| Basic Information | |
|---|---|
| Family ID | F101616 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 102 |
| Average Sequence Length | 47 residues |
| Representative Sequence | MWIKTSLIALGTASALAAATPAPTLAQGVYIGPGGVGVDVGRPGWRE |
| Number of Associated Samples | 87 |
| Number of Associated Scaffolds | 102 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Unclassified |
| % of genes with valid RBS motifs | 98.04 % |
| % of genes near scaffold ends (potentially truncated) | 94.12 % |
| % of genes from short scaffolds (< 2000 bps) | 94.12 % |
| Associated GOLD sequencing projects | 83 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.37 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Unclassified (70.588 % of family members) |
| NCBI Taxonomy ID | N/A |
| Taxonomy | N/A |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil (16.667 % of family members) |
| Environment Ontology (ENVO) | Unclassified (39.216 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Host-associated → Plant → Plant rhizosphere (48.039 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Fibrous | Signal Peptide: | Yes | Secondary Structure distribution: | α-helix: 24.00% β-sheet: 10.67% Coil/Unstructured: 65.33% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.37 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 102 Family Scaffolds |
|---|---|---|
| PF03401 | TctC | 4.90 |
| PF13545 | HTH_Crp_2 | 0.98 |
| PF00912 | Transgly | 0.98 |
| PF13442 | Cytochrome_CBB3 | 0.98 |
| PF01527 | HTH_Tnp_1 | 0.98 |
| PF02735 | Ku | 0.98 |
| PF00816 | Histone_HNS | 0.98 |
| PF03466 | LysR_substrate | 0.98 |
| PF13581 | HATPase_c_2 | 0.98 |
| PF11535 | Calci_bind_CcbP | 0.98 |
| PF11306 | DUF3108 | 0.98 |
| PF05433 | Rick_17kDa_Anti | 0.98 |
| COG ID | Name | Functional Category | % Frequency in 102 Family Scaffolds |
|---|---|---|---|
| COG3181 | Tripartite-type tricarboxylate transporter, extracytoplasmic receptor component TctC | Energy production and conversion [C] | 4.90 |
| COG0744 | Penicillin-binding protein 1B/1F, peptidoglycan transglycosylase/transpeptidase | Cell wall/membrane/envelope biogenesis [M] | 0.98 |
| COG1273 | Non-homologous end joining protein Ku, dsDNA break repair | Replication, recombination and repair [L] | 0.98 |
| COG2916 | DNA-binding protein H-NS | Transcription [K] | 0.98 |
| COG4953 | Membrane carboxypeptidase/penicillin-binding protein PbpC | Cell wall/membrane/envelope biogenesis [M] | 0.98 |
| COG5009 | Membrane carboxypeptidase/penicillin-binding protein | Cell wall/membrane/envelope biogenesis [M] | 0.98 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| Unclassified | root | N/A | 70.59 % |
| All Organisms | root | All Organisms | 29.41 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 2001200001|2001331835 | Not Available | 1096 | Open in IMG/M |
| 2088090014|GPIPI_16647150 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales | 2070 | Open in IMG/M |
| 2228664021|ICCgaii200_c0451103 | Not Available | 590 | Open in IMG/M |
| 3300000364|INPhiseqgaiiFebDRAFT_100432344 | Not Available | 769 | Open in IMG/M |
| 3300000789|JGI1027J11758_12301198 | Not Available | 515 | Open in IMG/M |
| 3300000955|JGI1027J12803_100047585 | Not Available | 1135 | Open in IMG/M |
| 3300000955|JGI1027J12803_100259307 | Not Available | 644 | Open in IMG/M |
| 3300000955|JGI1027J12803_100584425 | Not Available | 970 | Open in IMG/M |
| 3300000955|JGI1027J12803_101592141 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 622 | Open in IMG/M |
| 3300000955|JGI1027J12803_102048070 | Not Available | 581 | Open in IMG/M |
| 3300000956|JGI10216J12902_126982814 | Not Available | 704 | Open in IMG/M |
| 3300003267|soilL1_10073510 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1340 | Open in IMG/M |
| 3300004463|Ga0063356_103091603 | Not Available | 717 | Open in IMG/M |
| 3300004479|Ga0062595_102503947 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Methylobacteriaceae → Methylobacterium → unclassified Methylobacterium → Methylobacterium sp. MB200 | 515 | Open in IMG/M |
| 3300005093|Ga0062594_100651774 | Not Available | 937 | Open in IMG/M |
| 3300005171|Ga0066677_10473621 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 718 | Open in IMG/M |
| 3300005332|Ga0066388_100414929 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1990 | Open in IMG/M |
| 3300005340|Ga0070689_100798675 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 830 | Open in IMG/M |
| 3300005347|Ga0070668_100617908 | Not Available | 949 | Open in IMG/M |
| 3300005354|Ga0070675_100470004 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1130 | Open in IMG/M |
| 3300005438|Ga0070701_10170956 | Not Available | 1265 | Open in IMG/M |
| 3300005543|Ga0070672_100721635 | Not Available | 873 | Open in IMG/M |
| 3300005547|Ga0070693_100185905 | Not Available | 1341 | Open in IMG/M |
| 3300005547|Ga0070693_101296490 | Not Available | 563 | Open in IMG/M |
| 3300005561|Ga0066699_11242993 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Methylobacteriaceae → Methylobacterium → unclassified Methylobacterium → Methylobacterium sp. MB200 | 511 | Open in IMG/M |
| 3300005616|Ga0068852_100216296 | Not Available | 1820 | Open in IMG/M |
| 3300005617|Ga0068859_102619085 | Not Available | 555 | Open in IMG/M |
| 3300005840|Ga0068870_10589112 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 754 | Open in IMG/M |
| 3300005937|Ga0081455_10025538 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 5450 | Open in IMG/M |
| 3300005937|Ga0081455_10683973 | Not Available | 656 | Open in IMG/M |
| 3300006175|Ga0070712_101260299 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Methylobacteriaceae → Methylobacterium → unclassified Methylobacterium → Methylobacterium sp. WSM2598 | 644 | Open in IMG/M |
| 3300006755|Ga0079222_11513458 | Not Available | 630 | Open in IMG/M |
| 3300006791|Ga0066653_10145407 | Not Available | 1146 | Open in IMG/M |
| 3300006854|Ga0075425_103076395 | Not Available | 509 | Open in IMG/M |
| 3300006903|Ga0075426_10736847 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Methylobacteriaceae → Methylobacterium | 740 | Open in IMG/M |
| 3300009093|Ga0105240_12649217 | Not Available | 518 | Open in IMG/M |
| 3300009553|Ga0105249_11298457 | Not Available | 799 | Open in IMG/M |
| 3300009553|Ga0105249_13402344 | Not Available | 512 | Open in IMG/M |
| 3300010047|Ga0126382_10600065 | Not Available | 906 | Open in IMG/M |
| 3300010047|Ga0126382_11571297 | Not Available | 608 | Open in IMG/M |
| 3300010159|Ga0099796_10208792 | Not Available | 795 | Open in IMG/M |
| 3300010360|Ga0126372_12736258 | Not Available | 545 | Open in IMG/M |
| 3300010399|Ga0134127_11078467 | Not Available | 866 | Open in IMG/M |
| 3300010403|Ga0134123_12299132 | Not Available | 603 | Open in IMG/M |
| 3300012200|Ga0137382_11198628 | Not Available | 539 | Open in IMG/M |
| 3300012211|Ga0137377_11914960 | Not Available | 510 | Open in IMG/M |
| 3300012212|Ga0150985_107761569 | Not Available | 508 | Open in IMG/M |
| 3300012212|Ga0150985_119867733 | Not Available | 740 | Open in IMG/M |
| 3300012212|Ga0150985_120497909 | Not Available | 694 | Open in IMG/M |
| 3300012582|Ga0137358_10265749 | Not Available | 1166 | Open in IMG/M |
| 3300012929|Ga0137404_11203774 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 697 | Open in IMG/M |
| 3300012960|Ga0164301_10720171 | Not Available | 753 | Open in IMG/M |
| 3300012961|Ga0164302_10906887 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 677 | Open in IMG/M |
| 3300012961|Ga0164302_11470512 | Not Available | 560 | Open in IMG/M |
| 3300012985|Ga0164308_10203754 | Not Available | 1510 | Open in IMG/M |
| 3300012985|Ga0164308_10316315 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1246 | Open in IMG/M |
| 3300012989|Ga0164305_11215775 | Not Available | 654 | Open in IMG/M |
| 3300014325|Ga0163163_10011484 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 8037 | Open in IMG/M |
| 3300014326|Ga0157380_10139399 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 2081 | Open in IMG/M |
| 3300014969|Ga0157376_10435822 | All Organisms → cellular organisms → Bacteria | 1275 | Open in IMG/M |
| 3300015242|Ga0137412_11302389 | Not Available | 507 | Open in IMG/M |
| 3300015372|Ga0132256_102774810 | Not Available | 588 | Open in IMG/M |
| 3300015372|Ga0132256_103923310 | Not Available | 500 | Open in IMG/M |
| 3300015373|Ga0132257_100301292 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Phyllobacteriaceae → Mesorhizobium → Mesorhizobium amorphae → Mesorhizobium amorphae CCBAU 01583 | 1926 | Open in IMG/M |
| 3300015373|Ga0132257_103098390 | Not Available | 605 | Open in IMG/M |
| 3300018028|Ga0184608_10149086 | Not Available | 1007 | Open in IMG/M |
| 3300018469|Ga0190270_11560727 | Not Available | 711 | Open in IMG/M |
| 3300020005|Ga0193697_1137503 | Not Available | 553 | Open in IMG/M |
| 3300021475|Ga0210392_10706393 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Beijerinckiaceae → Rhodoblastus → unclassified Rhodoblastus → Rhodoblastus sp. | 751 | Open in IMG/M |
| 3300021478|Ga0210402_11520248 | Not Available | 597 | Open in IMG/M |
| 3300021560|Ga0126371_10501042 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1362 | Open in IMG/M |
| 3300022756|Ga0222622_10360481 | Not Available | 1015 | Open in IMG/M |
| 3300024055|Ga0247794_10260701 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Reyranellaceae → Reyranella → Reyranella soli | 575 | Open in IMG/M |
| 3300025900|Ga0207710_10148788 | Not Available | 1135 | Open in IMG/M |
| 3300025908|Ga0207643_10594188 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 712 | Open in IMG/M |
| 3300025918|Ga0207662_10009260 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 5412 | Open in IMG/M |
| 3300025931|Ga0207644_11131951 | Not Available | 658 | Open in IMG/M |
| 3300025935|Ga0207709_11225797 | Not Available | 619 | Open in IMG/M |
| 3300025942|Ga0207689_10675370 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 871 | Open in IMG/M |
| 3300025945|Ga0207679_10229444 | Not Available | 1566 | Open in IMG/M |
| 3300026067|Ga0207678_10243318 | Not Available | 1541 | Open in IMG/M |
| 3300026118|Ga0207675_101535431 | Not Available | 686 | Open in IMG/M |
| 3300027669|Ga0208981_1168298 | Not Available | 554 | Open in IMG/M |
| 3300027903|Ga0209488_11163255 | Not Available | 522 | Open in IMG/M |
| 3300027909|Ga0209382_10723103 | Not Available | 1069 | Open in IMG/M |
| 3300028380|Ga0268265_10123592 | Not Available | 2137 | Open in IMG/M |
| 3300028380|Ga0268265_10534985 | Not Available | 1110 | Open in IMG/M |
| 3300028710|Ga0307322_10019309 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1562 | Open in IMG/M |
| 3300028711|Ga0307293_10174985 | Not Available | 683 | Open in IMG/M |
| 3300028716|Ga0307311_10083908 | Not Available | 878 | Open in IMG/M |
| 3300028876|Ga0307286_10094873 | Not Available | 1043 | Open in IMG/M |
| 3300028884|Ga0307308_10482023 | Not Available | 595 | Open in IMG/M |
| 3300030902|Ga0308202_1072945 | Not Available | 669 | Open in IMG/M |
| 3300030903|Ga0308206_1066599 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 749 | Open in IMG/M |
| 3300031092|Ga0308204_10302176 | Not Available | 536 | Open in IMG/M |
| 3300031198|Ga0307500_10227175 | Not Available | 568 | Open in IMG/M |
| 3300031547|Ga0310887_10509702 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 726 | Open in IMG/M |
| 3300031720|Ga0307469_11904914 | Not Available | 576 | Open in IMG/M |
| 3300031908|Ga0310900_11574202 | Not Available | 556 | Open in IMG/M |
| 3300031954|Ga0306926_11874621 | Not Available | 678 | Open in IMG/M |
| 3300032180|Ga0307471_104300555 | Not Available | 503 | Open in IMG/M |
| 3300032205|Ga0307472_100606402 | All Organisms → cellular organisms → Bacteria | 967 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 16.67% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 11.76% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 6.86% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 3.92% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 3.92% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 3.92% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 2.94% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 2.94% |
| Avena Fatua Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Avena Fatua Rhizosphere | 2.94% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 2.94% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 2.94% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 2.94% |
| Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 1.96% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 1.96% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 1.96% |
| Switchgrass Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere | 1.96% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 1.96% |
| Tabebuia Heterophylla Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Tabebuia Heterophylla Rhizosphere | 1.96% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 1.96% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere | 1.96% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere | 1.96% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Arabidopsis Rhizosphere | 1.96% |
| Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 0.98% |
| Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 0.98% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 0.98% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 0.98% |
| Sugarcane Root And Bulk Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Sugarcane Root And Bulk Soil | 0.98% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 0.98% |
| Soil | Environmental → Terrestrial → Soil → Loam → Grasslands → Soil | 0.98% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 0.98% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 0.98% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 0.98% |
| Arabidopsis Thaliana Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Thaliana Rhizosphere | 0.98% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Roots → Rhizosphere → Soil → Switchgrass Rhizosphere | 0.98% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.98% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 0.98% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.98% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.98% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 2001200001 | Soil microbial communities from Waseca County, Minnesota, USA - Sample 10150 | Environmental | Open in IMG/M |
| 2088090014 | Soil microbial communities from Great Prairies - Iowa, Native Prairie soil | Environmental | Open in IMG/M |
| 2228664021 | Soil microbial communities from Great Prairies - Iowa, Continuous Corn soil | Environmental | Open in IMG/M |
| 3300000364 | Soil microbial communities from Great Prairies - Iowa, Native Prairie soil | Environmental | Open in IMG/M |
| 3300000789 | Soil microbial communities from Great Prairies - Iowa, Native Prairie soil | Environmental | Open in IMG/M |
| 3300000955 | Soil microbial communities from Great Prairies - Iowa, Native Prairie soil | Environmental | Open in IMG/M |
| 3300000956 | Soil microbial communities from Great Prairies - Kansas, Native Prairie soil | Environmental | Open in IMG/M |
| 3300003267 | Sugarcane bulk soil Sample L1 | Environmental | Open in IMG/M |
| 3300004463 | Combined assembly of Arabidopsis thaliana microbial communities | Host-Associated | Open in IMG/M |
| 3300004479 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of All WPAs | Environmental | Open in IMG/M |
| 3300005093 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of KBS All Blocks | Environmental | Open in IMG/M |
| 3300005171 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_126 | Environmental | Open in IMG/M |
| 3300005332 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Environmental | Open in IMG/M |
| 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Host-Associated | Open in IMG/M |
| 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Host-Associated | Open in IMG/M |
| 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Environmental | Open in IMG/M |
| 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Host-Associated | Open in IMG/M |
| 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Environmental | Open in IMG/M |
| 3300005561 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_148 | Environmental | Open in IMG/M |
| 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Host-Associated | Open in IMG/M |
| 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Host-Associated | Open in IMG/M |
| 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Host-Associated | Open in IMG/M |
| 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Host-Associated | Open in IMG/M |
| 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Environmental | Open in IMG/M |
| 3300006755 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Plitter | Environmental | Open in IMG/M |
| 3300006791 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_102 | Environmental | Open in IMG/M |
| 3300006854 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD4 | Host-Associated | Open in IMG/M |
| 3300006903 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD5 | Host-Associated | Open in IMG/M |
| 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Host-Associated | Open in IMG/M |
| 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Host-Associated | Open in IMG/M |
| 3300010047 | Tropical forest soil microbial communities from Panama - MetaG Plot_30 | Environmental | Open in IMG/M |
| 3300010159 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 | Environmental | Open in IMG/M |
| 3300010360 | Tropical forest soil microbial communities from Panama - MetaG Plot_6 | Environmental | Open in IMG/M |
| 3300010399 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-3 | Environmental | Open in IMG/M |
| 3300010403 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-3 | Environmental | Open in IMG/M |
| 3300012200 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_20_16 metaG | Environmental | Open in IMG/M |
| 3300012211 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_40_16 metaG | Environmental | Open in IMG/M |
| 3300012212 | Combined assembly of Hopland grassland soil | Host-Associated | Open in IMG/M |
| 3300012582 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_20_16 metaG | Environmental | Open in IMG/M |
| 3300012929 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012960 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_231_MG | Environmental | Open in IMG/M |
| 3300012961 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_202_MG | Environmental | Open in IMG/M |
| 3300012985 | Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_246_MG | Environmental | Open in IMG/M |
| 3300012989 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_237_MG | Environmental | Open in IMG/M |
| 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Host-Associated | Open in IMG/M |
| 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Host-Associated | Open in IMG/M |
| 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Host-Associated | Open in IMG/M |
| 3300015242 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300015372 | Soil combined assembly | Host-Associated | Open in IMG/M |
| 3300015373 | Combined assembly of cpr5 rhizosphere | Host-Associated | Open in IMG/M |
| 3300018028 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_30_coex | Environmental | Open in IMG/M |
| 3300018469 | Populus adjacent soil microbial communities from riparian zone of Weber River, Utah, USA - 320 T | Environmental | Open in IMG/M |
| 3300020005 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L3m2 | Environmental | Open in IMG/M |
| 3300021475 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-30-O | Environmental | Open in IMG/M |
| 3300021478 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-M | Environmental | Open in IMG/M |
| 3300021560 | Tropical forest soil microbial communities from Panama - MetaG Plot_4 | Environmental | Open in IMG/M |
| 3300022756 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM2_5_b1 | Environmental | Open in IMG/M |
| 3300024055 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-S046-202B-6 | Environmental | Open in IMG/M |
| 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300027669 | Forest soil microbial communities from El Dorado National Forest, California, USA - Mediterranean Blodgett CA OM1_M1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027903 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027909 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD5 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300028710 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_380 | Environmental | Open in IMG/M |
| 3300028711 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_150 | Environmental | Open in IMG/M |
| 3300028716 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_198 | Environmental | Open in IMG/M |
| 3300028876 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_140 | Environmental | Open in IMG/M |
| 3300028884 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_195 | Environmental | Open in IMG/M |
| 3300030902 | Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_356 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300030903 | Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_369 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031092 | Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_367 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031198 | Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 14_S | Environmental | Open in IMG/M |
| 3300031547 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T60D4 | Environmental | Open in IMG/M |
| 3300031720 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM2C_515 | Environmental | Open in IMG/M |
| 3300031908 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C24D1 | Environmental | Open in IMG/M |
| 3300031954 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178 (v2) | Environmental | Open in IMG/M |
| 3300032180 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515 | Environmental | Open in IMG/M |
| 3300032205 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_05 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| 2001391693 | 2001200001 | Soil | MGIKTSLIALGVAAATVAATPAPTLAQGVHIGPNAP |
| GPIPI_03105080 | 2088090014 | Soil | MWNKTSVAALGIIGALTCASPAPTLAQGVYVGPGGVGVDVGRPGWRERDYRDRG |
| ICCgaii200_04511031 | 2228664021 | Soil | MWIKTSLIALGFAAATLAATPAPTLAQGVHIGPNGVGIDIGRPGYRER |
| INPhiseqgaiiFebDRAFT_1004323441 | 3300000364 | Soil | MWIKTYLVTLGLVSALAAATPASTLAQGVYIGPGGVGVDVGR |
| JGI1027J11758_123011981 | 3300000789 | Soil | MWIKTYLVTLGLVSALAAATPASTLAQGVYIGPGG |
| JGI1027J12803_1000475854 | 3300000955 | Soil | MWIKTSVAALGIVGALAAATPAPTLAQGVYVGPGGVGVDVGRPGWRERDYRD |
| JGI1027J12803_1002593071 | 3300000955 | Soil | MWIKTYLVTLGLVSALAAATPASTLAQGVYIGPGGVGVDVGRPGW |
| JGI1027J12803_1005844251 | 3300000955 | Soil | MWIKMSLIALGTASALVAATPAPTLAQGVYIGPGGVGVDVGRPGWRERDYYRDDYT |
| JGI1027J12803_1015921411 | 3300000955 | Soil | MWMKTSLIALGIASALAAATPTPTLALDVHVGPGGVGVDT |
| JGI1027J12803_1020480701 | 3300000955 | Soil | MWINTSVAALGIVGALAAATPAPTLAQGVYVGPGGVGVDVGRPGWRERDY |
| JGI10216J12902_1269828141 | 3300000956 | Soil | MWIKTSVAALGIVGALAAATPAPTLAQGVYVGPGGVGV |
| soilL1_100735102 | 3300003267 | Sugarcane Root And Bulk Soil | MWIKTSLIALATVGILATGTPAPTLAQGVHIGPGGVGIDIGRPGWRERHDR |
| Ga0063356_1030916031 | 3300004463 | Arabidopsis Thaliana Rhizosphere | MWIKTSVIALGFAAATLAATPAPTLAQGVHIGPNGVGIDIGRPGYRERHY |
| Ga0062595_1025039471 | 3300004479 | Soil | MWIKTSVAALGIVGALAAATPAPTLAQGVYVGPGGVGVDVGRPGWRERDYRDRGYG |
| Ga0062594_1006517741 | 3300005093 | Soil | MWNKTSVAALGIIGALTCASPAPTLAQGVYVGPGGVGVDVGRPGWRERDYRDRG* |
| Ga0066677_104736212 | 3300005171 | Soil | MWIKTSLAALGMMGALAAATPAPSLAQGVYVGPGGVGVDTGRPGWRH |
| Ga0066388_1004149292 | 3300005332 | Tropical Forest Soil | MWIKTSLAALGLIGALTVASPAPTLAQGVHVGPGGVGVDTGRPGWRHDRAYRGYA* |
| Ga0070689_1007986751 | 3300005340 | Switchgrass Rhizosphere | MWIKTSLIALGLAGAMAAGTPAPTLAQGVHIGPGGVGIDIGRPGYRERHYRGGVYDDYAYDR |
| Ga0070668_1006179081 | 3300005347 | Switchgrass Rhizosphere | MWIKASLIAVGFVAATAAATPAPTLAQGVYVGPGGVSVDVGQ |
| Ga0070675_1004700041 | 3300005354 | Miscanthus Rhizosphere | MWIRTSLIALGLAGAMAAGTPVPTLAQGVHIGPGGVGIDIGR |
| Ga0070701_101709563 | 3300005438 | Corn, Switchgrass And Miscanthus Rhizosphere | MWIKASLIAVGFVAATAAATPAPTLAQGVYVGPGGVSVDVG |
| Ga0070672_1007216352 | 3300005543 | Miscanthus Rhizosphere | MWIKSSLIALGFAGAMVASTPAPAPAQGVHVGPGGVSVDVGR |
| Ga0070693_1001859051 | 3300005547 | Corn, Switchgrass And Miscanthus Rhizosphere | MWIKASLIAVGFVAATAAATPAPTLAQGVYVGPGGVSVDVGQPRYRE |
| Ga0070693_1012964901 | 3300005547 | Corn, Switchgrass And Miscanthus Rhizosphere | MWIKTSLIALGLAAAMAAATPAPTLAQGVHIGPGGVGIDIGR |
| Ga0066699_112429931 | 3300005561 | Soil | MWIKTSLIALGTASALAAATPAPTLAQGVYIGPGGVGVDVGRPGWRERDYY* |
| Ga0068852_1002162961 | 3300005616 | Corn Rhizosphere | MWIKASLIAVGFVAATAAATPAPTLAQGVYVGPGG |
| Ga0068859_1026190851 | 3300005617 | Switchgrass Rhizosphere | MWIKTSLIALGLAGAMATATPAPTLAQGVHIGPGGVGI |
| Ga0068870_105891122 | 3300005840 | Miscanthus Rhizosphere | MWIKTSLIALGFVGAMAAATPSPTLAQGVYVGPGGVGV |
| Ga0081455_100255381 | 3300005937 | Tabebuia Heterophylla Rhizosphere | MWIKTSLAVLGMMGALAAATPTSAVAQGVHIGPGGVGIDVGRPGWRERHYRDRDAYAYER |
| Ga0081455_106839731 | 3300005937 | Tabebuia Heterophylla Rhizosphere | MWIKTSLIAFGIAGAVAATTPAPTLAQGVYVGPGGVGVDL |
| Ga0070712_1012602991 | 3300006175 | Corn, Switchgrass And Miscanthus Rhizosphere | MWNKTSVAALGIIGALTCASPAPTLAQGVYVGPGGVGVDVGRPGWRERDY |
| Ga0079222_115134582 | 3300006755 | Agricultural Soil | MWIKTSVAALGIVGALAAASPAPTLAQGVYVGPGGVGVDIGRP |
| Ga0066653_101454072 | 3300006791 | Soil | MWLKTSLIALGMAGALAAATPAPTLAQGAYVRPGGVG |
| Ga0075425_1030763952 | 3300006854 | Populus Rhizosphere | MWMKMSLIALGMASALATATPAPTLAQGVYVGPGGVGV |
| Ga0075426_107368473 | 3300006903 | Populus Rhizosphere | MWLKTSLIALGMASALAAATSEPTLAQGVYVGPGGVGVDLGRPGWRERHYRDD |
| Ga0105240_126492171 | 3300009093 | Corn Rhizosphere | MWIRTSLIALGLAGAMAAGTPAPTLAQGVHRPGGVGIDIGRPGYRERHYRGGVYDDYA |
| Ga0105249_112984572 | 3300009553 | Switchgrass Rhizosphere | MWIKTSLIALGLAGAMAASTPAPTLAQGVHIGPGGVGIDIGRPGY |
| Ga0105249_134023441 | 3300009553 | Switchgrass Rhizosphere | MWIKTYLVTLGLVSALAAATPASTLAQGVYIGPGGVGVDVGRPGWRERDYYRD |
| Ga0126382_106000653 | 3300010047 | Tropical Forest Soil | MWLKTSLAALGMMGALAAASPTPAVAQGVYIGPDGGGIDTGRPGWRERHYRGHDDYA |
| Ga0126382_115712972 | 3300010047 | Tropical Forest Soil | MWIKTSIAAFGIVGALAAATPAPTLAQGVHIGPGGVGIDVGRPGWRERHYRD |
| Ga0099796_102087921 | 3300010159 | Vadose Zone Soil | MWIKASLIAVGFVAATAAATPAPTLAQGAYVGPGGV |
| Ga0126372_127362581 | 3300010360 | Tropical Forest Soil | MKTSLIALGMASALAAATPAPTLAQGVYVGPGGVGV |
| Ga0134127_110784671 | 3300010399 | Terrestrial Soil | MWIKSSLIALGFAGAMVASTPAPAPAQGVHVGPGGVSVDVG |
| Ga0134123_122991321 | 3300010403 | Terrestrial Soil | MWLKTSLAALGMVGALAAASPTPAVAQGVYIGPGGVG |
| Ga0137382_111986282 | 3300012200 | Vadose Zone Soil | MWIKISLIALGTASALVAATPAPTLAQGVYIGPGGVGVDVGRPGWRERDYY |
| Ga0137377_119149601 | 3300012211 | Vadose Zone Soil | MWIKTSLIARGTASALAAATPAPTLAQGVYIGPGGVGGDVGRPG |
| Ga0150985_1077615691 | 3300012212 | Avena Fatua Rhizosphere | MWIKASLIAFGFVAATAAATPAPTLAQGVYVGPGGVSVDVGQPRYRERYR |
| Ga0150985_1198677331 | 3300012212 | Avena Fatua Rhizosphere | MWIKTSLIALGLAGAMATATPVPTLAQGVHVGPGGVGIDIGRPGYRERHYR |
| Ga0150985_1204979091 | 3300012212 | Avena Fatua Rhizosphere | MWIKASLVVLGLAGAMTAANPAPTLAQGVHIGPGGVGIDIGRPGYRERHYR |
| Ga0137358_102657493 | 3300012582 | Vadose Zone Soil | MWIKTSLIALGTASALAAATPAPTLAQGVYIGPGGVGVDVGRPGWRERDYYRDDYTYERR |
| Ga0137404_112037741 | 3300012929 | Vadose Zone Soil | MWIKTSLIALGLVGTMAAATPAPTLAQGVYIGPNGVGV |
| Ga0164301_107201711 | 3300012960 | Soil | MWIKTSLIALGLAGAMVAATPAPTLAQGVYVGPGGVGIDIGRPGYRERHYR |
| Ga0164302_109068872 | 3300012961 | Soil | MWIKTSLIALGTASALAAATPAPTLAQGVYIGPGGVGVDVGRPGWRE |
| Ga0164302_114705121 | 3300012961 | Soil | MWIKASLIAVGFVAAMAAATPAPTLAQGVYVGPGGVSVDVGR |
| Ga0164308_102037543 | 3300012985 | Soil | MWIKASLIAVGFVAATAAATPAPTLAQGVYVGPGGVSVD |
| Ga0164308_103163151 | 3300012985 | Soil | MWIKTSLIALGLAGAMAAGTPAPTLAQGVHIGPGGVGIDIGRPSYRERHYRGGV |
| Ga0164305_112157751 | 3300012989 | Soil | MWIKTSLIALGLAGTMAASTPAPTLAQGVHVGPGGV |
| Ga0163163_100114841 | 3300014325 | Switchgrass Rhizosphere | MWIKASLIAVGFVAATAAATPAPTLAQGVYVGPGGV |
| Ga0157380_101393991 | 3300014326 | Switchgrass Rhizosphere | MWIKASLIAVGFAAATAAATPAPTLAQGVYVGPGGVSVDVGQPRYRERYRGY |
| Ga0157376_104358223 | 3300014969 | Miscanthus Rhizosphere | MWIKTSLIALGFAAATVAATPAPTLAQGVHIGPNGVGIDIGRPGYRERHYRGGVYDDY |
| Ga0137412_113023891 | 3300015242 | Vadose Zone Soil | MWIKTSLIALGLVGAMTAAAPPTLAQGVHIGPDGVGVDIGRPGYRER |
| Ga0132256_1027748101 | 3300015372 | Arabidopsis Rhizosphere | MWLKTSIIALGMASALAAATPAPTLSQGVYVGPGG |
| Ga0132256_1039233102 | 3300015372 | Arabidopsis Rhizosphere | MWIKTSLIALGFAAATLAATPAPTLAQGVHIGPNGVGIDIGRPGYRERHYRGGVYDDYAYDR |
| Ga0132257_1003012924 | 3300015373 | Arabidopsis Rhizosphere | MWIKTSVAALGIVGALAAATPAPTLAQGVYIGPGGVGVDTGRPDWRERRY |
| Ga0132257_1030983901 | 3300015373 | Arabidopsis Rhizosphere | MWIKTSLVALGIVGAMTAATPTPILAQGVHIGPDGVGVDIGRPG |
| Ga0184608_101490861 | 3300018028 | Groundwater Sediment | MWIKASLIAAGFVAATAAATPAPTLAQGVYVGPGGVSVDVGRPRYREH |
| Ga0190270_115607271 | 3300018469 | Soil | MWIKTSLIALGLAGAMAAATPAPTVAQGVHIGPGGVGVDIGRPGYRERHYRGGA |
| Ga0193697_11375031 | 3300020005 | Soil | MWIKASLIAAGFVAATAAATPAPTLAQGVYVGPGGVSVDVGRPRYREHYY |
| Ga0210392_107063931 | 3300021475 | Soil | MWLKTSLAALGMMGALAAGTPTPALALDVHVGPGGVGVDT |
| Ga0210402_115202482 | 3300021478 | Soil | MWIKISLIALGMASALAAATPAPTLAQGVYIGPGGVGVDVGRP |
| Ga0126371_105010421 | 3300021560 | Tropical Forest Soil | MWLKTSLAALGMMGALAAATPAPTLAQGVYVGPGGVGIDTGRP |
| Ga0222622_103604811 | 3300022756 | Groundwater Sediment | MWIKASLIAAGFVAATAAATPAPTLAQGVYVGPGGVSVDVGRPRYRDHY |
| Ga0247794_102607011 | 3300024055 | Soil | MWIKTSLIALGFVGAMAAATPSPTLAQGVYVGPGGVGVDI |
| Ga0207710_101487883 | 3300025900 | Switchgrass Rhizosphere | MWIKASLIAVGFVAATAAATPAPTLAQGVYVGPGGVS |
| Ga0207643_105941882 | 3300025908 | Miscanthus Rhizosphere | MWIKTSLIALGFVGAMAAATPSPTLAQGVYVGPGGVGVDIGRPGYRERRYRGYDDYA |
| Ga0207662_100092601 | 3300025918 | Switchgrass Rhizosphere | MWIKASLIAVGFVAATAAATPAPTLAQGVYVGPGGVSVDVGRPRYRE |
| Ga0207644_111319511 | 3300025931 | Switchgrass Rhizosphere | MWIKTSLIALGLAGAMATATPAPTLAQGVHIGPGGVGIDIGRPGYRERHYRGGVY |
| Ga0207709_112257972 | 3300025935 | Miscanthus Rhizosphere | MWIKASLIAVGFVAATAAATPAPTLAQGVYVGPGGVSVDVGRPRYRERYR |
| Ga0207689_106753701 | 3300025942 | Miscanthus Rhizosphere | MWIKTSLIALGLAGAMAAGTPAPTLAQGVHIGPGGVGIDIGRPGYRERHYRGG |
| Ga0207679_102294444 | 3300025945 | Corn Rhizosphere | MWIKASLIAVGFVAATAAATPAPTLAQGVYVGPGGVSVDVGRPRYR |
| Ga0207678_102433183 | 3300026067 | Corn Rhizosphere | MWIKTSLIALGFAAATLAATPAPTLAQGVHIGPNGIGIDIGRPGYRERHYRGGV |
| Ga0207675_1015354312 | 3300026118 | Switchgrass Rhizosphere | MWMKTSLIALGMASALAAATPTPTPAQGVHIGPGGVGIDVGRPGWRERHYRGHDAYAYE |
| Ga0208981_11682981 | 3300027669 | Forest Soil | MWIKTSLIALGFAGALAAATPAPSLAQGVYIGPGGVGVDVGRPRYRERDYRGYDDYA |
| Ga0209488_111632551 | 3300027903 | Vadose Zone Soil | MWMKTSLIALGMASALAAATPAPTLAQGVYVGPGGVGVDLGRPGWRERHYRGRDDYRGRDDYAYE |
| Ga0209382_107231031 | 3300027909 | Populus Rhizosphere | MWIKTSLAALGIMGAMAAATPAPTLAQGVYVGPGG |
| Ga0268265_101235921 | 3300028380 | Switchgrass Rhizosphere | MWIKASLIAVGFIAATAAATPAPTLAQGVYVGPGGV |
| Ga0268265_105349852 | 3300028380 | Switchgrass Rhizosphere | MSIKASLIAVGFIAATAAATPAPTLAQGVYVGPGGVSVDVGR |
| Ga0307322_100193094 | 3300028710 | Soil | MWIKTSLIALGLAGAMAATTPAPTLAQGVHVGPGGVSVDIGRPGYRE |
| Ga0307293_101749851 | 3300028711 | Soil | MWIKASLIAAGFVAATAAATPAPTLAQGVYVGPGGVSVDVGRPRYREHYYRGYHDYA |
| Ga0307311_100839081 | 3300028716 | Soil | MWIKASLIAAGFVAATAAATPAPTLAQGVYVGPGG |
| Ga0307286_100948732 | 3300028876 | Soil | MWIKASLIAAGFVAATAAATPAPTLAQGVYVGPGGVSVDVGQPRYRERYRGYDDYAYD |
| Ga0307308_104820232 | 3300028884 | Soil | MWIKTSLIALGTASALAAATPAPTLAQGVYIGPGGVGVDVG |
| Ga0308202_10729452 | 3300030902 | Soil | MWIKASLIAAGFVAATAAATPAPTLAQGVYVGPGGVSVDVG |
| Ga0308206_10665991 | 3300030903 | Soil | MWIKASLIAFGFVAATAAATPAPTLAQGVYVGPGGVSVDVGQPRYRERYRGYDDYAYDRR |
| Ga0308204_103021761 | 3300031092 | Soil | MWIKACLIAVGFVAATAAATPSPTLAQGVYVGPGGVSVDVGQPRYRERYRGYDDYAYD |
| Ga0307500_102271751 | 3300031198 | Soil | MWIKSSLIALGFAGAMVASTPAPAPAQGVHVGPGGVSVDVGRPRYR |
| Ga0310887_105097022 | 3300031547 | Soil | MWIKASLIAVGFVAATAAATPAPTLAQGVYVGPGGVSVDV |
| Ga0307469_119049141 | 3300031720 | Hardwood Forest Soil | MWIKSSLIALGFAGAMVASTPAPAPAQGVHVGPVGVSV |
| Ga0310900_115742022 | 3300031908 | Soil | MWIKASLIAFGFVAATAAATPAPTLAQGVYVGPGGVSVDVGQPRYRERY |
| Ga0306926_118746211 | 3300031954 | Soil | MWIKTSLAALGMMGALAAATPAPTLAQGVYVGPGGVGVDTGRPGW |
| Ga0307471_1043005551 | 3300032180 | Hardwood Forest Soil | MWIKISLIALGMASALAAATPAPTLAQGVYIGPGGVGVDVGRPGWRE |
| Ga0307472_1006064023 | 3300032205 | Hardwood Forest Soil | MWIKISLIALGMASALAAATPAPTLAQGVYIGPGGVGVDVGRPGWRERDYYRDDYTYE |
| ⦗Top⦘ |