M |
| 3300010366|Ga0126379_11496904 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 781 | Open in IMG/M |
| 3300010366|Ga0126379_12907689 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 573 | Open in IMG/M |
| 3300010371|Ga0134125_11226495 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 819 | Open in IMG/M |
| 3300010373|Ga0134128_10006240 | All Organisms → cellular organisms → Bacteria | 14450 | Open in IMG/M |
| 3300010376|Ga0126381_101007850 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1202 | Open in IMG/M |
| 3300010397|Ga0134124_12050363 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 610 | Open in IMG/M |
| 3300011120|Ga0150983_14855156 | All Organisms → cellular organisms → Bacteria | 697 | Open in IMG/M |
| 3300011998|Ga0120114_1117693 | All Organisms → cellular organisms → Bacteria | 508 | Open in IMG/M |
| 3300012204|Ga0137374_10996004 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 606 | Open in IMG/M |
| 3300012209|Ga0137379_11321285 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 626 | Open in IMG/M |
| 3300012212|Ga0150985_109717168 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 2101 | Open in IMG/M |
| 3300012361|Ga0137360_10842657 | All Organisms → cellular organisms → Bacteria | 790 | Open in IMG/M |
| 3300012362|Ga0137361_11508636 | Not Available | 594 | Open in IMG/M |
| 3300012683|Ga0137398_10009637 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 4819 | Open in IMG/M |
| 3300012923|Ga0137359_10030198 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 4648 | Open in IMG/M |
| 3300012944|Ga0137410_11289589 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 631 | Open in IMG/M |
| 3300012958|Ga0164299_11638966 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 508 | Open in IMG/M |
| 3300013100|Ga0157373_11029678 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 615 | Open in IMG/M |
| 3300013105|Ga0157369_11266138 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 752 | Open in IMG/M |
| 3300015371|Ga0132258_10518102 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2985 | Open in IMG/M |
| 3300019887|Ga0193729_1101148 | All Organisms → cellular organisms → Bacteria | 1097 | Open in IMG/M |
| 3300021170|Ga0210400_10530462 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 971 | Open in IMG/M |
| 3300021377|Ga0213874_10156527 | Not Available | 798 | Open in IMG/M |
| 3300021432|Ga0210384_11782612 | Not Available | 521 | Open in IMG/M |
| 3300021479|Ga0210410_10679505 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 910 | Open in IMG/M |
| 3300021559|Ga0210409_11033656 | All Organisms → cellular organisms → Bacteria | 696 | Open in IMG/M |
| 3300021560|Ga0126371_13735396 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 513 | Open in IMG/M |
| 3300024177|Ga0247686_1030331 | All Organisms → cellular organisms → Bacteria | 636 | Open in IMG/M |
| 3300025898|Ga0207692_10316609 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 954 | Open in IMG/M |
| 3300025906|Ga0207699_10491052 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 885 | Open in IMG/M |
| 3300025911|Ga0207654_10091173 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1858 | Open in IMG/M |
| 3300025915|Ga0207693_11077862 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 611 | Open in IMG/M |
| 3300025926|Ga0207659_10038436 | All Organisms → cellular organisms → Bacteria | 3329 | Open in IMG/M |
| 3300025928|Ga0207700_11134702 | All Organisms → cellular organisms → Bacteria | 698 | Open in IMG/M |
| 3300025930|Ga0207701_10348070 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1282 | Open in IMG/M |
| 3300025941|Ga0207711_10063225 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 3194 | Open in IMG/M |
| 3300026078|Ga0207702_10026119 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 4848 | Open in IMG/M |
| 3300026078|Ga0207702_11242687 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 739 | Open in IMG/M |
| 3300026116|Ga0207674_10011679 | All Organisms → cellular organisms → Bacteria | 9860 | Open in IMG/M |
| 3300026116|Ga0207674_11039158 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 788 | Open in IMG/M |
| 3300026118|Ga0207675_100105976 | All Organisms → cellular organisms → Bacteria | 2650 | Open in IMG/M |
| 3300026215|Ga0209849_1007259 | All Organisms → cellular organisms → Bacteria | 1792 | Open in IMG/M |
| 3300026291|Ga0209890_10060299 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1380 | Open in IMG/M |
| 3300027432|Ga0209421_1004045 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2697 | Open in IMG/M |
| 3300027846|Ga0209180_10018993 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 3629 | Open in IMG/M |
| 3300027867|Ga0209167_10129192 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1313 | Open in IMG/M |
| 3300031057|Ga0170834_101206577 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 518 | Open in IMG/M |
| 3300031057|Ga0170834_113059914 | Not Available | 778 | Open in IMG/M |
| 3300031128|Ga0170823_11541329 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 516 | Open in IMG/M |
| 3300031366|Ga0307506_10113325 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 906 | Open in IMG/M |
| 3300031962|Ga0307479_10865951 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 877 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 11.76% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 11.76% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 10.78% |
| Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 5.88% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 4.90% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 4.90% |
| Sugarcane Root And Bulk Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Sugarcane Root And Bulk Soil | 3.92% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 2.94% |
| Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 2.94% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 2.94% |
| Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil | 2.94% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Soil | 2.94% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 2.94% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 2.94% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 2.94% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 1.96% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 1.96% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Agricultural Soil | 1.96% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 1.96% |
| Iron-Sulfur Acid Spring | Environmental → Aquatic → Thermal Springs → Hot (42-90C) → Acidic → Iron-Sulfur Acid Spring | 0.98% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 0.98% |
| Permafrost | Environmental → Terrestrial → Soil → Unclassified → Permafrost → Permafrost | 0.98% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Corn, Switchgrass And Miscanthus Rhizosphere | 0.98% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 0.98% |
| Prmafrost Soil | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Prmafrost Soil | 0.98% |
| Corn Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere | 0.98% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 0.98% |
| Avena Fatua Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Avena Fatua Rhizosphere | 0.98% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Soil → Unclassified → Miscanthus Rhizosphere | 0.98% |
| Plant Roots | Host-Associated → Plants → Roots → Unclassified → Unclassified → Plant Roots | 0.98% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 0.98% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.98% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 0.98% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere | 0.98% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300003321 | Sugarcane bulk soil Sample H1 | Environmental | Open in IMG/M |
| 3300003324 | Sugarcane bulk soil Sample H2 | Environmental | Open in IMG/M |
| 3300004114 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of AARS Block 5 | Environmental | Open in IMG/M |
| 3300005332 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Host-Associated | Open in IMG/M |
| 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Environmental | Open in IMG/M |
| 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Environmental | Open in IMG/M |
| 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Environmental | Open in IMG/M |
| 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Environmental | Open in IMG/M |
| 3300005447 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_138 | Environmental | Open in IMG/M |
| 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Host-Associated | Open in IMG/M |
| 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Environmental | Open in IMG/M |
| 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Environmental | Open in IMG/M |
| 3300005529 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen16_06102014_R1 | Environmental | Open in IMG/M |
| 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Environmental | Open in IMG/M |
| 3300005541 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen05_05102014_R1 | Environmental | Open in IMG/M |
| 3300005542 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen04_05102014_R1 | Environmental | Open in IMG/M |
| 3300005557 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_153 | Environmental | Open in IMG/M |
| 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Host-Associated | Open in IMG/M |
| 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Host-Associated | Open in IMG/M |
| 3300005764 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2) | Environmental | Open in IMG/M |
| 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Host-Associated | Open in IMG/M |
| 3300005944 | Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil replicate 2 DNA2013-048 | Environmental | Open in IMG/M |
| 3300005993 | Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil replicate 1 DNA2013-046 | Environmental | Open in IMG/M |
| 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Environmental | Open in IMG/M |
| 3300006796 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_114 | Environmental | Open in IMG/M |
| 3300006893 | Iron sulfur acid spring bacterial and archeal communities from Banff, Canada, to study Microbial Dark Matter (Phase II) - Paint Pots PPA 5.5 metaG | Environmental | Open in IMG/M |
| 3300006903 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD5 | Host-Associated | Open in IMG/M |
| 3300007255 | Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_1 | Environmental | Open in IMG/M |
| 3300009012 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_159 | Environmental | Open in IMG/M |
| 3300009038 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaG | Environmental | Open in IMG/M |
| 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Host-Associated | Open in IMG/M |
| 3300009143 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_2 | Environmental | Open in IMG/M |
| 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Host-Associated | Open in IMG/M |
| 3300010048 | Tropical forest soil microbial communities from Panama - MetaG Plot_11 | Environmental | Open in IMG/M |
| 3300010358 | Tropical forest soil microbial communities from Panama - MetaG Plot_3 | Environmental | Open in IMG/M |
| 3300010361 | Tropical forest soil microbial communities from Panama - MetaG Plot_23 | Environmental | Open in IMG/M |
| 3300010366 | Tropical forest soil microbial communities from Panama - MetaG Plot_24 | Environmental | Open in IMG/M |
| 3300010371 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-1 | Environmental | Open in IMG/M |
| 3300010373 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-4 | Environmental | Open in IMG/M |
| 3300010376 | Tropical forest soil microbial communities from Panama - MetaG Plot_28 | Environmental | Open in IMG/M |
| 3300010397 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-4 | Environmental | Open in IMG/M |
| 3300011120 | Combined assembly of Microbial Forest Soil metaT | Environmental | Open in IMG/M |
| 3300011998 | Permafrost microbial communities from Nunavut, Canada - A30_35cm_6M | Environmental | Open in IMG/M |
| 3300012204 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_100_16 metaG | Environmental | Open in IMG/M |
| 3300012209 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_80_16 metaG | Environmental | Open in IMG/M |
| 3300012212 | Combined assembly of Hopland grassland soil | Host-Associated | Open in IMG/M |
| 3300012361 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_60_16 metaG | Environmental | Open in IMG/M |
| 3300012362 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_80_16 metaG | Environmental | Open in IMG/M |
| 3300012683 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz2.16 metaG | Environmental | Open in IMG/M |
| 3300012923 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_40_16 metaG | Environmental | Open in IMG/M |
| 3300012944 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012958 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_221_MG | Environmental | Open in IMG/M |
| 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Host-Associated | Open in IMG/M |
| 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Host-Associated | Open in IMG/M |
| 3300015371 | Combined assembly of cpr5 and col0 rhizosphere and soil | Host-Associated | Open in IMG/M |
| 3300018468 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_111 | Environmental | Open in IMG/M |
| 3300019887 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U1c2 | Environmental | Open in IMG/M |
| 3300021170 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-26-M | Environmental | Open in IMG/M |
| 3300021377 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 | Host-Associated | Open in IMG/M |
| 3300021432 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-M | Environmental | Open in IMG/M |
| 3300021479 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-4-M | Environmental | Open in IMG/M |
| 3300021559 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-M | Environmental | Open in IMG/M |
| 3300021560 | Tropical forest soil microbial communities from Panama - MetaG Plot_4 | Environmental | Open in IMG/M |
| 3300024177 | Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK27 | Environmental | Open in IMG/M |
| 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025930 | Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) | Environmental | Open in IMG/M |
| 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026215 | Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil replicate 2 DNA2013-048 (SPAdes) | Environmental | Open in IMG/M |
| 3300026291 | Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil replicate 3 DNA2013-049 (SPAdes) | Environmental | Open in IMG/M |
| 3300027432 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM2_O2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027846 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027867 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen05_05102014_R1 (SPAdes) | Environmental | Open in IMG/M |
| 3300031057 | Oak Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031128 | Oak Summer Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031366 | Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 25_S | Environmental | Open in IMG/M |
| 3300031962 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_515 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| soilH1_1000376210 | 3300003321 | Sugarcane Root And Bulk Soil | MIWWYLVVAVAAGAVLWAALSAYVWVRQRLRQAEHQTAEPPHHSE* |
| soilH1_100380493 | 3300003321 | Sugarcane Root And Bulk Soil | MIWWYLMIAVAAGAVLWAALSAYVWVRQRLRQAEHQTAEPPHHSE* |
| soilH2_101298901 | 3300003324 | Sugarcane Root And Bulk Soil | MIWWYLVVAVAAGAVLWAALSAYVWVRQRLRQAEHQTAEPPQHPE* |
| soilH2_101298919 | 3300003324 | Sugarcane Root And Bulk Soil | IVRMIWWYLVVAVAAGAVLWAALSAYVWVRQRLRQAEHQTAEPPHHSE* |
| Ga0062593_10000020610 | 3300004114 | Soil | MIWWYLIVAVAAGAVLWAALSAYIWVRQRLRQAEHQTTEPPQH* |
| Ga0066388_1001581553 | 3300005332 | Tropical Forest Soil | MIWWFLIVASSGGAVLWAVLSAFVRVRQRLRNAENKPFEPGQPSGE* |
| Ga0066388_1020344071 | 3300005332 | Tropical Forest Soil | MIWWFLTVAAAAGAVLWAGLSAYLQVRQRLRNAENRGRHSDQKTG* |
| Ga0070673_1002785143 | 3300005364 | Switchgrass Rhizosphere | YLVVAVAAGAVLWAALSAYVWVRQRLRQAEHQTSEPPQS* |
| Ga0070709_100680083 | 3300005434 | Corn, Switchgrass And Miscanthus Rhizosphere | MIWWFLIVAAAAGAVLWAGLSAYLQVRQRLRNAENKPQQNQGKSG* |
| Ga0070709_101088921 | 3300005434 | Corn, Switchgrass And Miscanthus Rhizosphere | MIWWYLMIAVAAGAVLWAALSTYVWVRQRLRQAEHQTAEPPHHSE* |
| Ga0070709_109151592 | 3300005434 | Corn, Switchgrass And Miscanthus Rhizosphere | MIWWFLIVAVAAGAVLWAALSAYVWVRQRLHNAENRPPESDQPKV* |
| Ga0070714_1001400332 | 3300005435 | Agricultural Soil | MIWWFLIVAAAAGAVLWAGLSAYLQVRQRLRNAENKPQQSQGKSG* |
| Ga0070714_1002897961 | 3300005435 | Agricultural Soil | MIWWFLIVAVASGAVLWALASSYVWVRQRLRNAENRPTPPEGESTQP* |
| Ga0070713_1023068611 | 3300005436 | Corn, Switchgrass And Miscanthus Rhizosphere | MIWWFLIVAVAAGAVLWAALSAYVWVRQRLRNAENKPADPEQPQV* |
| Ga0070710_103033102 | 3300005437 | Corn, Switchgrass And Miscanthus Rhizosphere | MIWWFLIVAVAAGAVVWAALSAYIRVRERLNKAENQPGEPEHDAGTGHQL* |
| Ga0066689_102267482 | 3300005447 | Soil | MIWWFLIVVAAAGAVLWAVLSAYLRVRERLSNAENKPAEPEHESGAGHPR* |
| Ga0070678_1008955722 | 3300005456 | Miscanthus Rhizosphere | VIVRMIWWYLIVAVAAGAVLWAALSAYIWVRQRLRQAEHQTTEPPQH* |
| Ga0070681_117499061 | 3300005458 | Corn Rhizosphere | MIWWFLIVAVASGAVLWALASSYVWVRQRLRNAENRPTPPEGE |
| Ga0070707_1010289812 | 3300005468 | Corn, Switchgrass And Miscanthus Rhizosphere | MIWWFLIVVAAAGAVLWAALSAYVRVRERLSNAENRPAEPEHESEADHQR* |
| Ga0070741_100630807 | 3300005529 | Surface Soil | MIWWFLIVAVAAGAVLWAVLSAYVQVRQRLAKAENRPPGQTPAGHES* |
| Ga0070741_107056732 | 3300005529 | Surface Soil | MIWWYLIVAVAAGAVLWAGLSAYVWVRQRLRQAEHQTAEPPHSD* |
| Ga0070697_1008420921 | 3300005536 | Corn, Switchgrass And Miscanthus Rhizosphere | MIWWFLIVAAAAGAVLWAGLSAYLQVRQRLRNAENKPQQSQ |
| Ga0070733_101980003 | 3300005541 | Surface Soil | MIWLFLIVLVAAGAVVWAILSAYVRVRQRLNNAQNRPPEPDQPEADHEI* |
| Ga0070732_100090984 | 3300005542 | Surface Soil | MIWWFLIVAAAAGAVLWAAVSAYLQVRQRLRNAENKPRHTEQKPG* |
| Ga0070732_101023273 | 3300005542 | Surface Soil | MIWWFLIVAAAAGAVLWAAVSAYLQVRRRLRNAENKPRQTEQKPG* |
| Ga0066704_110000862 | 3300005557 | Soil | MIWWFLIVVAAAGAVLWAVLSAYLRVRERLSNAENK |
| Ga0068856_1014552682 | 3300005614 | Corn Rhizosphere | MIWWFLMVAVAAGAVVWAALSAYIQVRRRLKRAANLPNE |
| Ga0068861_1000674104 | 3300005719 | Switchgrass Rhizosphere | WYLIVAVAAGAVLWAALSAYIWVRQRLRQAEHQTTEPPQH* |
| Ga0066903_1035051002 | 3300005764 | Tropical Forest Soil | MIWWFLIVAAAAGAVLWAALSAYLQVRQRLRNAENRDHRPHQKTG* |
| Ga0068863_1000168402 | 3300005841 | Switchgrass Rhizosphere | MIWWYLVVAVAAGAVLWAALSAYVWVRQRLRQAEHQTSEPPQS* |
| Ga0066788_101643342 | 3300005944 | Soil | MIWWFLIVAIAAGAVLWAALSAYIRVRQGLTKAENRPPEPDPPDAGHEL* |
| Ga0080027_100111872 | 3300005993 | Prmafrost Soil | MLNIVRMIWWFLIVAVAGGAVLWAALSAYVRVRQGLSRAENRPPEPDQPDTEHEL* |
| Ga0070712_1003637332 | 3300006175 | Corn, Switchgrass And Miscanthus Rhizosphere | MIWWFLIVAVAAGAVLWAALSAYVWVRQRLRNAENRPPDPEQPQV* |
| Ga0066665_107605252 | 3300006796 | Soil | VRMIWWFLIVAVAAGAVLWAALSAYVWVRQRLHNAENRAPDSDQPRV* |
| Ga0073928_109911762 | 3300006893 | Iron-Sulfur Acid Spring | MIWWFLIVAVAGGAVLWAALSAYIRVRQGLTKAENRPPEPDQPDTENQL* |
| Ga0075426_115611821 | 3300006903 | Populus Rhizosphere | MIWWFLIVAVAAGAVVWAALSAYIQVRRRLKRAANLPNEPGDGVSTQER* |
| Ga0099791_104312932 | 3300007255 | Vadose Zone Soil | VAAAAGAVVWAVLSAYVRVRQRLNNAQNRAPEPDHSEAGHEL* |
| Ga0066710_1005845813 | 3300009012 | Grasslands Soil | MIWWFLIVAVAGGALVWATLSAYVRVRERLRNAENNPNAGHPPR |
| Ga0099829_100514302 | 3300009038 | Vadose Zone Soil | MIWWFLIVAVAAGAVVWAVLSAYVRVRQRLTNAQNRPPEPGHSGTGHEL* |
| Ga0105240_101628701 | 3300009093 | Corn Rhizosphere | MIWWYLVVAVAAGAVLWAALSAYVSVRQRLRQAEHQTAEPPHHSE* |
| Ga0099792_108010852 | 3300009143 | Vadose Zone Soil | MFWWFLIVAAAAGAVLWAALSAYVRVRDRLKKAENKPVGGTRQP* |
| Ga0105238_104340402 | 3300009551 | Corn Rhizosphere | MIWWYLVVAVAAGAVLWAALSAYVWVRQRLRQAEH |
| Ga0126373_100179102 | 3300010048 | Tropical Forest Soil | MIWWFLIVASAGGAVLWAVLSAFVRVRQRLRNAENKPFEPEQSSGN* |
| Ga0126373_101022353 | 3300010048 | Tropical Forest Soil | MIWWFLIVASSGGAVLWAVLSAFVRVRQRLRNAENKPFEPEQPSGG* |
| Ga0126373_109174223 | 3300010048 | Tropical Forest Soil | MIWWFLIVAAAAGAVLWAALSAYLQVRQRLRNAENREPQSDQKTG* |
| Ga0126373_114316541 | 3300010048 | Tropical Forest Soil | MIWWFLTVAAAAGAVLWGGLSAYLQVRQRLRNAENRGRHSDQK |
| Ga0126370_100971714 | 3300010358 | Tropical Forest Soil | MIWWFLIVAAAAGAVLWAALSAYLQVRQRMRNAENRPRSDQKTG* |
| Ga0126370_109105202 | 3300010358 | Tropical Forest Soil | MFWWFLIVAIAAGAVVWAALSAYVRVRERLRRAENRQHEPGAETENH* |
| Ga0126378_100172524 | 3300010361 | Tropical Forest Soil | MIWWFLIVALSGGAVLWAVLSAFVRVRQRLRNSENKPFEPEQPTGG* |
| Ga0126379_110193623 | 3300010366 | Tropical Forest Soil | WFLIVALSGGAVLWAVLSAFVRVRQRLRNSENKPFEPEQPTEG* |
| Ga0126379_114969042 | 3300010366 | Tropical Forest Soil | MIWWFLIVALAGGAVLWAVLSAFIRVRQRLRNAENKPFEPGQP |
| Ga0126379_129076891 | 3300010366 | Tropical Forest Soil | ARAIVRMIWWFLIVASSGGAVLWAVLSAFVRVRQRLRNAENKPFEPGQPSGE* |
| Ga0134125_112264952 | 3300010371 | Terrestrial Soil | IVALAAGAMLWAALSAYVWVRQRLRNAENKPGDPDHTEV* |
| Ga0134128_1000624021 | 3300010373 | Terrestrial Soil | MIWWYLIVAVAAGAVLWAALSAYVWVRQRLRQAEHQTSEPPQP* |
| Ga0126381_1010078503 | 3300010376 | Tropical Forest Soil | MIWWFLTVAAAAGAVLWAGLSAYLQVRQRLRNAENR |
| Ga0134124_120503632 | 3300010397 | Terrestrial Soil | VRMIWWFLIVAAAAGAVLWAGLSAYLQVRQRLRNAENKPQHSQGKSG* |
| Ga0150983_148551562 | 3300011120 | Forest Soil | IWWFLIVAIAAGAVLWAALSAYIRVRQGLTKAENRPPEPDQPDAGREL* |
| Ga0120114_11176931 | 3300011998 | Permafrost | MIWWFLIVAVAAGAAVWAVLSAYIRVRQRLSNAANRPPEADQPEPGHDL* |
| Ga0137374_109960041 | 3300012204 | Vadose Zone Soil | VRMIWWFLIVAVAAGAVLWAALSAYVWVRQRLRNAENRPPDPEQPQL* |
| Ga0137379_113212852 | 3300012209 | Vadose Zone Soil | SSPFGILSVVRMIWWFLIVAVAAGAVLWAALSAYVWVRQRLHNAESRPPDSEPPKV* |
| Ga0150985_1097171683 | 3300012212 | Avena Fatua Rhizosphere | MIWWFLIVAVAAGAVVWAALSAYILVRKRLRRAANL |
| Ga0137360_108426572 | 3300012361 | Vadose Zone Soil | LISLFIVRMIWWFLIVAVAAGAVVWAVLSAYVRVRQRLTNAQNRPPEPGHSGTGHEL* |
| Ga0137361_115086362 | 3300012362 | Vadose Zone Soil | MIWWFLIVLVAAGAVVWAVLSAYVRVRQRLINAQNRPPGSGPEADHET* |
| Ga0137398_100096375 | 3300012683 | Vadose Zone Soil | MIWWFLIVAAAAGAVLWAGLSAYLQVRQRLRNAENKPQHSRGKSG* |
| Ga0137359_100301983 | 3300012923 | Vadose Zone Soil | MFWWFLIVAAAAGAVLWAALSAYVRVRERLKKAENKPVGGTRQP* |
| Ga0137410_112895892 | 3300012944 | Vadose Zone Soil | MIWWFLIVAGAGGAVLWAALSAYVRVRQGLHRAENRPPEPDQP |
| Ga0164299_116389662 | 3300012958 | Soil | MIWWFLIVAVAAGAVLWAALAAYVWVRQRLHNAENRPADPEQPQV* |
| Ga0157373_110296782 | 3300013100 | Corn Rhizosphere | MIWWYLVVAVAAGAVLWAALSAYVWVRQRLRQAEHQTAEP |
| Ga0157369_112661382 | 3300013105 | Corn Rhizosphere | ALAAGAMLWAALSAYVWVRQRLRNAENKPGDPDHTEV* |
| Ga0132258_105181023 | 3300015371 | Arabidopsis Rhizosphere | MIWWYLIVAVAAGAVLWAALSAYVWVRQRLRQAEHQTAEPPQH* |
| Ga0066662_109594772 | 3300018468 | Grasslands Soil | MIWWFLIVAAAAGAVFWAALSAYLQVRNRMKKAAHLHSESGPDGGHQN |
| Ga0193729_11011482 | 3300019887 | Soil | MIWWFLIVAVAAGAAVWAVLSAYIRVRQRLSNAANRPPEPDQPEPGHEL |
| Ga0210400_105304622 | 3300021170 | Soil | MFWWFLIVAVAAGAVVWAALSAYILVRKRLKRAENLPH |
| Ga0213874_101565272 | 3300021377 | Plant Roots | MIWWFLIVGLAAGAVVWALLSAFVRVKQRLANAENKPPEQGTAARP |
| Ga0210384_117826121 | 3300021432 | Soil | MIWWFLIVAIAAGAVLWAALSAYIRVRQGLTKAENRP |
| Ga0210410_106795052 | 3300021479 | Soil | MIWWFLIVAVAAGAVVWAGLSAYIRVRERLKKAENHPGEPEHRS |
| Ga0210409_110336562 | 3300021559 | Soil | LIVAVAGGAVLWAALSAYVRVRQGLSRAENRPPEPDQPDAGREL |
| Ga0126371_137353962 | 3300021560 | Tropical Forest Soil | MIWWFLIVAAAAGAVLWAALSAYLQVRQRMRNAQNRPRSDQKTG |
| Ga0247686_10303312 | 3300024177 | Soil | VIVRMIWWFLIVAAAGGAVLWAAVSAYVQVRQRLRNSENRPETAEQKARTNREA |
| Ga0207692_103166091 | 3300025898 | Corn, Switchgrass And Miscanthus Rhizosphere | ILSVVRMIWWFLIVAVAAGAVLWAGLSAYVWVRQRLHNAENRPPDPEQPHL |
| Ga0207699_104910521 | 3300025906 | Corn, Switchgrass And Miscanthus Rhizosphere | MIWWFLIVAAAAGAVLWAGLSAYLQVRQRLRNAENKPQQSQGKSG |
| Ga0207654_100911734 | 3300025911 | Corn Rhizosphere | MIWWYLVVAVAAGAVLWAALSAYVWVRQRLRQAEHQTAEPPHHSE |
| Ga0207693_110778622 | 3300025915 | Corn, Switchgrass And Miscanthus Rhizosphere | IVAVAAGAVMWAGLSAYVWVRQRLHNAENRPPDPEQPHL |
| Ga0207659_100384364 | 3300025926 | Miscanthus Rhizosphere | MIWWYLIVAVAAGAVLWAALSAYIWVRQRLRQAEHQTTEPPQH |
| Ga0207700_111347022 | 3300025928 | Corn, Switchgrass And Miscanthus Rhizosphere | MIWWFLIVAVAAGAVLWAALSAYVWVRQRLRNAENKPADPEQPQV |
| Ga0207701_103480701 | 3300025930 | Corn, Switchgrass And Miscanthus Rhizosphere | YLIVAVAAGAVLWAALSAYIWVRQRLRQAEHQTTEPPQH |
| Ga0207711_100632254 | 3300025941 | Switchgrass Rhizosphere | MIWWYLVVAVAAGAVLWAALSAYVWVRQRLRQAEHQTSEPPQS |
| Ga0207702_100261191 | 3300026078 | Corn Rhizosphere | LIVAVAGGAVLWAALSAYIWVRQRLRQAEHQTTEPPQH |
| Ga0207702_112426872 | 3300026078 | Corn Rhizosphere | MIWWFLIVAVAAGAVVWAALSAYIQVRRRLKRAANLPN |
| Ga0207674_100116792 | 3300026116 | Corn Rhizosphere | MIWWYLIVAVAAGAVLWAALSAYVWVRQRLRQAEHQTSEPPQP |
| Ga0207674_110391581 | 3300026116 | Corn Rhizosphere | MIWWYLVVAVAAGAVLWAALSAYVWVRQRLRQAEHQ |
| Ga0207675_1001059761 | 3300026118 | Switchgrass Rhizosphere | WWYLIVAVAAGAVLWAALSAYIWVRQRLRQAEHQTTEPPQH |
| Ga0209849_10072591 | 3300026215 | Soil | MIWWFLIVAIAAGAVLWAALSAYIRVRQGLTKAENRPPEPDPPDAGHEL |
| Ga0209890_100602992 | 3300026291 | Soil | MLNIVRMIWWFLIVAVAGGAVLWAALSAYVRVRQGLSRAENRPPEPDQPDTEHEL |
| Ga0209421_10040452 | 3300027432 | Forest Soil | MIWWFLIVLVAAGAVVWAALSAYVRVRQGLTKAENRPPDQEHHESEHDL |
| Ga0209180_100189936 | 3300027846 | Vadose Zone Soil | MIWWFLIVAVAAGAVVWAVLSAYVRVRQRLTNAQNRPPEPGHSGTGHEL |
| Ga0209167_101291922 | 3300027867 | Surface Soil | MIWLFLIVLVAAGAVVWAILSAYVRVRQRLNNAQNRPPEPDQPEADHEI |
| Ga0170834_1012065772 | 3300031057 | Forest Soil | WFLIVAAAAGAVLWAGLSAYLQVRQRLRNAENKPQHSQGKSG |
| Ga0170834_1130599141 | 3300031057 | Forest Soil | LNLVRMIWWFLIVLVAAGAVVWAALSAYVRVHQGLTKAENRPPEQEHHESEHDL |
| Ga0170823_115413291 | 3300031128 | Forest Soil | MIWWFLIVAAAAGAVLWAGLSAYLQVRQRLRNAENKPQHSQGKSG |
| Ga0307506_101133252 | 3300031366 | Soil | MIWWFLIVAVAGGAFVWAALSAYVRVRERLTNAENKPRRNKV |
| Ga0307479_108659512 | 3300031962 | Hardwood Forest Soil | MIWWFLIVLCAAGAVVWAVLSAYVRVRQRLNNAQNRPPEPDQPEADHEI |
| ⦗Top⦘ |