| Basic Information | |
|---|---|
| Family ID | F101642 |
| Family Type | Metagenome |
| Number of Sequences | 102 |
| Average Sequence Length | 42 residues |
| Representative Sequence | MPTDLGPAFARKRAAQAKLQTEITMLLFWLIVSLGLLFEFLA |
| Number of Associated Samples | 62 |
| Number of Associated Scaffolds | 102 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | No |
| Most common taxonomic group | Unclassified |
| % of genes with valid RBS motifs | 83.00 % |
| % of genes near scaffold ends (potentially truncated) | 43.14 % |
| % of genes from short scaffolds (< 2000 bps) | 88.24 % |
| Associated GOLD sequencing projects | 54 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.48 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Unclassified (76.471 % of family members) |
| NCBI Taxonomy ID | N/A |
| Taxonomy | N/A |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil (23.529 % of family members) |
| Environment Ontology (ENVO) | Unclassified (44.118 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (60.784 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Transmembrane (alpha-helical) | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 52.86% β-sheet: 0.00% Coil/Unstructured: 47.14% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.48 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 102 Family Scaffolds |
|---|---|---|
| PF00216 | Bac_DNA_binding | 1.96 |
| PF02729 | OTCace_N | 1.96 |
| PF00561 | Abhydrolase_1 | 0.98 |
| PF09361 | Phasin_2 | 0.98 |
| PF05128 | DUF697 | 0.98 |
| PF04280 | Tim44 | 0.98 |
| PF13183 | Fer4_8 | 0.98 |
| PF00296 | Bac_luciferase | 0.98 |
| PF02586 | SRAP | 0.98 |
| PF10686 | YAcAr | 0.98 |
| PF09539 | DUF2385 | 0.98 |
| PF01068 | DNA_ligase_A_M | 0.98 |
| PF16884 | ADH_N_2 | 0.98 |
| PF12071 | DUF3551 | 0.98 |
| PF04773 | FecR | 0.98 |
| PF00188 | CAP | 0.98 |
| PF12697 | Abhydrolase_6 | 0.98 |
| COG ID | Name | Functional Category | % Frequency in 102 Family Scaffolds |
|---|---|---|---|
| COG0776 | Bacterial nucleoid DNA-binding protein IHF-alpha | Replication, recombination and repair [L] | 1.96 |
| COG1423 | ATP-dependent RNA circularization protein, DNA/RNA ligase (PAB1020) family | Replication, recombination and repair [L] | 0.98 |
| COG1793 | ATP-dependent DNA ligase | Replication, recombination and repair [L] | 0.98 |
| COG2135 | ssDNA abasic site-binding protein YedK/HMCES, SRAP family | Replication, recombination and repair [L] | 0.98 |
| COG2141 | Flavin-dependent oxidoreductase, luciferase family (includes alkanesulfonate monooxygenase SsuD and methylene tetrahydromethanopterin reductase) | Coenzyme transport and metabolism [H] | 0.98 |
| COG2340 | Spore germination protein YkwD and related proteins with CAP (CSP/antigen 5/PR1) domain | Cell cycle control, cell division, chromosome partitioning [D] | 0.98 |
| COG3768 | Uncharacterized membrane protein YcjF, UPF0283 family | Function unknown [S] | 0.98 |
| COG4395 | Predicted lipid-binding transport protein, Tim44 family | Lipid transport and metabolism [I] | 0.98 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| Unclassified | root | N/A | 76.47 % |
| All Organisms | root | All Organisms | 23.53 % |
| Visualization |
|---|
| Powered by ApexCharts |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 23.53% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 20.59% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 16.67% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 14.71% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment | 8.82% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 5.88% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 2.94% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 1.96% |
| Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 0.98% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 0.98% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 0.98% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 0.98% |
| Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 0.98% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300004633 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 1 MoBio | Environmental | Open in IMG/M |
| 3300005179 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_133 | Environmental | Open in IMG/M |
| 3300005332 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Environmental | Open in IMG/M |
| 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Environmental | Open in IMG/M |
| 3300005764 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2) | Environmental | Open in IMG/M |
| 3300006052 | Freshwater sediment microbial communities from North America - Little Laurel Run_MetaG_LLR_2013 | Environmental | Open in IMG/M |
| 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Environmental | Open in IMG/M |
| 3300009012 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_159 | Environmental | Open in IMG/M |
| 3300010046 | Tropical forest soil microbial communities from Panama - MetaG Plot_36 | Environmental | Open in IMG/M |
| 3300010048 | Tropical forest soil microbial communities from Panama - MetaG Plot_11 | Environmental | Open in IMG/M |
| 3300010358 | Tropical forest soil microbial communities from Panama - MetaG Plot_3 | Environmental | Open in IMG/M |
| 3300010361 | Tropical forest soil microbial communities from Panama - MetaG Plot_23 | Environmental | Open in IMG/M |
| 3300010366 | Tropical forest soil microbial communities from Panama - MetaG Plot_24 | Environmental | Open in IMG/M |
| 3300010376 | Tropical forest soil microbial communities from Panama - MetaG Plot_28 | Environmental | Open in IMG/M |
| 3300012971 | Tropical forest soil microbial communities from Panama - MetaG Plot_1 | Environmental | Open in IMG/M |
| 3300016270 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080 | Environmental | Open in IMG/M |
| 3300016294 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178 | Environmental | Open in IMG/M |
| 3300016319 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.00H | Environmental | Open in IMG/M |
| 3300016341 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 | Environmental | Open in IMG/M |
| 3300016357 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.000 | Environmental | Open in IMG/M |
| 3300016387 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176 | Environmental | Open in IMG/M |
| 3300016404 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082 | Environmental | Open in IMG/M |
| 3300016422 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111 | Environmental | Open in IMG/M |
| 3300016445 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108 | Environmental | Open in IMG/M |
| 3300017822 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_2 | Environmental | Open in IMG/M |
| 3300017924 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_5 | Environmental | Open in IMG/M |
| 3300017932 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW-S_4 | Environmental | Open in IMG/M |
| 3300017933 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_1 | Environmental | Open in IMG/M |
| 3300017942 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW_3 | Environmental | Open in IMG/M |
| 3300017970 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_SJ02_MP02_20_MG | Environmental | Open in IMG/M |
| 3300017994 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SourceSoil_2 | Environmental | Open in IMG/M |
| 3300021560 | Tropical forest soil microbial communities from Panama - MetaG Plot_4 | Environmental | Open in IMG/M |
| 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027070 | Forest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaG HF004 (SPAdes) | Environmental | Open in IMG/M |
| 3300027787 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Plitter (SPAdes) | Environmental | Open in IMG/M |
| 3300031543 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f20 | Environmental | Open in IMG/M |
| 3300031561 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f26 | Environmental | Open in IMG/M |
| 3300031573 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.AN111 | Environmental | Open in IMG/M |
| 3300031744 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.00H (v2) | Environmental | Open in IMG/M |
| 3300031754 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_515 | Environmental | Open in IMG/M |
| 3300031770 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f17 | Environmental | Open in IMG/M |
| 3300031781 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f20 | Environmental | Open in IMG/M |
| 3300031796 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f24 | Environmental | Open in IMG/M |
| 3300031821 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f20 | Environmental | Open in IMG/M |
| 3300031833 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.LF178 | Environmental | Open in IMG/M |
| 3300031879 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.172 (v2) | Environmental | Open in IMG/M |
| 3300031880 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.168b4f25 | Environmental | Open in IMG/M |
| 3300031890 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176 (v2) | Environmental | Open in IMG/M |
| 3300031896 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f19 | Environmental | Open in IMG/M |
| 3300031912 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080 (v2) | Environmental | Open in IMG/M |
| 3300031941 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.OX080 | Environmental | Open in IMG/M |
| 3300031945 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.OX082 | Environmental | Open in IMG/M |
| 3300031946 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.HF172 | Environmental | Open in IMG/M |
| 3300031954 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178 (v2) | Environmental | Open in IMG/M |
| 3300032001 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082 (v2) | Environmental | Open in IMG/M |
| 3300032039 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f21 | Environmental | Open in IMG/M |
| 3300032091 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f25 | Environmental | Open in IMG/M |
| 3300032205 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_05 | Environmental | Open in IMG/M |
| 3300032261 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 (v2) | Environmental | Open in IMG/M |
| 3300033289 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.AN108 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| Ga0066395_103129151 | 3300004633 | Tropical Forest Soil | MPTDLGPAFARKRAAQAKLQTEITMLLFWLIVSLGLLFEF |
| Ga0066684_103695562 | 3300005179 | Soil | GQLGERQSVMPTDLAPALARKRAAQLQLQIEINMMLFWCIVMLGLTFEFLA* |
| Ga0066388_1000871991 | 3300005332 | Tropical Forest Soil | MPTDFEPVSARKRAAQAQAQPEITMLLFWLIICLGMVGLLFEVVGK* |
| Ga0066388_1001346471 | 3300005332 | Tropical Forest Soil | MPTDLAPAFARKRAAQAKLQTEITMLLFWLVVSLGLLFEFLGK* |
| Ga0066388_1012862292 | 3300005332 | Tropical Forest Soil | MPTDLAPALARKRAAQAQLQIEINMMLFWSIIMFGLMFEFLA* |
| Ga0066388_1016499411 | 3300005332 | Tropical Forest Soil | MPTDIAPALARKRAAQAKLQTEITMLLFWLIVSLGLLFEFLGNSS* |
| Ga0066388_1034396221 | 3300005332 | Tropical Forest Soil | MPTDLAPALARKRAAQAQLQIEINMMLFWSIICLGLMFEFLA* |
| Ga0066388_1039818561 | 3300005332 | Tropical Forest Soil | MPTDLDAAFARKRAAQAKLQTEITMLLFWLIVSLGLLFEFLGNSS* |
| Ga0066388_1049305581 | 3300005332 | Tropical Forest Soil | MPTDLAPALARKRAAQAQLQIEINMMLFWSIIMLGLMFEFLA* |
| Ga0066388_1055713182 | 3300005332 | Tropical Forest Soil | MPTDLAVFARKRAAQAKVQTEITMLLFWLIVSLGLLFEFLGNSS* |
| Ga0066388_1062011501 | 3300005332 | Tropical Forest Soil | MPTDLGLAFAQKRAAQAKLQTEITMLLFWLIVSLGLLFEFLA* |
| Ga0066388_1069051682 | 3300005332 | Tropical Forest Soil | MPTDLAPALARKRAAQAQLQIEINMMLFSLIIWLGLMFEFLA* |
| Ga0070713_1020740852 | 3300005436 | Corn, Switchgrass And Miscanthus Rhizosphere | MPTDLNPALGRKRAAQAKLQTEITVLLFWLIMCLGLLFEFLGNSS* |
| Ga0070697_1014566611 | 3300005536 | Corn, Switchgrass And Miscanthus Rhizosphere | IMPTDLAPAFARKRAAQAKLQTEITILLFWLIMCVGLLFEFFGNSS* |
| Ga0066903_1018990732 | 3300005764 | Tropical Forest Soil | MPTDLAPALARKRAAQAQLQIEINTMLFWSIIMFGLMFEFLA* |
| Ga0066903_1024666731 | 3300005764 | Tropical Forest Soil | MPTDLAPALARKRAAQAQLQIEINMMLFWSIIMLGLMFEFFA* |
| Ga0066903_1056128902 | 3300005764 | Tropical Forest Soil | MPTDLAPALARKRAAQAQLQIEINMTLFWSIIMLGLMFEFLA* |
| Ga0066903_1074385791 | 3300005764 | Tropical Forest Soil | MPTDLGPAFARKRAAQAKLQTEITMLLFWLIVSLGLLFEFL |
| Ga0066903_1085255012 | 3300005764 | Tropical Forest Soil | MPTDLAPALARKRAAQAQSQIEINMMLFWSIIMFGLMFEFLA* |
| Ga0066903_1091517701 | 3300005764 | Tropical Forest Soil | MPTDLGPAFARKRAAQAKLQTEITMLLFWLIVSLG |
| Ga0075029_1013376921 | 3300006052 | Watersheds | IMPTDLAPAFARKRAAQAKLQTEITMLLFWLIVSLGLLFEFLGNSS* |
| Ga0070712_1003669522 | 3300006175 | Corn, Switchgrass And Miscanthus Rhizosphere | MPTDLAPAFARKRAAQAQLQTEINMLLFWSIIMLGLMFEFLA* |
| Ga0070712_1009947041 | 3300006175 | Corn, Switchgrass And Miscanthus Rhizosphere | MPTDLTPAFARKRAAQAKLQTEITMLLFWLIVSLG |
| Ga0066710_1019052231 | 3300009012 | Grasslands Soil | MPTDLAPAFARKRAAQAKLQTEISIMLFCLVVSLGLLFEFLGNSS |
| Ga0126384_106708132 | 3300010046 | Tropical Forest Soil | MPTDLGPAFARKRAAQAKLQTEIATLLFWLIVSLGL |
| Ga0126373_103516661 | 3300010048 | Tropical Forest Soil | MPTDLGPAFARKRAAQAKLQTEITMLLFWLIVSLGLLFEFLA* |
| Ga0126373_105769872 | 3300010048 | Tropical Forest Soil | MPTDLAPALARKRAAQLQLQIEINMMLFWCIMMLGLFFEFIA* |
| Ga0126373_106699074 | 3300010048 | Tropical Forest Soil | RPIMPTDLDPAFARKRAAQAKIQTEITMLLFWLIMCLGLLFEFLGNSS* |
| Ga0126370_103046221 | 3300010358 | Tropical Forest Soil | IMPTDLGPAFARKRAAQAKLQTEIATLLFWLIVSLGLLFEFL* |
| Ga0126378_125287631 | 3300010361 | Tropical Forest Soil | MPTDLGPAFARKRAAQAKLQTEIATLLFWLIVSLGLL |
| Ga0126379_114907921 | 3300010366 | Tropical Forest Soil | MPTDLAPALARKRAAQAQLQIEINTMLFWSIIMLGLMFEFYA* |
| Ga0126379_123287171 | 3300010366 | Tropical Forest Soil | MPTDLAPALARKRATQARLQTEINMLLFGLIICLGLMFEFLG |
| Ga0126381_1006012452 | 3300010376 | Tropical Forest Soil | MPTDIAPALARKGAAQAKLQTEITMLLFWLIVSLGLLFEFLGNSS* |
| Ga0126381_1008175153 | 3300010376 | Tropical Forest Soil | MPTDLGPAFARKRAAQAKVQTEITMLLFWLIMCLGLLFEFLGNGS* |
| Ga0126381_1011488515 | 3300010376 | Tropical Forest Soil | MPTDLDPAFAQKRAAQAKKQTEITMLLFWLIMCLGLLFEFLGNSS* |
| Ga0126381_1027385012 | 3300010376 | Tropical Forest Soil | MPTDLDPVSARKRTAQAQAQPEITMLLFWLIISLGMLGLLFEVLAR* |
| Ga0126381_1038355701 | 3300010376 | Tropical Forest Soil | MPTDFEPVSARKRAAQAQAQPEITMLLFWLIICLGMVGLLFEV |
| Ga0126369_102955561 | 3300012971 | Tropical Forest Soil | PTDLAPAFARKRAAQAKLQTEITMLLFWLIVSLGLLFEFLGNSS* |
| Ga0182036_105395431 | 3300016270 | Soil | MPTDLAPVFARKRAAQAKLQTEIMMLLFWLIVCLGLLFEFLDS |
| Ga0182041_1000229218 | 3300016294 | Soil | MPTDLAPAFARKRAAQAKLQTEITMLLFWLIVSLGLLFEFLGNSSEPATLT |
| Ga0182033_103707842 | 3300016319 | Soil | MPTDLAPALARKRAAQARLQIEINMMLFWSIIMFGLMFEFLAL |
| Ga0182035_105979512 | 3300016341 | Soil | MRATIMPTDLGPAFARKRAAQAKLQTEITMLLFWLIVSLGLLFEFLA |
| Ga0182032_1000064422 | 3300016357 | Soil | MPTDLGPVSVGKRAGQAQAQTETTMLLFWLIICLGMLVLFFEVQ |
| Ga0182032_105099081 | 3300016357 | Soil | MPTDLAPVFARKRAAQAKLQTEITMLLFWLVVSLGL |
| Ga0182040_112026592 | 3300016387 | Soil | MPTDLAPALARKRMAQAQLQTEINMLLFWSVIMLGLMFEFLA |
| Ga0182040_113777651 | 3300016387 | Soil | MPTDLAPVFARKRAAQAKLQTEIMMLLFWLIMCLGLL |
| Ga0182037_101767342 | 3300016404 | Soil | MPTDLAPALARKRAAQARLQIEINMMLFWSIIMFGLMFEFLA |
| Ga0182037_114439321 | 3300016404 | Soil | MPTDLEVPARKRAAQAHAQTEITMLLFWLIMCLGLLFE |
| Ga0182039_100291921 | 3300016422 | Soil | MPTDFEPVSARKRAAQAQAQPEITMLLFWLIICLGMVGLLFEVV |
| Ga0182039_122110032 | 3300016422 | Soil | MPTDLAPALARKRAAQAQLQTQINMLLFSSIIMLGLMFEFLA |
| Ga0182038_116343591 | 3300016445 | Soil | MPTDLDPAFARKRAAQSHAQTEITILLVWLIFCLGLLLVILGLFEVFGQ |
| Ga0187802_100384752 | 3300017822 | Freshwater Sediment | MPTDVDKAFARKHAAQAKVQTEINIMLFWLIVCLGLLFEFLGSSP |
| Ga0187802_100434121 | 3300017822 | Freshwater Sediment | MPTDVDQAFARKRAAQAKVQTEIAMLLFWLIMCLGLLFEFLGSGS |
| Ga0187802_100626111 | 3300017822 | Freshwater Sediment | MPTDLAPAFARKRAAQAKLQTEITMLLFWLIVSLGLLFEFSS |
| Ga0187820_10004602 | 3300017924 | Freshwater Sediment | MPTDVDQAFARKHEAQAKVQTEINIMLFWLIVCLGLLFEFLGSSS |
| Ga0187814_102945572 | 3300017932 | Freshwater Sediment | MPTDVDQAFARKHAAQAKVQTEINIMLFWLIVCLGLLFEFLGSSS |
| Ga0187801_102164151 | 3300017933 | Freshwater Sediment | MPTDVDQAFARKRAAQAKVQTEINILLFSLIVCLGLLFEFLGASS |
| Ga0187808_101592753 | 3300017942 | Freshwater Sediment | MPTDVDKAFARKHAAQAKVQTEINIMLFWLIVCLGLLFEFLGSSS |
| Ga0187783_105323391 | 3300017970 | Tropical Peatland | MPTDLDQAFARKRAAQAELQTEISMLLFWLIVCLGLLFEFLGNGS |
| Ga0187822_100131443 | 3300017994 | Freshwater Sediment | MPTDVDQAFARKHAAQAKVQTEINIMLFWLIVCLGLLFEFLGSSP |
| Ga0187822_103435742 | 3300017994 | Freshwater Sediment | MPTDVDQAFTRKRAAQAKVQTEIAMLLFWLIMCLGLLFEFLGSGS |
| Ga0126371_134451411 | 3300021560 | Tropical Forest Soil | MPTDLAPALARKRAAQLQLQIEINMMLFWCIMMLGLFFEFIA |
| Ga0207693_106445871 | 3300025915 | Corn, Switchgrass And Miscanthus Rhizosphere | MPTDLAPAFARKRAAQAQLQTEINMLLFWSIIMLGLMFEFLA |
| Ga0207700_108547993 | 3300025928 | Corn, Switchgrass And Miscanthus Rhizosphere | SIMPTDLAPAFARKRAAQAKLQTEITMLLFWLIVSLGLLFEFLGNSS |
| Ga0208365_10031291 | 3300027070 | Forest Soil | MPTDLDPAFARKRAAQAKVQTEITMLLFWLIMCLGLLFEFLGNSS |
| Ga0208365_10220492 | 3300027070 | Forest Soil | ARKRAAQAKLQTEITMLLFWVIVSLGLLFEFLGNSS |
| Ga0209074_103391482 | 3300027787 | Agricultural Soil | LGRKRAAQAKLQTEITVLLFWLIMCLGLLFEFLGNSS |
| Ga0318516_102749161 | 3300031543 | Soil | MPTDLGPAFARKRAAQAKVQTEITMLLFWLIMCLGLLFEFLGNGS |
| Ga0318516_104940842 | 3300031543 | Soil | MPTDFEPVSARKRAAQAQAQPEITMLLFWLIICLGMVGLLFEVVGK |
| Ga0318528_104705821 | 3300031561 | Soil | MPTDLGPAFARKRAAQAKVQTEITMLLFWLIMCLGLLFEFLG |
| Ga0318528_107655211 | 3300031561 | Soil | MPTDLAPAFARKRAAQAKLQTEITMLLFWLIICLGLLFEFLGNSS |
| Ga0310915_100972292 | 3300031573 | Soil | MPTDLGPAFARKRAAQAKLQTEITMLLFWLIVSLGLLFEFLA |
| Ga0306918_102349031 | 3300031744 | Soil | MPTDLGPAFARKRAAQAKLQTEITMLLFWLIVSLGLL |
| Ga0306918_106858682 | 3300031744 | Soil | MPTDLAPVFARKRAAQAKLQTEIMMLLFWLIMWLGLLFEFLDS |
| Ga0306918_109818042 | 3300031744 | Soil | FARKRAAQAKLQTEITMLLFWLIICLGLLFEFLGNSS |
| Ga0307475_100706714 | 3300031754 | Hardwood Forest Soil | MPTDLDPAFARKRAAQAKVQTEITMLLFCLIVSFGLLFEFLG |
| Ga0307475_112609511 | 3300031754 | Hardwood Forest Soil | LDPAFARKRAAQAKVQTEITMLLFWLIMCLGLLFEFLGNSS |
| Ga0318521_106280501 | 3300031770 | Soil | MPTDLDPAFARKRAAQAKIQTEITMLLFWLIMCLGLLFEFL |
| Ga0318547_107042372 | 3300031781 | Soil | MPTDLAPALARKRAAQAQLQIEINMMLFWSIIMFGLMFEFLAL |
| Ga0318547_107405582 | 3300031781 | Soil | RYIMPTDFEPVSARKRAAQAQAQPEITMLLFWLIICLGMVGLLFEVVGK |
| Ga0318576_100235156 | 3300031796 | Soil | MPTDLGPAFARKRAAQAKVQTEITMLLFWLIMCLG |
| Ga0318567_101023275 | 3300031821 | Soil | MPTDLGPAFARKRAAQAKVQTEITMLLFWLIMCLGLLFEF |
| Ga0310917_100334325 | 3300031833 | Soil | MPTDLAPAFARKRAAQAKLQTEITMLLFWLVVSLGLLFEFLGK |
| Ga0310917_109339461 | 3300031833 | Soil | MRSTMPTDLAPAFARKRAAQAKLQTEITMLLFWLIICLGLL |
| Ga0310917_111930942 | 3300031833 | Soil | MPTDLAPALARKRAAQAQLQIEINMMLFWSIIMFGLMFEFL |
| Ga0306919_104753263 | 3300031879 | Soil | MPTDLAPALARKRAAQAQLQIEINMMLFWSIIMFGLMFEFLA |
| Ga0306919_104942131 | 3300031879 | Soil | MRSTMPTDLAPAFARKRAAQAKLQTEITMLLFWLIICLGLLFE |
| Ga0318544_103095301 | 3300031880 | Soil | MPTDLGPAFARKRAAQAKVQTEITMLLFWLIMCLGLLFE |
| Ga0306925_108823672 | 3300031890 | Soil | MPTDLAPVFARKRAAQAKLQTEIMMLLFWLIMCLGLLFEFLDS |
| Ga0318551_102973182 | 3300031896 | Soil | MPTDLAPAFARKRAAQAKLQTEITMLLFWLIICLG |
| Ga0306921_116786382 | 3300031912 | Soil | MPTDLAPALARKRAAQAQLQTEINMMLFWSIIMFGLMFEFLA |
| Ga0310912_112820271 | 3300031941 | Soil | MRSTMPTDLAPAFARKRAAQAKLQTEITMLLFWLIICLGLLFEFLGNSS |
| Ga0310913_101546543 | 3300031945 | Soil | PIMPTDLGPAFARKRAAQAKLQTEIATLLFWLIVSLGLLFEFL |
| Ga0310910_111045531 | 3300031946 | Soil | MPTDLAPVFARKRAAQAKLQTEIMMLLFWLIMWLGLLF |
| Ga0306926_126388551 | 3300031954 | Soil | RKRAAQAKLQTEITMLLFWLIVSLGLLFEFLGNSS |
| Ga0306926_128415862 | 3300031954 | Soil | MPTDLALALARKRAAQAHLMLLFGLIIMVGLMVEFLAFS |
| Ga0306922_107043914 | 3300032001 | Soil | MPTDLDPAFARKRAAQAKIQTEITMLLFWLIMCLGLLFEFLGNSS |
| Ga0318559_103159731 | 3300032039 | Soil | MPTDLAPAFARKRAAQAKLQTEITMLLFWLVVSLGLLFE |
| Ga0318577_105151961 | 3300032091 | Soil | CFIGHSERWPIMPTDLAPAFARKRAAQAKLQTEITMLLFWLIICLGLLFEFLGNSS |
| Ga0307472_1015604331 | 3300032205 | Hardwood Forest Soil | FARKRAAQAKLQTEITMLLFWLVVSLGLLFEFLGNSS |
| Ga0306920_1041349572 | 3300032261 | Soil | TDLGPAFARKRAAQAKLQTEITMLLFWLIVSLGLLFEFLA |
| Ga0310914_101603541 | 3300033289 | Soil | PAFARKRAAQAKLQTEITMLLFWLIVSLGLLFEFLA |
| ⦗Top⦘ |