NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome Family F101632

Metagenome Family F101632

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F101632
Family Type Metagenome
Number of Sequences 102
Average Sequence Length 46 residues
Representative Sequence ARGRPVDIVFAVYLQSRRPAVRAAVLDADTDEVLGPTGTRESAVL
Number of Associated Samples 93
Number of Associated Scaffolds 102

Quality Assessment
Transcriptomic Evidence No
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 23.53 %
% of genes near scaffold ends (potentially truncated) 61.76 %
% of genes from short scaffolds (< 2000 bps) 90.20 %
Associated GOLD sequencing projects 89
AlphaFold2 3D model prediction Yes
3D model pTM-score0.30

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (59.804 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil
(15.686 % of family members)
Environment Ontology (ENVO) Unclassified
(24.510 % of family members)
Earth Microbiome Project Ontology (EMPO) Free-living → Non-saline → Soil (non-saline)
(57.843 % of family members)



 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      


 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 0.00%    β-sheet: 16.44%    Coil/Unstructured: 83.56%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  
pTM-score: 0.30
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.


 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 102 Family Scaffolds
PF13191AAA_16 9.80
PF00501AMP-binding 9.80
PF08281Sigma70_r4_2 5.88
PF13466STAS_2 1.96
PF01663Phosphodiest 1.96
PF02729OTCace_N 0.98
PF07690MFS_1 0.98
PF09678Caa3_CtaG 0.98
PF04655APH_6_hur 0.98
PF13193AMP-binding_C 0.98
PF13751DDE_Tnp_1_6 0.98
PF05598DUF772 0.98
PF07291MauE 0.98
PF01636APH 0.98

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 102 Family Scaffolds
COG3570Streptomycin 6-kinaseDefense mechanisms [V] 0.98


 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms59.80 %
UnclassifiedrootN/A40.20 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
2170459024|GZRSKLJ02JG3DRAll Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales548Open in IMG/M
3300003368|JGI26340J50214_10000461All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia14278Open in IMG/M
3300004114|Ga0062593_102629487All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium572Open in IMG/M
3300005331|Ga0070670_102051708Not Available527Open in IMG/M
3300005332|Ga0066388_102406099All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales955Open in IMG/M
3300005434|Ga0070709_10919670Not Available692Open in IMG/M
3300005434|Ga0070709_11002236All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales664Open in IMG/M
3300005435|Ga0070714_100801015All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales912Open in IMG/M
3300005435|Ga0070714_101628829All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales630Open in IMG/M
3300005436|Ga0070713_101857919All Organisms → cellular organisms → Bacteria584Open in IMG/M
3300005439|Ga0070711_101043844All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales702Open in IMG/M
3300005439|Ga0070711_101970238Not Available514Open in IMG/M
3300005454|Ga0066687_10778845All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Streptosporangiaceae → Streptosporangium → Streptosporangium roseum569Open in IMG/M
3300005458|Ga0070681_11219035Not Available674Open in IMG/M
3300005466|Ga0070685_10592285All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia797Open in IMG/M
3300005518|Ga0070699_100975638All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales777Open in IMG/M
3300005529|Ga0070741_10250961Not Available1685Open in IMG/M
3300005543|Ga0070672_100773470Not Available844Open in IMG/M
3300005563|Ga0068855_102285641Not Available541Open in IMG/M
3300005841|Ga0068863_100632516All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales1060Open in IMG/M
3300006028|Ga0070717_11977922All Organisms → cellular organisms → Bacteria525Open in IMG/M
3300006175|Ga0070712_100810753Not Available803Open in IMG/M
3300006175|Ga0070712_100949943All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia742Open in IMG/M
3300006175|Ga0070712_101292848Not Available635Open in IMG/M
3300006176|Ga0070765_101541570All Organisms → cellular organisms → Bacteria625Open in IMG/M
3300006871|Ga0075434_100285979All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales1668Open in IMG/M
3300006904|Ga0075424_102652233All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales523Open in IMG/M
3300009038|Ga0099829_10245609Not Available1458Open in IMG/M
3300009162|Ga0075423_10443070Not Available1364Open in IMG/M
3300010159|Ga0099796_10159384All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia893Open in IMG/M
3300010373|Ga0134128_11636486Not Available709Open in IMG/M
3300010379|Ga0136449_101361993Not Available1100Open in IMG/M
3300010399|Ga0134127_10492241Not Available1236Open in IMG/M
3300010401|Ga0134121_10544143Not Available1077Open in IMG/M
3300011120|Ga0150983_15473557All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia528Open in IMG/M
3300011271|Ga0137393_10195694Not Available1704Open in IMG/M
3300012189|Ga0137388_10688628Not Available949Open in IMG/M
3300012208|Ga0137376_11698294All Organisms → cellular organisms → Bacteria522Open in IMG/M
3300012351|Ga0137386_10508300All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia868Open in IMG/M
3300012500|Ga0157314_1019742Not Available676Open in IMG/M
3300012917|Ga0137395_10274547Not Available1189Open in IMG/M
3300012918|Ga0137396_10496823All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia904Open in IMG/M
3300012924|Ga0137413_11840086All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia501Open in IMG/M
3300012951|Ga0164300_10057210All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia1566Open in IMG/M
3300012961|Ga0164302_11488145All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia557Open in IMG/M
3300014052|Ga0120109_1123020Not Available604Open in IMG/M
3300014489|Ga0182018_10727821All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia516Open in IMG/M
3300017926|Ga0187807_1262476Not Available568Open in IMG/M
3300017948|Ga0187847_10153574All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales1258Open in IMG/M
3300020579|Ga0210407_10032125All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria3905Open in IMG/M
3300020580|Ga0210403_10686519Not Available821Open in IMG/M
3300020582|Ga0210395_10994373Not Available621Open in IMG/M
3300021171|Ga0210405_10787965All Organisms → cellular organisms → Bacteria729Open in IMG/M
3300021178|Ga0210408_10054681Not Available3117Open in IMG/M
3300021402|Ga0210385_11044210All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium628Open in IMG/M
3300021403|Ga0210397_10033217All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia3232Open in IMG/M
3300021406|Ga0210386_11778564All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia508Open in IMG/M
3300021420|Ga0210394_10070189Not Available3036Open in IMG/M
3300021432|Ga0210384_10130083All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Thermomonosporaceae → Actinomadura2259Open in IMG/M
3300021477|Ga0210398_10173502All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia1757Open in IMG/M
3300021477|Ga0210398_11309672All Organisms → cellular organisms → Bacteria569Open in IMG/M
3300021478|Ga0210402_10755799All Organisms → cellular organisms → Bacteria896Open in IMG/M
3300021479|Ga0210410_10188153All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Thermomonosporaceae → Actinomadura1848Open in IMG/M
3300021559|Ga0210409_10247147All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales1616Open in IMG/M
3300025898|Ga0207692_10771275Not Available627Open in IMG/M
3300025916|Ga0207663_10985538All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → unclassified Streptosporangiales → Streptosporangiales bacterium676Open in IMG/M
3300026088|Ga0207641_11004820Not Available831Open in IMG/M
3300026475|Ga0257147_1015071All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia1052Open in IMG/M
3300026551|Ga0209648_10148481All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Streptosporangiaceae1854Open in IMG/M
3300026552|Ga0209577_10078103All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia2727Open in IMG/M
3300027076|Ga0208860_1006389Not Available1029Open in IMG/M
3300027166|Ga0208729_105839All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia716Open in IMG/M
3300027570|Ga0208043_1078575Not Available917Open in IMG/M
3300027725|Ga0209178_1210387All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii691Open in IMG/M
3300027869|Ga0209579_10183640Not Available1119Open in IMG/M
3300027884|Ga0209275_10335083All Organisms → cellular organisms → Bacteria845Open in IMG/M
3300028718|Ga0307307_10048264All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales1242Open in IMG/M
3300028781|Ga0302223_10124767All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia851Open in IMG/M
3300028784|Ga0307282_10007656All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia4272Open in IMG/M
3300028792|Ga0307504_10050186All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia1189Open in IMG/M
3300028793|Ga0307299_10289838Not Available615Open in IMG/M
3300028795|Ga0302227_10097946Not Available1219Open in IMG/M
3300028801|Ga0302226_10405587All Organisms → cellular organisms → Bacteria570Open in IMG/M
3300028828|Ga0307312_10014795All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria4366Open in IMG/M
3300028828|Ga0307312_10118883Not Available1654Open in IMG/M
3300028879|Ga0302229_10079081Not Available1580Open in IMG/M
3300028884|Ga0307308_10019383All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria3114Open in IMG/M
3300028906|Ga0308309_10637005Not Available926Open in IMG/M
3300028906|Ga0308309_11088630All Organisms → cellular organisms → Bacteria691Open in IMG/M
3300029882|Ga0311368_10493252All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia882Open in IMG/M
3300029882|Ga0311368_11048017Not Available534Open in IMG/M
3300029910|Ga0311369_10635193All Organisms → cellular organisms → Bacteria886Open in IMG/M
3300029999|Ga0311339_11399299All Organisms → cellular organisms → Bacteria628Open in IMG/M
3300030520|Ga0311372_10941046Not Available1152Open in IMG/M
3300030618|Ga0311354_10716104Not Available955Open in IMG/M
3300030659|Ga0316363_10093883Not Available1342Open in IMG/M
3300031028|Ga0302180_10344155All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia757Open in IMG/M
3300031740|Ga0307468_100819338All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia796Open in IMG/M
3300032074|Ga0308173_10473394Not Available1117Open in IMG/M
3300032160|Ga0311301_11014059Not Available1095Open in IMG/M
3300032782|Ga0335082_10501181All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia1076Open in IMG/M
3300033412|Ga0310810_10797885All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii854Open in IMG/M



 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil15.69%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere11.76%
PalsaEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa10.78%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil9.80%
Vadose Zone SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil8.82%
Peatlands SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil3.92%
SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Soil3.92%
Terrestrial SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil2.94%
Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil2.94%
Populus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere2.94%
Surface SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil1.96%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Soil1.96%
Agricultural SoilEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Agricultural Soil1.96%
Switchgrass RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere1.96%
PeatlandEnvironmental → Aquatic → Freshwater → Wetlands → Bog → Peatland0.98%
Bog Forest SoilEnvironmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil0.98%
Freshwater SedimentEnvironmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment0.98%
Grass SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Grass Soil0.98%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil0.98%
Agricultural SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil0.98%
PermafrostEnvironmental → Terrestrial → Soil → Unclassified → Permafrost → Permafrost0.98%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil0.98%
Hardwood Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil0.98%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural → Soil0.98%
SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Soil0.98%
PalsaEnvironmental → Terrestrial → Soil → Wetlands → Permafrost → Palsa0.98%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil0.98%
Corn RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere0.98%
Switchgrass RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere0.98%
Corn RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere0.98%
Arabidopsis RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Rhizosphere0.98%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere0.98%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere0.98%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
2170459024Grass soil microbial communities from Rothamsted Park, UK - FD1 (NaCl 300g/L 5ml)EnvironmentalOpen in IMG/M
3300003368Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP12_OM2EnvironmentalOpen in IMG/M
3300004114Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of AARS Block 5EnvironmentalOpen in IMG/M
3300005331Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaGHost-AssociatedOpen in IMG/M
3300005332Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly)EnvironmentalOpen in IMG/M
3300005434Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaGEnvironmentalOpen in IMG/M
3300005435Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaGEnvironmentalOpen in IMG/M
3300005436Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaGEnvironmentalOpen in IMG/M
3300005439Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaGEnvironmentalOpen in IMG/M
3300005454Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_136EnvironmentalOpen in IMG/M
3300005458Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaGEnvironmentalOpen in IMG/M
3300005466Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaGEnvironmentalOpen in IMG/M
3300005518Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaGEnvironmentalOpen in IMG/M
3300005529Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen16_06102014_R1EnvironmentalOpen in IMG/M
3300005543Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaGHost-AssociatedOpen in IMG/M
3300005563Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2Host-AssociatedOpen in IMG/M
3300005841Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2Host-AssociatedOpen in IMG/M
3300006028Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaGEnvironmentalOpen in IMG/M
3300006175Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaGEnvironmentalOpen in IMG/M
3300006176Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5EnvironmentalOpen in IMG/M
3300006871Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3Host-AssociatedOpen in IMG/M
3300006904Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD3Host-AssociatedOpen in IMG/M
3300009038Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaGEnvironmentalOpen in IMG/M
3300009162Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD2Host-AssociatedOpen in IMG/M
3300010159Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3EnvironmentalOpen in IMG/M
3300010373Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-4EnvironmentalOpen in IMG/M
3300010379Sb_50d combined assemblyEnvironmentalOpen in IMG/M
3300010399Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-3EnvironmentalOpen in IMG/M
3300010401Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-1EnvironmentalOpen in IMG/M
3300011120Combined assembly of Microbial Forest Soil metaTEnvironmentalOpen in IMG/M
3300011271Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4B metaGEnvironmentalOpen in IMG/M
3300012189Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4A metaGEnvironmentalOpen in IMG/M
3300012208Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_20_16 metaGEnvironmentalOpen in IMG/M
3300012351Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_100_16 metaGEnvironmentalOpen in IMG/M
3300012500Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.4.old.080610Host-AssociatedOpen in IMG/M
3300012917Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czobulk2.16 metaGEnvironmentalOpen in IMG/M
3300012918Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czcobulk3.16 metaGEnvironmentalOpen in IMG/M
3300012924Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_16fungal (Illumina Assembly)EnvironmentalOpen in IMG/M
3300012951Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_226_MGEnvironmentalOpen in IMG/M
3300012961Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_202_MGEnvironmentalOpen in IMG/M
3300014052Permafrost microbial communities from Nunavut, Canada - A23_35cm_12MEnvironmentalOpen in IMG/M
3300014489Permafrost microbial communities from Stordalen Mire, Sweden - 812P2M metaGEnvironmentalOpen in IMG/M
3300017926Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW_2EnvironmentalOpen in IMG/M
3300017948Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_4_10EnvironmentalOpen in IMG/M
3300020579Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-MEnvironmentalOpen in IMG/M
3300020580Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-MEnvironmentalOpen in IMG/M
3300020582Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-4-OEnvironmentalOpen in IMG/M
3300021171Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-11-MEnvironmentalOpen in IMG/M
3300021178Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-4-MEnvironmentalOpen in IMG/M
3300021402Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-26-OEnvironmentalOpen in IMG/M
3300021403Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-OEnvironmentalOpen in IMG/M
3300021406Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-OEnvironmentalOpen in IMG/M
3300021420Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-12-MEnvironmentalOpen in IMG/M
3300021432Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-MEnvironmentalOpen in IMG/M
3300021477Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-4-OEnvironmentalOpen in IMG/M
3300021478Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-MEnvironmentalOpen in IMG/M
3300021479Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-4-MEnvironmentalOpen in IMG/M
3300021559Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-MEnvironmentalOpen in IMG/M
3300025898Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025916Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300026088Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026475Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - CO-12-AEnvironmentalOpen in IMG/M
3300026551Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_115cm (SPAdes)EnvironmentalOpen in IMG/M
3300026552Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_109 (SPAdes)EnvironmentalOpen in IMG/M
3300027076Forest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaG HF012 (SPAdes)EnvironmentalOpen in IMG/M
3300027166Forest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaG HF033 (SPAdes)EnvironmentalOpen in IMG/M
3300027570Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_9_AC metaG (SPAdes)EnvironmentalOpen in IMG/M
3300027725Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS200 (SPAdes)EnvironmentalOpen in IMG/M
3300027869Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen03_05102014_R1 (SPAdes)EnvironmentalOpen in IMG/M
3300027884Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF2 (SPAdes)EnvironmentalOpen in IMG/M
3300028718Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_194EnvironmentalOpen in IMG/M
3300028781Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_E2_3EnvironmentalOpen in IMG/M
3300028784Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_121EnvironmentalOpen in IMG/M
3300028792Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 19_SEnvironmentalOpen in IMG/M
3300028793Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_159EnvironmentalOpen in IMG/M
3300028795Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_N1_1EnvironmentalOpen in IMG/M
3300028801Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_E3_3EnvironmentalOpen in IMG/M
3300028828Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_202EnvironmentalOpen in IMG/M
3300028879Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_N1_3EnvironmentalOpen in IMG/M
3300028884Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_195EnvironmentalOpen in IMG/M
3300028906Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5 (v2)EnvironmentalOpen in IMG/M
3300029882III_Palsa_E1 coassemblyEnvironmentalOpen in IMG/M
3300029910III_Palsa_E2 coassemblyEnvironmentalOpen in IMG/M
3300029999I_Palsa_E3 coassemblyEnvironmentalOpen in IMG/M
3300030520III_Palsa_N2 coassemblyEnvironmentalOpen in IMG/M
3300030618II_Palsa_E3 coassemblyEnvironmentalOpen in IMG/M
3300030659Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_a_PC metaG (v2)EnvironmentalOpen in IMG/M
3300031028Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Palsa_E3_2EnvironmentalOpen in IMG/M
3300031740Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gases AM2C_05EnvironmentalOpen in IMG/M
3300032074Soil microbial communities from UC Gill Tract Community Farm, Albany, California, United States - DLSLS.P.R1EnvironmentalOpen in IMG/M
3300032160Sb_50d combined assembly (MetaSPAdes)EnvironmentalOpen in IMG/M
3300032782Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.1EnvironmentalOpen in IMG/M
3300033412Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - NCEnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap



 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
FD1_037353502170459024Grass SoilVVYPGYARGRPVDIVFAVYLQPRRPAVRVAVLDADTDEVLGPTGTRESAVL
JGI26340J50214_10000461153300003368Bog Forest SoilVVYPGSTRSRRVDVVFAVYLQSRRPAIRAAVLSADTDEALGTGTRESAVI*
Ga0062593_10262948723300004114SoilVYPGYARGRPVDIVFAVYLQSRRPAVRAAVLDADTDEVLGPTGTRESAVL*
Ga0070670_10205170823300005331Switchgrass RhizosphereLKVRRRIFAVYLQSRRPAVRAAVLGADTDEVLGPTGTRESAVL*
Ga0066388_10240609913300005332Tropical Forest SoilVYPGYARGRLAGIVFAVYLQSRRPAVRVAVLDADTDEVLGPTGTRESAVL*
Ga0070709_1091967013300005434Corn, Switchgrass And Miscanthus RhizosphereLKSGAGIFAVYLQSRRPAVHAAVLGADTDEVLGPTGTRESAVL*
Ga0070709_1100223613300005434Corn, Switchgrass And Miscanthus RhizospherePGYARGRRVDIVFAVYLQNRRPAIRAAVLDADTDEILGRAGTRESATI*
Ga0070714_10080101533300005435Agricultural SoilVYPGYARGRRVDIVFAVYLQNRRPAIRAAVLDADTDEVLGRAETRESATI*
Ga0070714_10162882913300005435Agricultural SoilYARGRRVDIVFAVYLQNRRPAIRAAVLDADTDEILGRAGTRESATI*
Ga0070713_10185791923300005436Corn, Switchgrass And Miscanthus RhizosphereLKVGAGIFAVYLQSRRPAVHAAVLGADTDEVLGPTGTRESAVL*
Ga0070711_10104384413300005439Corn, Switchgrass And Miscanthus RhizosphereYARGRPVDIVFAVYLQSRRPAVRAAVLDADTDEVLGPAGTRESAVL*
Ga0070711_10197023823300005439Corn, Switchgrass And Miscanthus RhizosphereRPVDIVFAVYLQSRRPAVRAAVLDADTGEVLGPTGTRESAVL*
Ga0066687_1077884513300005454SoilFVVYPGYTRGRPVDIVFAVYLQSRRPAVRAAVLDADTDEVLGPTGTRESAVL*
Ga0070681_1121903523300005458Corn RhizosphereLKVRRRIFAVYLQSRRPAVHAAVLGADTDEVLGPTGTRESAVL*
Ga0070685_1059228533300005466Switchgrass RhizosphereLTTGPLKVRRRIFAVYLQSRRPAVHAAVLGADTDEVLGPTGTRESAVL*
Ga0070699_10097563813300005518Corn, Switchgrass And Miscanthus RhizosphereVDIVFAVYLQSRRPAIRAAVLDADTDEVLGPTGTRESAVV*
Ga0070741_1025096113300005529Surface SoilVDIVFAVYLQNRSPAIRVAVLDADTDEVLGRADTRESAAI*
Ga0070672_10077347023300005543Miscanthus RhizosphereLKSGAGILAVYLQSRRPAVRAAVLGADTDEVLGPTGTRESAVL*
Ga0068855_10228564123300005563Corn RhizosphereLKVRRRILAVYLQSRRPAVRAAVLGADTDEVLGPTGTRESAVL*
Ga0068863_10063251623300005841Switchgrass RhizosphereDIVFAVYLQNRRPAIRAAVLDADTDEVLGRADTRESAAI*
Ga0070717_1197792223300006028Corn, Switchgrass And Miscanthus RhizosphereLKVGAGIFAVYLQSRRPAVRAVVLGADTDEVLGPTGTRESAVL*
Ga0070712_10081075323300006175Corn, Switchgrass And Miscanthus RhizosphereLKSGAGIFAVYLQSRRPAVRAAVLGADTDEVLGPTGTRESAVL*
Ga0070712_10094994313300006175Corn, Switchgrass And Miscanthus RhizosphereRGRRVDIVFAVYLQNRRPAIRAAVLDADTDEILGRAGTRESATI*
Ga0070712_10129284823300006175Corn, Switchgrass And Miscanthus RhizosphereVYPGYARGRPVDIVFAVYLQSRRPAVRAALLDADTDEVLGPTGTRESAVL*
Ga0070765_10154157013300006176SoilVYLQTRRPAIRAAVLDADTDEILGLIETRESAFF*
Ga0075434_10028597923300006871Populus RhizosphereVYPGYARGRPVDIVFAVYLQDRRPAVRAAVLDADTDEVLGPTGTRESAVL*
Ga0075424_10265223313300006904Populus RhizosphereYARGRPVDIVFAVYLQSRRPAVRAAVLDAETDEVLGPTGTRESAVL*
Ga0099829_1024560923300009038Vadose Zone SoilVDIVFAVYLQARRPVVRAAVLDADTDEVLGPIGTRESAVI*
Ga0075423_1044307013300009162Populus RhizosphereRVGIVFAVYLQSRRPAVRAAVLNAHTDEVLGPAGTRISAVL*
Ga0099796_1015938413300010159Vadose Zone SoilPGYARGRPVDIVFAVYLQSRRPAVRAAVLDADTDEVLGPTGTRESAVL*
Ga0134128_1163648623300010373Terrestrial SoilVYPGYARGRPVDIVFAVYLQSRRPAVPAAVLDADTDEVLGPTGTRESAVL*
Ga0136449_10136199313300010379Peatlands SoilRCLAGGVLAVRGVPGSARGRRVDIVFAVYLQSRRAAIRAAVLDADADEVLGPTWTRVSAVI*
Ga0134127_1049224113300010399Terrestrial SoilVVYPGYARGRPVDTVFAVYLQSRRPAVRAAVLDADTDEVLGPTGTRESAVL*
Ga0134121_1054414313300010401Terrestrial SoilIFAVYLQSRRPAVHAAVLGADTDEVLGPTGTRESAVL*
Ga0150983_1547355713300011120Forest SoilPGVVSARPVDIVFAVYLQARRPAIRVAVLDAATDEILGLAGARESAVL*
Ga0137393_1019569413300011271Vadose Zone SoilARGRPVDIVFAVYLQSRRPAVRAAVLDADTDEVLGPTGTRESAVL*
Ga0137388_1068862813300012189Vadose Zone SoilRRVDIVFAVYLQARRPVVRAAVLDADTDEVLGPIGTRESAVI*
Ga0137376_1169829413300012208Vadose Zone SoilIVFAVYLQSRRPAVRVAVLDADTDEVLGSTGTRESAVL*
Ga0137386_1050830013300012351Vadose Zone SoilRPVDIVFAVYLQSRRPAIRAAVLDADTDEVLGPTGTRESAVI*
Ga0157314_101974213300012500Arabidopsis RhizospherePVDIVFAIYLQSRRPAVRAAVLDADTHEVLGPTGTRESAVL*
Ga0137395_1027454713300012917Vadose Zone SoilAVYLQSRRPAIRAAVLDADTDEVLGPTGTRESAVI*
Ga0137396_1049682323300012918Vadose Zone SoilGYARGRPVDIVFAVYLQSRRPAVRAAVLDADTDEALGPTGTRESAVL*
Ga0137413_1184008623300012924Vadose Zone SoilVVYPGYARGRRVDIVFAVYLQSRRPAVRAAILDADTDEVPGPTGTRESAVL*
Ga0164300_1005721023300012951SoilVDIVFAVYLQSRRPAVRAAVLDADTDEVLGPIGTRISAVL*
Ga0164302_1148814523300012961SoilVDIVFAVYLQSRRPAVRAAVLDADTDEVLGPTGTRESAVL*
Ga0120109_112302013300014052PermafrostMGDVRDRLPGIARGRHVDIVFAVYLQARRPAIRAAVLDADTDEVLGLTDARESAVI*
Ga0182018_1072782123300014489PalsaRRVDIVFAVYLQARRPAIRVAVLDAATDEILGLAGARKSAVL*
Ga0187807_126247613300017926Freshwater SedimentVWREGRWRFAVYLGLARGRRIDIVFAVNLQARRPPIRVAVLDADTDEILGRAE
Ga0187847_1015357433300017948PeatlandLVYPGIVSGRRVDIVFAVYLQARRPAIRVAVLDAATDEILGLAGARKSAVL
Ga0210407_1003212543300020579SoilVVYPGYARGRPVDIVFAVYLQSRRPAIRAAVLETDTDEVPGPTGTRESAVI
Ga0210403_1068651923300020580SoilVDIVFAVYLQSRRPAIRAAVLDADTDEVLGPTGTRESAVI
Ga0210395_1099437323300020582SoilGRPVDVVFAVYLQSRCPAVRAAILDADTDEVLGPTGTRQSAVI
Ga0210405_1078796523300021171SoilVYPGYARGRPVDIVFAVYLQSRRPAIRAAVLETDTDEVPGPTGTRESAVI
Ga0210408_1005468123300021178SoilVVYPGYARGRPVDVVFAVYLQSRCPAVRAAILDADTDEVLGPTGTRQSAVV
Ga0210385_1104421013300021402SoilVDIVFAVYLQSRRPAVRAAVLDADTDEVLGPAGTRESAVL
Ga0210397_1003321713300021403SoilYPGCARGRAVDIVFAVYLQSRRPAVRAVVLDADTDEVLGPTGTRESAVL
Ga0210386_1177856423300021406SoilVDIVFAVYLQSRRPAVRAAVLDADTDEVLGPAGAHESAVL
Ga0210394_1007018933300021420SoilVVYPGYARGRPVDVVFAVYLQSRRPAVRAAILDADTDEVLGPTGTRQSAVI
Ga0210384_1013008323300021432SoilVLAVRGVSGYARGRPVDIVFAVYLQSRRPAVRAAILDADTDEVLGPTGTRQSAVI
Ga0210398_1017350243300021477SoilARPVDIVFAVYLQARRPAIRVAVLDAATDEILGLAGARESAVL
Ga0210398_1130967223300021477SoilVVYPGIVRGRQVDIVFAIYLQARRPAIRAAVLDAETDEVLGTRESALI
Ga0210402_1075579943300021478SoilVVYPGYARGRPVDIVFAVYLQSRRPAIRAAVLDTDTDEVLGPTGTRESAVI
Ga0210410_1018815323300021479SoilVVYPGYARGRPVDVVFAVYLQSRCPAVRAAILDADTDEVLGPTGTRQSAVI
Ga0210409_1024714723300021559SoilVVYPGYARGRPVDIVFAVYLQSRRPAIRAAVLAADTDEVLGPTGTRESAVI
Ga0207692_1077127523300025898Corn, Switchgrass And Miscanthus RhizosphereFVVYPGYARGRPVDIVFAVYLQSRRPAVRAAVLDADTGEVLGPTGTRESAVL
Ga0207663_1098553823300025916Corn, Switchgrass And Miscanthus RhizosphereVVYPGYARGRRVDIVFAVYLQNRRPAIRAAVLDADTDEVLNHTDLRESATI
Ga0207641_1100482023300026088Switchgrass RhizosphereVVYPGYARGRQVDIVFAVYLQNRRPAIRAAVLDADTDEVLGRADTRESAAI
Ga0257147_101507123300026475SoilVYPGYARGRPVDIVFAVYLQSRRPAVRAAIVDADTDEVLGPTGTRESAVL
Ga0209648_1014848113300026551Grasslands SoilGRRVDIVFAVYLQARRPPVRAAVLDADTDEILGPTGTRESATI
Ga0209577_1007810313300026552SoilVYPGYARGRPVHIVFAVYLQSRRPAVRAAVLDVDTDEVLGPAGARESAVL
Ga0208860_100638913300027076Forest SoilVYPGSSRGRRVDIVFAIYLQSRQPAIRAAVLDADTDEVLGPTGARESAVI
Ga0208729_10583923300027166Forest SoilVDIVFAIYLQARRPAVRAAVIDADTDEVLAPVGPLESAVI
Ga0208043_107857523300027570Peatlands SoilIVFAVYLQARRPVIRAAVLDAHTDEVLGLAETREFTAMR
Ga0209178_121038713300027725Agricultural SoilVYPGYARGRPVDIVFAVYLQSRRPAVRAAVLDADTDEVLGPTGTRESAV
Ga0209579_1018364013300027869Surface SoilVYAGVARGRRVDIVFAVYLQSRRPVIRAAVLDAATDEVLGLAETREFTAIR
Ga0209275_1033508323300027884SoilMARVFAIYLQARRPAVRAAVIDADTDEVLAPVGPLESAVI
Ga0307307_1004826423300028718SoilVLAVRLVPGNARGRPVDIVFAVYLQSRRPAVRAAVLDADTDEVLGPTGTRESAVL
Ga0302223_1012476723300028781PalsaGRAVDIVFAIYLQARRPPIRVAVLDAEADSPGPAGARESVVI
Ga0307282_1000765643300028784SoilVLAVRLVPGYARGRPVDIVFAVYLQSRRPAVRAAVLDADTDEVLGPTGTRESAVL
Ga0307504_1005018623300028792SoilVYPGYARGRPVDIVFAVYLQSRRPAVRAAVLDADTDEVLGPAGTRESAVL
Ga0307299_1028983823300028793SoilARGRPVDIVFAVYLQSRRPAVRAAVLDADTDEVLGPTGTRESAVL
Ga0302227_1009794613300028795PalsaRFVVYPGVVSARPVDIVFAVYLQARRPAIRVAVLDAATDEILGLAGARESAVL
Ga0302226_1040558723300028801PalsaIVFAVYLQARRPAIRVAVLDAATDEILGLAAARPSAVL
Ga0307312_1001479513300028828SoilIVFAVYLQSRRPAVRAAVLDADTDEVLGPTGTRESAVL
Ga0307312_1011888313300028828SoilGYARGRPVDIVFAVYLQSRRPAVRVAVLDADTDEVLGPAGTRESAVL
Ga0302229_1007908123300028879PalsaVVYPGVARDRHVDIVFAVYLQARRPAIRAAVLDADTDEILALIETHESAFF
Ga0307308_1001938343300028884SoilDPGYARGRPVDIVFAVYLQSRRPAVRAAVLDADTDEVLGPTGTRESAVL
Ga0308309_1063700523300028906SoilIVFAIFLQARRPAIRVAVLDAATDEILGLAGARPSAVL
Ga0308309_1108863013300028906SoilHDRHVDIVFAVYLQTRRPGIRAAVLDAVTDEILGLIETRESAFF
Ga0311368_1049325213300029882PalsaYPGTVSGRRVDIVFAIYLQARRPAIRVAVLDAATDEILGLAGARESAVL
Ga0311368_1104801723300029882PalsaVFAVFLQARRPAIRVAVLDAATDEILGLAGARPSAVL
Ga0311369_1063519313300029910PalsaFAVYPGVERGRRVDIVFAVYLQTRRPAIRAAVLDADTDEILGLIETRESALF
Ga0311339_1139929923300029999PalsaRFVVYPGVARDRHVDIVFAVYLQARRPAIRAAVLDADTDEILALIETHESAFF
Ga0311372_1094104623300030520PalsaYPGIVSGRRVDIVFAVYLQARRPAIRVAVLDAATDEILGLAGARKSAVL
Ga0311354_1071610423300030618PalsaYPGNVSGRRVDIVFAVYLQARRPAIRVAVLDAATDEILGLAAARPSAVL
Ga0316363_1009388313300030659Peatlands SoilAVYPGSARGRPVDIVFAVYLQSRRPVIRAAVLDADTDEVLGPAGTRESVVI
Ga0302180_1034415513300031028PalsaRRVDIVFAVYLQARRPAVRVAVLDAATDEILGLAGARPSAVL
Ga0307468_10081933813300031740Hardwood Forest SoilVDIVFAVYLQSRRPAVRAAVLDADTDEVLGPTGTRESAVL
Ga0308173_1047339413300032074SoilGRPVDIVFAVYLQSRRPVGRAAVLDADTDEVLGPTGTRESAVL
Ga0311301_1101405923300032160Peatlands SoilPGHARGRQVDIVFAVYLQSRRPAIRAAVLDADTDEVLGPSRTRESVVI
Ga0335082_1050118123300032782SoilVVYPGSERGRPVDIVFAVYLQSRRPAIRAAVLDADTDEVPGPAGIRESAII
Ga0310810_1079788513300033412SoilVYPGYARGRPVDIVFAVYLQSRRPAVRAAVLDADTDEVLGPTGTRESAVL


 ⦗Top⦘


© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.