| Basic Information | |
|---|---|
| Family ID | F101632 |
| Family Type | Metagenome |
| Number of Sequences | 102 |
| Average Sequence Length | 46 residues |
| Representative Sequence | ARGRPVDIVFAVYLQSRRPAVRAAVLDADTDEVLGPTGTRESAVL |
| Number of Associated Samples | 93 |
| Number of Associated Scaffolds | 102 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | No |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 23.53 % |
| % of genes near scaffold ends (potentially truncated) | 61.76 % |
| % of genes from short scaffolds (< 2000 bps) | 90.20 % |
| Associated GOLD sequencing projects | 89 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.30 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (59.804 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil (15.686 % of family members) |
| Environment Ontology (ENVO) | Unclassified (24.510 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (57.843 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 0.00% β-sheet: 16.44% Coil/Unstructured: 83.56% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.30 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 102 Family Scaffolds |
|---|---|---|
| PF13191 | AAA_16 | 9.80 |
| PF00501 | AMP-binding | 9.80 |
| PF08281 | Sigma70_r4_2 | 5.88 |
| PF13466 | STAS_2 | 1.96 |
| PF01663 | Phosphodiest | 1.96 |
| PF02729 | OTCace_N | 0.98 |
| PF07690 | MFS_1 | 0.98 |
| PF09678 | Caa3_CtaG | 0.98 |
| PF04655 | APH_6_hur | 0.98 |
| PF13193 | AMP-binding_C | 0.98 |
| PF13751 | DDE_Tnp_1_6 | 0.98 |
| PF05598 | DUF772 | 0.98 |
| PF07291 | MauE | 0.98 |
| PF01636 | APH | 0.98 |
| COG ID | Name | Functional Category | % Frequency in 102 Family Scaffolds |
|---|---|---|---|
| COG3570 | Streptomycin 6-kinase | Defense mechanisms [V] | 0.98 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 59.80 % |
| Unclassified | root | N/A | 40.20 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 2170459024|GZRSKLJ02JG3DR | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales | 548 | Open in IMG/M |
| 3300003368|JGI26340J50214_10000461 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 14278 | Open in IMG/M |
| 3300004114|Ga0062593_102629487 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 572 | Open in IMG/M |
| 3300005331|Ga0070670_102051708 | Not Available | 527 | Open in IMG/M |
| 3300005332|Ga0066388_102406099 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales | 955 | Open in IMG/M |
| 3300005434|Ga0070709_10919670 | Not Available | 692 | Open in IMG/M |
| 3300005434|Ga0070709_11002236 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales | 664 | Open in IMG/M |
| 3300005435|Ga0070714_100801015 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales | 912 | Open in IMG/M |
| 3300005435|Ga0070714_101628829 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales | 630 | Open in IMG/M |
| 3300005436|Ga0070713_101857919 | All Organisms → cellular organisms → Bacteria | 584 | Open in IMG/M |
| 3300005439|Ga0070711_101043844 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales | 702 | Open in IMG/M |
| 3300005439|Ga0070711_101970238 | Not Available | 514 | Open in IMG/M |
| 3300005454|Ga0066687_10778845 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Streptosporangiaceae → Streptosporangium → Streptosporangium roseum | 569 | Open in IMG/M |
| 3300005458|Ga0070681_11219035 | Not Available | 674 | Open in IMG/M |
| 3300005466|Ga0070685_10592285 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 797 | Open in IMG/M |
| 3300005518|Ga0070699_100975638 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales | 777 | Open in IMG/M |
| 3300005529|Ga0070741_10250961 | Not Available | 1685 | Open in IMG/M |
| 3300005543|Ga0070672_100773470 | Not Available | 844 | Open in IMG/M |
| 3300005563|Ga0068855_102285641 | Not Available | 541 | Open in IMG/M |
| 3300005841|Ga0068863_100632516 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales | 1060 | Open in IMG/M |
| 3300006028|Ga0070717_11977922 | All Organisms → cellular organisms → Bacteria | 525 | Open in IMG/M |
| 3300006175|Ga0070712_100810753 | Not Available | 803 | Open in IMG/M |
| 3300006175|Ga0070712_100949943 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 742 | Open in IMG/M |
| 3300006175|Ga0070712_101292848 | Not Available | 635 | Open in IMG/M |
| 3300006176|Ga0070765_101541570 | All Organisms → cellular organisms → Bacteria | 625 | Open in IMG/M |
| 3300006871|Ga0075434_100285979 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales | 1668 | Open in IMG/M |
| 3300006904|Ga0075424_102652233 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales | 523 | Open in IMG/M |
| 3300009038|Ga0099829_10245609 | Not Available | 1458 | Open in IMG/M |
| 3300009162|Ga0075423_10443070 | Not Available | 1364 | Open in IMG/M |
| 3300010159|Ga0099796_10159384 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 893 | Open in IMG/M |
| 3300010373|Ga0134128_11636486 | Not Available | 709 | Open in IMG/M |
| 3300010379|Ga0136449_101361993 | Not Available | 1100 | Open in IMG/M |
| 3300010399|Ga0134127_10492241 | Not Available | 1236 | Open in IMG/M |
| 3300010401|Ga0134121_10544143 | Not Available | 1077 | Open in IMG/M |
| 3300011120|Ga0150983_15473557 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 528 | Open in IMG/M |
| 3300011271|Ga0137393_10195694 | Not Available | 1704 | Open in IMG/M |
| 3300012189|Ga0137388_10688628 | Not Available | 949 | Open in IMG/M |
| 3300012208|Ga0137376_11698294 | All Organisms → cellular organisms → Bacteria | 522 | Open in IMG/M |
| 3300012351|Ga0137386_10508300 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 868 | Open in IMG/M |
| 3300012500|Ga0157314_1019742 | Not Available | 676 | Open in IMG/M |
| 3300012917|Ga0137395_10274547 | Not Available | 1189 | Open in IMG/M |
| 3300012918|Ga0137396_10496823 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 904 | Open in IMG/M |
| 3300012924|Ga0137413_11840086 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 501 | Open in IMG/M |
| 3300012951|Ga0164300_10057210 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1566 | Open in IMG/M |
| 3300012961|Ga0164302_11488145 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 557 | Open in IMG/M |
| 3300014052|Ga0120109_1123020 | Not Available | 604 | Open in IMG/M |
| 3300014489|Ga0182018_10727821 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 516 | Open in IMG/M |
| 3300017926|Ga0187807_1262476 | Not Available | 568 | Open in IMG/M |
| 3300017948|Ga0187847_10153574 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales | 1258 | Open in IMG/M |
| 3300020579|Ga0210407_10032125 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 3905 | Open in IMG/M |
| 3300020580|Ga0210403_10686519 | Not Available | 821 | Open in IMG/M |
| 3300020582|Ga0210395_10994373 | Not Available | 621 | Open in IMG/M |
| 3300021171|Ga0210405_10787965 | All Organisms → cellular organisms → Bacteria | 729 | Open in IMG/M |
| 3300021178|Ga0210408_10054681 | Not Available | 3117 | Open in IMG/M |
| 3300021402|Ga0210385_11044210 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 628 | Open in IMG/M |
| 3300021403|Ga0210397_10033217 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 3232 | Open in IMG/M |
| 3300021406|Ga0210386_11778564 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 508 | Open in IMG/M |
| 3300021420|Ga0210394_10070189 | Not Available | 3036 | Open in IMG/M |
| 3300021432|Ga0210384_10130083 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Thermomonosporaceae → Actinomadura | 2259 | Open in IMG/M |
| 3300021477|Ga0210398_10173502 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1757 | Open in IMG/M |
| 3300021477|Ga0210398_11309672 | All Organisms → cellular organisms → Bacteria | 569 | Open in IMG/M |
| 3300021478|Ga0210402_10755799 | All Organisms → cellular organisms → Bacteria | 896 | Open in IMG/M |
| 3300021479|Ga0210410_10188153 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Thermomonosporaceae → Actinomadura | 1848 | Open in IMG/M |
| 3300021559|Ga0210409_10247147 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales | 1616 | Open in IMG/M |
| 3300025898|Ga0207692_10771275 | Not Available | 627 | Open in IMG/M |
| 3300025916|Ga0207663_10985538 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → unclassified Streptosporangiales → Streptosporangiales bacterium | 676 | Open in IMG/M |
| 3300026088|Ga0207641_11004820 | Not Available | 831 | Open in IMG/M |
| 3300026475|Ga0257147_1015071 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1052 | Open in IMG/M |
| 3300026551|Ga0209648_10148481 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Streptosporangiaceae | 1854 | Open in IMG/M |
| 3300026552|Ga0209577_10078103 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 2727 | Open in IMG/M |
| 3300027076|Ga0208860_1006389 | Not Available | 1029 | Open in IMG/M |
| 3300027166|Ga0208729_105839 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 716 | Open in IMG/M |
| 3300027570|Ga0208043_1078575 | Not Available | 917 | Open in IMG/M |
| 3300027725|Ga0209178_1210387 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii | 691 | Open in IMG/M |
| 3300027869|Ga0209579_10183640 | Not Available | 1119 | Open in IMG/M |
| 3300027884|Ga0209275_10335083 | All Organisms → cellular organisms → Bacteria | 845 | Open in IMG/M |
| 3300028718|Ga0307307_10048264 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales | 1242 | Open in IMG/M |
| 3300028781|Ga0302223_10124767 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 851 | Open in IMG/M |
| 3300028784|Ga0307282_10007656 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 4272 | Open in IMG/M |
| 3300028792|Ga0307504_10050186 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1189 | Open in IMG/M |
| 3300028793|Ga0307299_10289838 | Not Available | 615 | Open in IMG/M |
| 3300028795|Ga0302227_10097946 | Not Available | 1219 | Open in IMG/M |
| 3300028801|Ga0302226_10405587 | All Organisms → cellular organisms → Bacteria | 570 | Open in IMG/M |
| 3300028828|Ga0307312_10014795 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 4366 | Open in IMG/M |
| 3300028828|Ga0307312_10118883 | Not Available | 1654 | Open in IMG/M |
| 3300028879|Ga0302229_10079081 | Not Available | 1580 | Open in IMG/M |
| 3300028884|Ga0307308_10019383 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 3114 | Open in IMG/M |
| 3300028906|Ga0308309_10637005 | Not Available | 926 | Open in IMG/M |
| 3300028906|Ga0308309_11088630 | All Organisms → cellular organisms → Bacteria | 691 | Open in IMG/M |
| 3300029882|Ga0311368_10493252 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 882 | Open in IMG/M |
| 3300029882|Ga0311368_11048017 | Not Available | 534 | Open in IMG/M |
| 3300029910|Ga0311369_10635193 | All Organisms → cellular organisms → Bacteria | 886 | Open in IMG/M |
| 3300029999|Ga0311339_11399299 | All Organisms → cellular organisms → Bacteria | 628 | Open in IMG/M |
| 3300030520|Ga0311372_10941046 | Not Available | 1152 | Open in IMG/M |
| 3300030618|Ga0311354_10716104 | Not Available | 955 | Open in IMG/M |
| 3300030659|Ga0316363_10093883 | Not Available | 1342 | Open in IMG/M |
| 3300031028|Ga0302180_10344155 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 757 | Open in IMG/M |
| 3300031740|Ga0307468_100819338 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 796 | Open in IMG/M |
| 3300032074|Ga0308173_10473394 | Not Available | 1117 | Open in IMG/M |
| 3300032160|Ga0311301_11014059 | Not Available | 1095 | Open in IMG/M |
| 3300032782|Ga0335082_10501181 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1076 | Open in IMG/M |
| 3300033412|Ga0310810_10797885 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii | 854 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 15.69% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 11.76% |
| Palsa | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa | 10.78% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 9.80% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 8.82% |
| Peatlands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil | 3.92% |
| Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil | 3.92% |
| Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 2.94% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 2.94% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 2.94% |
| Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 1.96% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 1.96% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Agricultural Soil | 1.96% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 1.96% |
| Peatland | Environmental → Aquatic → Freshwater → Wetlands → Bog → Peatland | 0.98% |
| Bog Forest Soil | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil | 0.98% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment | 0.98% |
| Grass Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grass Soil | 0.98% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 0.98% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 0.98% |
| Permafrost | Environmental → Terrestrial → Soil → Unclassified → Permafrost → Permafrost | 0.98% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 0.98% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 0.98% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 0.98% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 0.98% |
| Palsa | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Palsa | 0.98% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 0.98% |
| Corn Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere | 0.98% |
| Switchgrass Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere | 0.98% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 0.98% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Rhizosphere | 0.98% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 0.98% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere | 0.98% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 2170459024 | Grass soil microbial communities from Rothamsted Park, UK - FD1 (NaCl 300g/L 5ml) | Environmental | Open in IMG/M |
| 3300003368 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP12_OM2 | Environmental | Open in IMG/M |
| 3300004114 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of AARS Block 5 | Environmental | Open in IMG/M |
| 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Host-Associated | Open in IMG/M |
| 3300005332 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Environmental | Open in IMG/M |
| 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Environmental | Open in IMG/M |
| 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Environmental | Open in IMG/M |
| 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Environmental | Open in IMG/M |
| 3300005454 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_136 | Environmental | Open in IMG/M |
| 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Environmental | Open in IMG/M |
| 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Environmental | Open in IMG/M |
| 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Environmental | Open in IMG/M |
| 3300005529 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen16_06102014_R1 | Environmental | Open in IMG/M |
| 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Host-Associated | Open in IMG/M |
| 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Host-Associated | Open in IMG/M |
| 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Host-Associated | Open in IMG/M |
| 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Environmental | Open in IMG/M |
| 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Environmental | Open in IMG/M |
| 3300006176 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5 | Environmental | Open in IMG/M |
| 3300006871 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Host-Associated | Open in IMG/M |
| 3300006904 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD3 | Host-Associated | Open in IMG/M |
| 3300009038 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaG | Environmental | Open in IMG/M |
| 3300009162 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD2 | Host-Associated | Open in IMG/M |
| 3300010159 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 | Environmental | Open in IMG/M |
| 3300010373 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-4 | Environmental | Open in IMG/M |
| 3300010379 | Sb_50d combined assembly | Environmental | Open in IMG/M |
| 3300010399 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-3 | Environmental | Open in IMG/M |
| 3300010401 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-1 | Environmental | Open in IMG/M |
| 3300011120 | Combined assembly of Microbial Forest Soil metaT | Environmental | Open in IMG/M |
| 3300011271 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4B metaG | Environmental | Open in IMG/M |
| 3300012189 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4A metaG | Environmental | Open in IMG/M |
| 3300012208 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_20_16 metaG | Environmental | Open in IMG/M |
| 3300012351 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_100_16 metaG | Environmental | Open in IMG/M |
| 3300012500 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.4.old.080610 | Host-Associated | Open in IMG/M |
| 3300012917 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czobulk2.16 metaG | Environmental | Open in IMG/M |
| 3300012918 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czcobulk3.16 metaG | Environmental | Open in IMG/M |
| 3300012924 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012951 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_226_MG | Environmental | Open in IMG/M |
| 3300012961 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_202_MG | Environmental | Open in IMG/M |
| 3300014052 | Permafrost microbial communities from Nunavut, Canada - A23_35cm_12M | Environmental | Open in IMG/M |
| 3300014489 | Permafrost microbial communities from Stordalen Mire, Sweden - 812P2M metaG | Environmental | Open in IMG/M |
| 3300017926 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW_2 | Environmental | Open in IMG/M |
| 3300017948 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_4_10 | Environmental | Open in IMG/M |
| 3300020579 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-M | Environmental | Open in IMG/M |
| 3300020580 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-M | Environmental | Open in IMG/M |
| 3300020582 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-4-O | Environmental | Open in IMG/M |
| 3300021171 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-11-M | Environmental | Open in IMG/M |
| 3300021178 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-4-M | Environmental | Open in IMG/M |
| 3300021402 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-26-O | Environmental | Open in IMG/M |
| 3300021403 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-O | Environmental | Open in IMG/M |
| 3300021406 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-O | Environmental | Open in IMG/M |
| 3300021420 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-12-M | Environmental | Open in IMG/M |
| 3300021432 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-M | Environmental | Open in IMG/M |
| 3300021477 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-4-O | Environmental | Open in IMG/M |
| 3300021478 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-M | Environmental | Open in IMG/M |
| 3300021479 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-4-M | Environmental | Open in IMG/M |
| 3300021559 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-M | Environmental | Open in IMG/M |
| 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026475 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - CO-12-A | Environmental | Open in IMG/M |
| 3300026551 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_115cm (SPAdes) | Environmental | Open in IMG/M |
| 3300026552 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_109 (SPAdes) | Environmental | Open in IMG/M |
| 3300027076 | Forest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaG HF012 (SPAdes) | Environmental | Open in IMG/M |
| 3300027166 | Forest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaG HF033 (SPAdes) | Environmental | Open in IMG/M |
| 3300027570 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_9_AC metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027725 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS200 (SPAdes) | Environmental | Open in IMG/M |
| 3300027869 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen03_05102014_R1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027884 | Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF2 (SPAdes) | Environmental | Open in IMG/M |
| 3300028718 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_194 | Environmental | Open in IMG/M |
| 3300028781 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_E2_3 | Environmental | Open in IMG/M |
| 3300028784 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_121 | Environmental | Open in IMG/M |
| 3300028792 | Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 19_S | Environmental | Open in IMG/M |
| 3300028793 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_159 | Environmental | Open in IMG/M |
| 3300028795 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_N1_1 | Environmental | Open in IMG/M |
| 3300028801 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_E3_3 | Environmental | Open in IMG/M |
| 3300028828 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_202 | Environmental | Open in IMG/M |
| 3300028879 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_N1_3 | Environmental | Open in IMG/M |
| 3300028884 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_195 | Environmental | Open in IMG/M |
| 3300028906 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5 (v2) | Environmental | Open in IMG/M |
| 3300029882 | III_Palsa_E1 coassembly | Environmental | Open in IMG/M |
| 3300029910 | III_Palsa_E2 coassembly | Environmental | Open in IMG/M |
| 3300029999 | I_Palsa_E3 coassembly | Environmental | Open in IMG/M |
| 3300030520 | III_Palsa_N2 coassembly | Environmental | Open in IMG/M |
| 3300030618 | II_Palsa_E3 coassembly | Environmental | Open in IMG/M |
| 3300030659 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_a_PC metaG (v2) | Environmental | Open in IMG/M |
| 3300031028 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Palsa_E3_2 | Environmental | Open in IMG/M |
| 3300031740 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gases AM2C_05 | Environmental | Open in IMG/M |
| 3300032074 | Soil microbial communities from UC Gill Tract Community Farm, Albany, California, United States - DLSLS.P.R1 | Environmental | Open in IMG/M |
| 3300032160 | Sb_50d combined assembly (MetaSPAdes) | Environmental | Open in IMG/M |
| 3300032782 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.1 | Environmental | Open in IMG/M |
| 3300033412 | Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - NC | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| FD1_03735350 | 2170459024 | Grass Soil | VVYPGYARGRPVDIVFAVYLQPRRPAVRVAVLDADTDEVLGPTGTRESAVL |
| JGI26340J50214_1000046115 | 3300003368 | Bog Forest Soil | VVYPGSTRSRRVDVVFAVYLQSRRPAIRAAVLSADTDEALGTGTRESAVI* |
| Ga0062593_1026294872 | 3300004114 | Soil | VYPGYARGRPVDIVFAVYLQSRRPAVRAAVLDADTDEVLGPTGTRESAVL* |
| Ga0070670_1020517082 | 3300005331 | Switchgrass Rhizosphere | LKVRRRIFAVYLQSRRPAVRAAVLGADTDEVLGPTGTRESAVL* |
| Ga0066388_1024060991 | 3300005332 | Tropical Forest Soil | VYPGYARGRLAGIVFAVYLQSRRPAVRVAVLDADTDEVLGPTGTRESAVL* |
| Ga0070709_109196701 | 3300005434 | Corn, Switchgrass And Miscanthus Rhizosphere | LKSGAGIFAVYLQSRRPAVHAAVLGADTDEVLGPTGTRESAVL* |
| Ga0070709_110022361 | 3300005434 | Corn, Switchgrass And Miscanthus Rhizosphere | PGYARGRRVDIVFAVYLQNRRPAIRAAVLDADTDEILGRAGTRESATI* |
| Ga0070714_1008010153 | 3300005435 | Agricultural Soil | VYPGYARGRRVDIVFAVYLQNRRPAIRAAVLDADTDEVLGRAETRESATI* |
| Ga0070714_1016288291 | 3300005435 | Agricultural Soil | YARGRRVDIVFAVYLQNRRPAIRAAVLDADTDEILGRAGTRESATI* |
| Ga0070713_1018579192 | 3300005436 | Corn, Switchgrass And Miscanthus Rhizosphere | LKVGAGIFAVYLQSRRPAVHAAVLGADTDEVLGPTGTRESAVL* |
| Ga0070711_1010438441 | 3300005439 | Corn, Switchgrass And Miscanthus Rhizosphere | YARGRPVDIVFAVYLQSRRPAVRAAVLDADTDEVLGPAGTRESAVL* |
| Ga0070711_1019702382 | 3300005439 | Corn, Switchgrass And Miscanthus Rhizosphere | RPVDIVFAVYLQSRRPAVRAAVLDADTGEVLGPTGTRESAVL* |
| Ga0066687_107788451 | 3300005454 | Soil | FVVYPGYTRGRPVDIVFAVYLQSRRPAVRAAVLDADTDEVLGPTGTRESAVL* |
| Ga0070681_112190352 | 3300005458 | Corn Rhizosphere | LKVRRRIFAVYLQSRRPAVHAAVLGADTDEVLGPTGTRESAVL* |
| Ga0070685_105922853 | 3300005466 | Switchgrass Rhizosphere | LTTGPLKVRRRIFAVYLQSRRPAVHAAVLGADTDEVLGPTGTRESAVL* |
| Ga0070699_1009756381 | 3300005518 | Corn, Switchgrass And Miscanthus Rhizosphere | VDIVFAVYLQSRRPAIRAAVLDADTDEVLGPTGTRESAVV* |
| Ga0070741_102509611 | 3300005529 | Surface Soil | VDIVFAVYLQNRSPAIRVAVLDADTDEVLGRADTRESAAI* |
| Ga0070672_1007734702 | 3300005543 | Miscanthus Rhizosphere | LKSGAGILAVYLQSRRPAVRAAVLGADTDEVLGPTGTRESAVL* |
| Ga0068855_1022856412 | 3300005563 | Corn Rhizosphere | LKVRRRILAVYLQSRRPAVRAAVLGADTDEVLGPTGTRESAVL* |
| Ga0068863_1006325162 | 3300005841 | Switchgrass Rhizosphere | DIVFAVYLQNRRPAIRAAVLDADTDEVLGRADTRESAAI* |
| Ga0070717_119779222 | 3300006028 | Corn, Switchgrass And Miscanthus Rhizosphere | LKVGAGIFAVYLQSRRPAVRAVVLGADTDEVLGPTGTRESAVL* |
| Ga0070712_1008107532 | 3300006175 | Corn, Switchgrass And Miscanthus Rhizosphere | LKSGAGIFAVYLQSRRPAVRAAVLGADTDEVLGPTGTRESAVL* |
| Ga0070712_1009499431 | 3300006175 | Corn, Switchgrass And Miscanthus Rhizosphere | RGRRVDIVFAVYLQNRRPAIRAAVLDADTDEILGRAGTRESATI* |
| Ga0070712_1012928482 | 3300006175 | Corn, Switchgrass And Miscanthus Rhizosphere | VYPGYARGRPVDIVFAVYLQSRRPAVRAALLDADTDEVLGPTGTRESAVL* |
| Ga0070765_1015415701 | 3300006176 | Soil | VYLQTRRPAIRAAVLDADTDEILGLIETRESAFF* |
| Ga0075434_1002859792 | 3300006871 | Populus Rhizosphere | VYPGYARGRPVDIVFAVYLQDRRPAVRAAVLDADTDEVLGPTGTRESAVL* |
| Ga0075424_1026522331 | 3300006904 | Populus Rhizosphere | YARGRPVDIVFAVYLQSRRPAVRAAVLDAETDEVLGPTGTRESAVL* |
| Ga0099829_102456092 | 3300009038 | Vadose Zone Soil | VDIVFAVYLQARRPVVRAAVLDADTDEVLGPIGTRESAVI* |
| Ga0075423_104430701 | 3300009162 | Populus Rhizosphere | RVGIVFAVYLQSRRPAVRAAVLNAHTDEVLGPAGTRISAVL* |
| Ga0099796_101593841 | 3300010159 | Vadose Zone Soil | PGYARGRPVDIVFAVYLQSRRPAVRAAVLDADTDEVLGPTGTRESAVL* |
| Ga0134128_116364862 | 3300010373 | Terrestrial Soil | VYPGYARGRPVDIVFAVYLQSRRPAVPAAVLDADTDEVLGPTGTRESAVL* |
| Ga0136449_1013619931 | 3300010379 | Peatlands Soil | RCLAGGVLAVRGVPGSARGRRVDIVFAVYLQSRRAAIRAAVLDADADEVLGPTWTRVSAVI* |
| Ga0134127_104922411 | 3300010399 | Terrestrial Soil | VVYPGYARGRPVDTVFAVYLQSRRPAVRAAVLDADTDEVLGPTGTRESAVL* |
| Ga0134121_105441431 | 3300010401 | Terrestrial Soil | IFAVYLQSRRPAVHAAVLGADTDEVLGPTGTRESAVL* |
| Ga0150983_154735571 | 3300011120 | Forest Soil | PGVVSARPVDIVFAVYLQARRPAIRVAVLDAATDEILGLAGARESAVL* |
| Ga0137393_101956941 | 3300011271 | Vadose Zone Soil | ARGRPVDIVFAVYLQSRRPAVRAAVLDADTDEVLGPTGTRESAVL* |
| Ga0137388_106886281 | 3300012189 | Vadose Zone Soil | RRVDIVFAVYLQARRPVVRAAVLDADTDEVLGPIGTRESAVI* |
| Ga0137376_116982941 | 3300012208 | Vadose Zone Soil | IVFAVYLQSRRPAVRVAVLDADTDEVLGSTGTRESAVL* |
| Ga0137386_105083001 | 3300012351 | Vadose Zone Soil | RPVDIVFAVYLQSRRPAIRAAVLDADTDEVLGPTGTRESAVI* |
| Ga0157314_10197421 | 3300012500 | Arabidopsis Rhizosphere | PVDIVFAIYLQSRRPAVRAAVLDADTHEVLGPTGTRESAVL* |
| Ga0137395_102745471 | 3300012917 | Vadose Zone Soil | AVYLQSRRPAIRAAVLDADTDEVLGPTGTRESAVI* |
| Ga0137396_104968232 | 3300012918 | Vadose Zone Soil | GYARGRPVDIVFAVYLQSRRPAVRAAVLDADTDEALGPTGTRESAVL* |
| Ga0137413_118400862 | 3300012924 | Vadose Zone Soil | VVYPGYARGRRVDIVFAVYLQSRRPAVRAAILDADTDEVPGPTGTRESAVL* |
| Ga0164300_100572102 | 3300012951 | Soil | VDIVFAVYLQSRRPAVRAAVLDADTDEVLGPIGTRISAVL* |
| Ga0164302_114881452 | 3300012961 | Soil | VDIVFAVYLQSRRPAVRAAVLDADTDEVLGPTGTRESAVL* |
| Ga0120109_11230201 | 3300014052 | Permafrost | MGDVRDRLPGIARGRHVDIVFAVYLQARRPAIRAAVLDADTDEVLGLTDARESAVI* |
| Ga0182018_107278212 | 3300014489 | Palsa | RRVDIVFAVYLQARRPAIRVAVLDAATDEILGLAGARKSAVL* |
| Ga0187807_12624761 | 3300017926 | Freshwater Sediment | VWREGRWRFAVYLGLARGRRIDIVFAVNLQARRPPIRVAVLDADTDEILGRAE |
| Ga0187847_101535743 | 3300017948 | Peatland | LVYPGIVSGRRVDIVFAVYLQARRPAIRVAVLDAATDEILGLAGARKSAVL |
| Ga0210407_100321254 | 3300020579 | Soil | VVYPGYARGRPVDIVFAVYLQSRRPAIRAAVLETDTDEVPGPTGTRESAVI |
| Ga0210403_106865192 | 3300020580 | Soil | VDIVFAVYLQSRRPAIRAAVLDADTDEVLGPTGTRESAVI |
| Ga0210395_109943732 | 3300020582 | Soil | GRPVDVVFAVYLQSRCPAVRAAILDADTDEVLGPTGTRQSAVI |
| Ga0210405_107879652 | 3300021171 | Soil | VYPGYARGRPVDIVFAVYLQSRRPAIRAAVLETDTDEVPGPTGTRESAVI |
| Ga0210408_100546812 | 3300021178 | Soil | VVYPGYARGRPVDVVFAVYLQSRCPAVRAAILDADTDEVLGPTGTRQSAVV |
| Ga0210385_110442101 | 3300021402 | Soil | VDIVFAVYLQSRRPAVRAAVLDADTDEVLGPAGTRESAVL |
| Ga0210397_100332171 | 3300021403 | Soil | YPGCARGRAVDIVFAVYLQSRRPAVRAVVLDADTDEVLGPTGTRESAVL |
| Ga0210386_117785642 | 3300021406 | Soil | VDIVFAVYLQSRRPAVRAAVLDADTDEVLGPAGAHESAVL |
| Ga0210394_100701893 | 3300021420 | Soil | VVYPGYARGRPVDVVFAVYLQSRRPAVRAAILDADTDEVLGPTGTRQSAVI |
| Ga0210384_101300832 | 3300021432 | Soil | VLAVRGVSGYARGRPVDIVFAVYLQSRRPAVRAAILDADTDEVLGPTGTRQSAVI |
| Ga0210398_101735024 | 3300021477 | Soil | ARPVDIVFAVYLQARRPAIRVAVLDAATDEILGLAGARESAVL |
| Ga0210398_113096722 | 3300021477 | Soil | VVYPGIVRGRQVDIVFAIYLQARRPAIRAAVLDAETDEVLGTRESALI |
| Ga0210402_107557994 | 3300021478 | Soil | VVYPGYARGRPVDIVFAVYLQSRRPAIRAAVLDTDTDEVLGPTGTRESAVI |
| Ga0210410_101881532 | 3300021479 | Soil | VVYPGYARGRPVDVVFAVYLQSRCPAVRAAILDADTDEVLGPTGTRQSAVI |
| Ga0210409_102471472 | 3300021559 | Soil | VVYPGYARGRPVDIVFAVYLQSRRPAIRAAVLAADTDEVLGPTGTRESAVI |
| Ga0207692_107712752 | 3300025898 | Corn, Switchgrass And Miscanthus Rhizosphere | FVVYPGYARGRPVDIVFAVYLQSRRPAVRAAVLDADTGEVLGPTGTRESAVL |
| Ga0207663_109855382 | 3300025916 | Corn, Switchgrass And Miscanthus Rhizosphere | VVYPGYARGRRVDIVFAVYLQNRRPAIRAAVLDADTDEVLNHTDLRESATI |
| Ga0207641_110048202 | 3300026088 | Switchgrass Rhizosphere | VVYPGYARGRQVDIVFAVYLQNRRPAIRAAVLDADTDEVLGRADTRESAAI |
| Ga0257147_10150712 | 3300026475 | Soil | VYPGYARGRPVDIVFAVYLQSRRPAVRAAIVDADTDEVLGPTGTRESAVL |
| Ga0209648_101484811 | 3300026551 | Grasslands Soil | GRRVDIVFAVYLQARRPPVRAAVLDADTDEILGPTGTRESATI |
| Ga0209577_100781031 | 3300026552 | Soil | VYPGYARGRPVHIVFAVYLQSRRPAVRAAVLDVDTDEVLGPAGARESAVL |
| Ga0208860_10063891 | 3300027076 | Forest Soil | VYPGSSRGRRVDIVFAIYLQSRQPAIRAAVLDADTDEVLGPTGARESAVI |
| Ga0208729_1058392 | 3300027166 | Forest Soil | VDIVFAIYLQARRPAVRAAVIDADTDEVLAPVGPLESAVI |
| Ga0208043_10785752 | 3300027570 | Peatlands Soil | IVFAVYLQARRPVIRAAVLDAHTDEVLGLAETREFTAMR |
| Ga0209178_12103871 | 3300027725 | Agricultural Soil | VYPGYARGRPVDIVFAVYLQSRRPAVRAAVLDADTDEVLGPTGTRESAV |
| Ga0209579_101836401 | 3300027869 | Surface Soil | VYAGVARGRRVDIVFAVYLQSRRPVIRAAVLDAATDEVLGLAETREFTAIR |
| Ga0209275_103350832 | 3300027884 | Soil | MARVFAIYLQARRPAVRAAVIDADTDEVLAPVGPLESAVI |
| Ga0307307_100482642 | 3300028718 | Soil | VLAVRLVPGNARGRPVDIVFAVYLQSRRPAVRAAVLDADTDEVLGPTGTRESAVL |
| Ga0302223_101247672 | 3300028781 | Palsa | GRAVDIVFAIYLQARRPPIRVAVLDAEADSPGPAGARESVVI |
| Ga0307282_100076564 | 3300028784 | Soil | VLAVRLVPGYARGRPVDIVFAVYLQSRRPAVRAAVLDADTDEVLGPTGTRESAVL |
| Ga0307504_100501862 | 3300028792 | Soil | VYPGYARGRPVDIVFAVYLQSRRPAVRAAVLDADTDEVLGPAGTRESAVL |
| Ga0307299_102898382 | 3300028793 | Soil | ARGRPVDIVFAVYLQSRRPAVRAAVLDADTDEVLGPTGTRESAVL |
| Ga0302227_100979461 | 3300028795 | Palsa | RFVVYPGVVSARPVDIVFAVYLQARRPAIRVAVLDAATDEILGLAGARESAVL |
| Ga0302226_104055872 | 3300028801 | Palsa | IVFAVYLQARRPAIRVAVLDAATDEILGLAAARPSAVL |
| Ga0307312_100147951 | 3300028828 | Soil | IVFAVYLQSRRPAVRAAVLDADTDEVLGPTGTRESAVL |
| Ga0307312_101188831 | 3300028828 | Soil | GYARGRPVDIVFAVYLQSRRPAVRVAVLDADTDEVLGPAGTRESAVL |
| Ga0302229_100790812 | 3300028879 | Palsa | VVYPGVARDRHVDIVFAVYLQARRPAIRAAVLDADTDEILALIETHESAFF |
| Ga0307308_100193834 | 3300028884 | Soil | DPGYARGRPVDIVFAVYLQSRRPAVRAAVLDADTDEVLGPTGTRESAVL |
| Ga0308309_106370052 | 3300028906 | Soil | IVFAIFLQARRPAIRVAVLDAATDEILGLAGARPSAVL |
| Ga0308309_110886301 | 3300028906 | Soil | HDRHVDIVFAVYLQTRRPGIRAAVLDAVTDEILGLIETRESAFF |
| Ga0311368_104932521 | 3300029882 | Palsa | YPGTVSGRRVDIVFAIYLQARRPAIRVAVLDAATDEILGLAGARESAVL |
| Ga0311368_110480172 | 3300029882 | Palsa | VFAVFLQARRPAIRVAVLDAATDEILGLAGARPSAVL |
| Ga0311369_106351931 | 3300029910 | Palsa | FAVYPGVERGRRVDIVFAVYLQTRRPAIRAAVLDADTDEILGLIETRESALF |
| Ga0311339_113992992 | 3300029999 | Palsa | RFVVYPGVARDRHVDIVFAVYLQARRPAIRAAVLDADTDEILALIETHESAFF |
| Ga0311372_109410462 | 3300030520 | Palsa | YPGIVSGRRVDIVFAVYLQARRPAIRVAVLDAATDEILGLAGARKSAVL |
| Ga0311354_107161042 | 3300030618 | Palsa | YPGNVSGRRVDIVFAVYLQARRPAIRVAVLDAATDEILGLAAARPSAVL |
| Ga0316363_100938831 | 3300030659 | Peatlands Soil | AVYPGSARGRPVDIVFAVYLQSRRPVIRAAVLDADTDEVLGPAGTRESVVI |
| Ga0302180_103441551 | 3300031028 | Palsa | RRVDIVFAVYLQARRPAVRVAVLDAATDEILGLAGARPSAVL |
| Ga0307468_1008193381 | 3300031740 | Hardwood Forest Soil | VDIVFAVYLQSRRPAVRAAVLDADTDEVLGPTGTRESAVL |
| Ga0308173_104733941 | 3300032074 | Soil | GRPVDIVFAVYLQSRRPVGRAAVLDADTDEVLGPTGTRESAVL |
| Ga0311301_110140592 | 3300032160 | Peatlands Soil | PGHARGRQVDIVFAVYLQSRRPAIRAAVLDADTDEVLGPSRTRESVVI |
| Ga0335082_105011812 | 3300032782 | Soil | VVYPGSERGRPVDIVFAVYLQSRRPAIRAAVLDADTDEVPGPAGIRESAII |
| Ga0310810_107978851 | 3300033412 | Soil | VYPGYARGRPVDIVFAVYLQSRRPAVRAAVLDADTDEVLGPTGTRESAVL |
| ⦗Top⦘ |