 |
Bioinformatics & Integrated Biology Lab Institute for Fundamental Biomedical Research Biomedical Sciences Research Center "Alexander Fleming" |
| Basic Information | |
|---|---|
| Family ID | F101610 |
| Family Type | Metagenome |
| Number of Sequences | 102 |
| Average Sequence Length | 43 residues |
| Representative Sequence | MSSDRIIVDAIKVAQDLLRQNLPPTHNLTDAATVMRFRELVRSQ |
| Number of Associated Samples | 76 |
| Number of Associated Scaffolds | 102 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | No |
| Most common taxonomic group | Unclassified |
| % of genes with valid RBS motifs | 40.00 % |
| % of genes near scaffold ends (potentially truncated) | 24.51 % |
| % of genes from short scaffolds (< 2000 bps) | 19.61 % |
| Associated GOLD sequencing projects | 72 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.38 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Unclassified (77.451 % of family members) |
| NCBI Taxonomy ID | N/A |
| Taxonomy | N/A |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil (22.549 % of family members) |
| Environment Ontology (ENVO) | Unclassified (38.235 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (63.725 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 48.61% β-sheet: 0.00% Coil/Unstructured: 51.39% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.38 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 102 Family Scaffolds |
|---|---|---|
| PF05957 | DUF883 | 3.92 |
| PF00106 | adh_short | 2.94 |
| PF05532 | CsbD | 2.94 |
| PF06055 | ExoD | 2.94 |
| PF04392 | ABC_sub_bind | 2.94 |
| PF01042 | Ribonuc_L-PSP | 1.96 |
| PF13683 | rve_3 | 0.98 |
| PF13763 | DUF4167 | 0.98 |
| PF02735 | Ku | 0.98 |
| PF02894 | GFO_IDH_MocA_C | 0.98 |
| PF02586 | SRAP | 0.98 |
| PF13604 | AAA_30 | 0.98 |
| PF03631 | Virul_fac_BrkB | 0.98 |
| PF01134 | GIDA | 0.98 |
| PF01977 | UbiD | 0.98 |
| PF13586 | DDE_Tnp_1_2 | 0.98 |
| PF03572 | Peptidase_S41 | 0.98 |
| PF00072 | Response_reg | 0.98 |
| COG ID | Name | Functional Category | % Frequency in 102 Family Scaffolds |
|---|---|---|---|
| COG4575 | Membrane-anchored ribosome-binding protein ElaB, inhibits growth in stationary phase, YqjD/DUF883 family | Translation, ribosomal structure and biogenesis [J] | 3.92 |
| COG2984 | ABC-type uncharacterized transport system, periplasmic component | General function prediction only [R] | 2.94 |
| COG3237 | Uncharacterized conserved protein YjbJ, UPF0337 family | Function unknown [S] | 2.94 |
| COG3932 | Exopolysaccharide synthesis protein ExoD | Cell wall/membrane/envelope biogenesis [M] | 2.94 |
| COG0251 | Enamine deaminase RidA/Endoribonuclease Rid7C, YjgF/YER057c/UK114 family | Defense mechanisms [V] | 1.96 |
| COG0043 | 3-polyprenyl-4-hydroxybenzoate decarboxylase | Coenzyme transport and metabolism [H] | 0.98 |
| COG0673 | Predicted dehydrogenase | General function prediction only [R] | 0.98 |
| COG0793 | C-terminal processing protease CtpA/Prc, contains a PDZ domain | Posttranslational modification, protein turnover, chaperones [O] | 0.98 |
| COG1273 | Non-homologous end joining protein Ku, dsDNA break repair | Replication, recombination and repair [L] | 0.98 |
| COG1295 | Uncharacterized membrane protein, BrkB/YihY/UPF0761 family (not an RNase) | Function unknown [S] | 0.98 |
| COG2135 | ssDNA abasic site-binding protein YedK/HMCES, SRAP family | Replication, recombination and repair [L] | 0.98 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| Unclassified | root | N/A | 77.45 % |
| All Organisms | root | All Organisms | 22.55 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300005437|Ga0070710_10613640 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 758 | Open in IMG/M |
| 3300005553|Ga0066695_10031155 | All Organisms → cellular organisms → Bacteria | 3082 | Open in IMG/M |
| 3300005713|Ga0066905_100072452 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 2224 | Open in IMG/M |
| 3300005713|Ga0066905_100350418 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1179 | Open in IMG/M |
| 3300005764|Ga0066903_100305338 | All Organisms → cellular organisms → Bacteria | 2523 | Open in IMG/M |
| 3300005764|Ga0066903_102974120 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 918 | Open in IMG/M |
| 3300006175|Ga0070712_101394045 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 611 | Open in IMG/M |
| 3300009137|Ga0066709_103770171 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 550 | Open in IMG/M |
| 3300009156|Ga0111538_11562520 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 832 | Open in IMG/M |
| 3300010046|Ga0126384_11125687 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 721 | Open in IMG/M |
| 3300010046|Ga0126384_12257520 | Not Available | 525 | Open in IMG/M |
| 3300010360|Ga0126372_10027840 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 3482 | Open in IMG/M |
| 3300010376|Ga0126381_102171121 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 799 | Open in IMG/M |
| 3300016270|Ga0182036_10829286 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 755 | Open in IMG/M |
| 3300021560|Ga0126371_13454973 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 533 | Open in IMG/M |
| 3300031544|Ga0318534_10523348 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 677 | Open in IMG/M |
| 3300031719|Ga0306917_10212465 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1469 | Open in IMG/M |
| 3300031765|Ga0318554_10741933 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 550 | Open in IMG/M |
| 3300031780|Ga0318508_1075545 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 917 | Open in IMG/M |
| 3300031910|Ga0306923_11421720 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 729 | Open in IMG/M |
| 3300031947|Ga0310909_10123377 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 2106 | Open in IMG/M |
| 3300031954|Ga0306926_12853190 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 520 | Open in IMG/M |
| 3300032001|Ga0306922_10833016 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 962 | Open in IMG/M |
| 3300032205|Ga0307472_101298220 | Not Available | 701 | Open in IMG/M |
| 3300033289|Ga0310914_11343158 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 617 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 22.55% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 17.65% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 12.75% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 10.78% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 10.78% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 6.86% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 3.92% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 3.92% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 3.92% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 0.98% |
| Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 0.98% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 0.98% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 0.98% |
| Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil | 0.98% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 0.98% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 0.98% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300000893 | Forest soil microbial communities from Amazon forest - Pasture72 2010 replicate I A001 | Environmental | Open in IMG/M |
| 3300004479 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of All WPAs | Environmental | Open in IMG/M |
| 3300004633 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 1 MoBio | Environmental | Open in IMG/M |
| 3300005174 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_129 | Environmental | Open in IMG/M |
| 3300005179 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_133 | Environmental | Open in IMG/M |
| 3300005332 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Environmental | Open in IMG/M |
| 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Environmental | Open in IMG/M |
| 3300005540 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_146 | Environmental | Open in IMG/M |
| 3300005552 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_150 | Environmental | Open in IMG/M |
| 3300005553 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_144 | Environmental | Open in IMG/M |
| 3300005558 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_147 | Environmental | Open in IMG/M |
| 3300005587 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_103 | Environmental | Open in IMG/M |
| 3300005713 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 36 (version 2) | Environmental | Open in IMG/M |
| 3300005764 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2) | Environmental | Open in IMG/M |
| 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Environmental | Open in IMG/M |
| 3300006046 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_101 | Environmental | Open in IMG/M |
| 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Environmental | Open in IMG/M |
| 3300006844 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Host-Associated | Open in IMG/M |
| 3300006903 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD5 | Host-Associated | Open in IMG/M |
| 3300007788 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 | Environmental | Open in IMG/M |
| 3300009137 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_158 | Environmental | Open in IMG/M |
| 3300009156 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD1 (version 2) | Host-Associated | Open in IMG/M |
| 3300009162 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD2 | Host-Associated | Open in IMG/M |
| 3300010043 | Tropical forest soil microbial communities from Panama - MetaG Plot_26 | Environmental | Open in IMG/M |
| 3300010046 | Tropical forest soil microbial communities from Panama - MetaG Plot_36 | Environmental | Open in IMG/M |
| 3300010301 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_2_09082015 | Environmental | Open in IMG/M |
| 3300010360 | Tropical forest soil microbial communities from Panama - MetaG Plot_6 | Environmental | Open in IMG/M |
| 3300010366 | Tropical forest soil microbial communities from Panama - MetaG Plot_24 | Environmental | Open in IMG/M |
| 3300010376 | Tropical forest soil microbial communities from Panama - MetaG Plot_28 | Environmental | Open in IMG/M |
| 3300010398 | Tropical forest soil microbial communities from Panama - MetaG Plot_35 | Environmental | Open in IMG/M |
| 3300010403 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-3 | Environmental | Open in IMG/M |
| 3300012363 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4A metaG | Environmental | Open in IMG/M |
| 3300012923 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_40_16 metaG | Environmental | Open in IMG/M |
| 3300012989 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_237_MG | Environmental | Open in IMG/M |
| 3300016270 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080 | Environmental | Open in IMG/M |
| 3300016371 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.172 | Environmental | Open in IMG/M |
| 3300016422 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111 | Environmental | Open in IMG/M |
| 3300016445 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108 | Environmental | Open in IMG/M |
| 3300018431 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_104 | Environmental | Open in IMG/M |
| 3300021170 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-26-M | Environmental | Open in IMG/M |
| 3300021560 | Tropical forest soil microbial communities from Panama - MetaG Plot_4 | Environmental | Open in IMG/M |
| 3300024288 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_08_16fungal | Environmental | Open in IMG/M |
| 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300026309 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_110 (SPAdes) | Environmental | Open in IMG/M |
| 3300026536 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_147 (SPAdes) | Environmental | Open in IMG/M |
| 3300027050 | Forest soil microbial communities from Davy Crockett National Forest, Groveton, Texas, USA - Texas A ecozone_OM1H0_M1 (SPAdes) | Environmental | Open in IMG/M |
| 3300031544 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.117b4f26 | Environmental | Open in IMG/M |
| 3300031564 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f21 | Environmental | Open in IMG/M |
| 3300031573 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.AN111 | Environmental | Open in IMG/M |
| 3300031681 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f20 | Environmental | Open in IMG/M |
| 3300031719 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.000 (v2) | Environmental | Open in IMG/M |
| 3300031744 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.00H (v2) | Environmental | Open in IMG/M |
| 3300031765 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f22 | Environmental | Open in IMG/M |
| 3300031768 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f22 | Environmental | Open in IMG/M |
| 3300031780 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f21 | Environmental | Open in IMG/M |
| 3300031781 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f20 | Environmental | Open in IMG/M |
| 3300031846 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.171b2f19 | Environmental | Open in IMG/M |
| 3300031910 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108 (v2) | Environmental | Open in IMG/M |
| 3300031946 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.HF172 | Environmental | Open in IMG/M |
| 3300031947 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.T000H | Environmental | Open in IMG/M |
| 3300031954 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178 (v2) | Environmental | Open in IMG/M |
| 3300032001 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082 (v2) | Environmental | Open in IMG/M |
| 3300032042 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.168b4f26 | Environmental | Open in IMG/M |
| 3300032044 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f20 | Environmental | Open in IMG/M |
| 3300032059 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f27 | Environmental | Open in IMG/M |
| 3300032060 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f18 | Environmental | Open in IMG/M |
| 3300032066 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f18 | Environmental | Open in IMG/M |
| 3300032076 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111 (v2) | Environmental | Open in IMG/M |
| 3300032091 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f25 | Environmental | Open in IMG/M |
| 3300032094 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.166b4f25 | Environmental | Open in IMG/M |
| 3300032205 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_05 | Environmental | Open in IMG/M |
| 3300032261 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 (v2) | Environmental | Open in IMG/M |
| 3300033289 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.AN108 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| AP72_2010_repI_A001DRAFT_10832661 | 3300000893 | Forest Soil | MSSDRVIIDAIKVAQDLLRQNLPPTHNLTDAAAVLRF |
| Ga0062595_1023147121 | 3300004479 | Soil | MSSDRIIVEAIKAAQDLLSQNLPPAHNLTDAATVMRFRELIRSQA |
| Ga0066395_103787172 | 3300004633 | Tropical Forest Soil | MSSDRIIVDAIKVAQDLLLQNLPPAHNFTDAATVMRFRELVRSQAIRSA |
| Ga0066680_107139791 | 3300005174 | Soil | MLRLRFFHMSSDRVIVDAIKVAQDLLRQNLPPARNLTDAAVVLRFRE |
| Ga0066684_109485282 | 3300005179 | Soil | LKPNALGSTVALIFLPMSSDRIIVEAIKAGQNLLSQNLPPAHSLTDAATVMRFRELVRSQ |
| Ga0066388_1036329922 | 3300005332 | Tropical Forest Soil | MSSERVIVEAIKMAQDFLCQNLPAVQNLSDAAAVMRFREIVR |
| Ga0066388_1085374721 | 3300005332 | Tropical Forest Soil | MSDDRIIVDAIKVAQNLLCQNLQAAQNLSDAAAVMRFRELVRS |
| Ga0066388_1086331361 | 3300005332 | Tropical Forest Soil | MSSDRIIVEAIKVAQDLLSQNLPPAHNLTDAATVLRFRELVRSQ |
| Ga0070713_1014311191 | 3300005436 | Corn, Switchgrass And Miscanthus Rhizosphere | MSFLPMSSDRIIVEAIKVGQNLLSQNLPPAHSLTDAATVMRFRELVRSQ |
| Ga0070710_106136402 | 3300005437 | Corn, Switchgrass And Miscanthus Rhizosphere | MSSDRIIADGIKVAQDLLRQNLPPTHNLTDAAVVLRFRELVRSQAIRS |
| Ga0066697_101776793 | 3300005540 | Soil | MSSDRVIVEAIKVGQNLLSQNLPPAHSLTDAATVMRFRELV |
| Ga0066701_106131111 | 3300005552 | Soil | MLRLRFFHMSSDRVIVDAIKVAQDLLRQNLPPARNLTDAAVVLRF |
| Ga0066695_100311556 | 3300005553 | Soil | MSSDRTIVDAIKVAQDLLRQNLPPTHNLTDAATVMRFRELVRSQAIRSA |
| Ga0066695_101232141 | 3300005553 | Soil | MSSDRIIVDVIKVAQDLLAQNLSAAQTLTDAAAVMRFRELVR |
| Ga0066698_107560022 | 3300005558 | Soil | FHMSSDRVIVDAIKVAQDLLRQNLPPARNLTDAAVV* |
| Ga0066654_101059182 | 3300005587 | Soil | MTYERVIVEASKVAQELLRQNLPPTHNLTDAATVLRL |
| Ga0066905_1000724521 | 3300005713 | Tropical Forest Soil | MSSERIIVDAIKVAQNLLNQNLPPAHKLTDAATVLRFRELVRSQAIRSALER |
| Ga0066905_1003504181 | 3300005713 | Tropical Forest Soil | MSSDRIIVDAIKVAQDLLCQNLPAAQKLSDAAAVLRFRELVHSQAVRSAL |
| Ga0066905_1006575101 | 3300005713 | Tropical Forest Soil | MSSDRTIVDAIKVAQDLLRQNLPSTHNLTDAAAVMRFR |
| Ga0066903_1003053386 | 3300005764 | Tropical Forest Soil | MSSDRAIVDAIKVAQDLLRQNLPPTHNLTDAATVMRFRELVRSQA |
| Ga0066903_1008579461 | 3300005764 | Tropical Forest Soil | MSSDRIIVDAIKVAQNLLNQNLPPAHNLTDAATVLRF |
| Ga0066903_1029741203 | 3300005764 | Tropical Forest Soil | MILTVTIVDAIKVAQGLLQQNLPPAHNLTDAATVMRFRELVRSP |
| Ga0066903_1045256301 | 3300005764 | Tropical Forest Soil | MSSDRPIADGIKVAQDLLRQNLPPAHNLTDAAVVLRFRELVRSQA |
| Ga0070717_119571651 | 3300006028 | Corn, Switchgrass And Miscanthus Rhizosphere | MSSDRIIADGIKVAQDLLRQNLPPTHNLTDAAVVLRFRELV |
| Ga0066652_1019692831 | 3300006046 | Soil | MTYERIIVEAIKVAQELLRQNLPPTHNLTDAATVLRL |
| Ga0070712_1013940451 | 3300006175 | Corn, Switchgrass And Miscanthus Rhizosphere | MSSDRIIVEAIKVGQNLLSQNLPPAHSLTDAATVMRFRELVRSQAIRSAL |
| Ga0075428_1008977201 | 3300006844 | Populus Rhizosphere | MSSDRIIVEAIKVGQNLLSQNLPPAHSLTDAATVMRF |
| Ga0075426_109945422 | 3300006903 | Populus Rhizosphere | MSSDRIIVEAIKMGQSLLSQNLPPAHSLTDAATVTRFRELVRSQALR |
| Ga0099795_103679882 | 3300007788 | Vadose Zone Soil | MSFLPMSSDRIIVEAIKVGQNLLSQNLPPAHSLTDAA |
| Ga0066709_1024029861 | 3300009137 | Grasslands Soil | MLRLRFFHMSSDRVIVDAIKVAQDLLRQNLPPARNLTDA |
| Ga0066709_1037701711 | 3300009137 | Grasslands Soil | MSSDRVIVDTIKVAQDLLRQNLPPTHNLTDATTVMRFRELVRSQATSTIRSFRSRC |
| Ga0111538_115625202 | 3300009156 | Populus Rhizosphere | VSSDRIIVETIKVAQGLLCQNLPAVHTLSDAALVMRFRELVRSQTVRAALERS |
| Ga0075423_127004862 | 3300009162 | Populus Rhizosphere | MSSDRIIVDAIKVAQDLLLQNLPPAHNFTDAATVMR |
| Ga0126380_111150391 | 3300010043 | Tropical Forest Soil | MSSDRVIVEALKVAQELLRQNLPPTHNLTDAATVLRLRERPSGCLG |
| Ga0126384_108867682 | 3300010046 | Tropical Forest Soil | MSSDRIIVDAIKVAQDLLWQNLPPTHNLTDAATVMRFRELVRSQA |
| Ga0126384_111256871 | 3300010046 | Tropical Forest Soil | MSPDRLIVEAIKSAQDLLRQNLPPGHNLTDAATVLRLRELVHSP |
| Ga0126384_122575201 | 3300010046 | Tropical Forest Soil | MSSERIIVDAIKVAQNLLNQNLPPAHKLTDAATVLRFRELVRSQAIRS |
| Ga0134070_104297451 | 3300010301 | Grasslands Soil | MLRLRFFHMSSDRVIVDAIKVAQDLLRQNLPPARNLTDAAVVLRFREFVRS |
| Ga0126372_100278406 | 3300010360 | Tropical Forest Soil | MSSDRVIIDAIKVAQDLLRQNLPPTHNLTDAAAVLRFRELVRSQAIRSALE |
| Ga0126372_116251241 | 3300010360 | Tropical Forest Soil | VSSDRIIVEAIKVAQDLLSQNLPPAHNLTDAATVLRFRELVRSQAI |
| Ga0126379_113390343 | 3300010366 | Tropical Forest Soil | MSSDRTIVDAIKVAQDLLRQNLPPAHNLTDAATVMRFRELVRSQAIR |
| Ga0126381_1021711211 | 3300010376 | Tropical Forest Soil | MSSDRIIIDAIKVAKDLLWQNLPPTHNLTDAATVMRFRELVRSQAIRSTLER |
| Ga0126383_108582243 | 3300010398 | Tropical Forest Soil | MSSDRTIVDAIKVAQDLLRQNLPPAHNLTDAATVMRFRELVRSQ |
| Ga0126383_116460271 | 3300010398 | Tropical Forest Soil | VNSDRIIVDAIKVAQNLLSQNLTPAHNLTDAATVLRFRE |
| Ga0126383_123739291 | 3300010398 | Tropical Forest Soil | MSSDRTIVDAIKVAQDLLRQNLPPTHNLTDAATVMRFRELVRSQAIRS |
| Ga0126383_127644631 | 3300010398 | Tropical Forest Soil | MSSERIIVDAIKVAQNLLNQNLPPAHKLTDAATVL |
| Ga0134123_124272332 | 3300010403 | Terrestrial Soil | MIPDRLIVEAIKVAQDLLRQNLPPMHNLTDAATVLRLREVHR |
| Ga0137390_118824561 | 3300012363 | Vadose Zone Soil | MSSDRIIVDAFKVAQNLLSQNLPPAHNLTDAATVLRFRELVRSQAI |
| Ga0137359_103440094 | 3300012923 | Vadose Zone Soil | MSSDRIIVDAIKVAQDLLRQNLPPTHNLTDAATVMRFRELVRSQ |
| Ga0164305_101587981 | 3300012989 | Soil | VAYEFLPMSSDRIIVEAIKVGQNLLSQNLPPAHSLTDAATVMRFRELVRSQ |
| Ga0182036_108292861 | 3300016270 | Soil | MSSDRVIIDAIKVAKDLLWQNLPPTHNLTDAATVMRFRELVRSQAIRSALE |
| Ga0182034_104130331 | 3300016371 | Soil | MSSDRVIVDAIKVAQDLLRQNLPTAHHLTDAAAVLRF |
| Ga0182034_112766361 | 3300016371 | Soil | VPMSSDRTIVDAIKVAQDLLRQNLPPAHNLTDAATVM |
| Ga0182039_108844103 | 3300016422 | Soil | MSSDRTIVDAIKVAQDLLRQNLPSTHNLTDAAAVMRFRELVRSQ |
| Ga0182038_106746511 | 3300016445 | Soil | MSSDRVIVDAIKVAQDLLCQNLPPAHNLTDAATVM |
| Ga0182038_114020661 | 3300016445 | Soil | MSSDRAIIDAIKVAKDLLWQNLPPTHNLTDAATVMRFR |
| Ga0066655_105125461 | 3300018431 | Grasslands Soil | AFFHMSSDRVIVDAIKVAQDLLRQNLPPARNLTDAAVV |
| Ga0066655_110954462 | 3300018431 | Grasslands Soil | MSSDRIIVDAIKVAQDLLLQNLPPAHNFTDAATVMRFRE |
| Ga0210400_110286691 | 3300021170 | Soil | MSSDRIIVDAIKVAQDLLLQNLPPAHNFTDAATVMRFRELVRSQAIRSAL |
| Ga0210400_114094682 | 3300021170 | Soil | MSSDRTIVDAIKVAQDLLRQNLPPTHNLTDAATVMR |
| Ga0126371_134549732 | 3300021560 | Tropical Forest Soil | MSSDHVIAEGIKVAQNFLRQNLPSTRNLTDAAVVLRFRELVRSQAIRS |
| Ga0179589_105495541 | 3300024288 | Vadose Zone Soil | MSSDRIIVDAFKVAQNLLSQNLPPAHNLTDAATVLRFRELV |
| Ga0207684_110926092 | 3300025910 | Corn, Switchgrass And Miscanthus Rhizosphere | MSSDRIIADGIKVAQDLLRQNLPPTHNLTDAAVVLR |
| Ga0207693_109755491 | 3300025915 | Corn, Switchgrass And Miscanthus Rhizosphere | MSFLPMSSDRIIVEAIKVGQNLLSQNLPPAHSLTDAATVMRFRELVRS |
| Ga0207665_104493704 | 3300025939 | Corn, Switchgrass And Miscanthus Rhizosphere | MSSDRVIADGIKVAQDLLRQNLPPTHNLTDAAVVLRFREL |
| Ga0209055_10889631 | 3300026309 | Soil | MSSDRTIVDAIKVAQDLLRQNLPPTHNLTDAATVMRFRELVRSQ |
| Ga0209058_11569731 | 3300026536 | Soil | SAVFHMSSDRVIVDAIKVAQDLLRQNLPPARNLTDAAVV |
| Ga0209325_10021711 | 3300027050 | Forest Soil | MSSDRTIVDAIKVAQDLLRQNLPPTHNLTDAATVMRFR |
| Ga0318534_105233481 | 3300031544 | Soil | MSSERIIVDGIKVAQNLLNQNLPPAHNLTDAATVLRFRELVRSQAIRSALE |
| Ga0318573_104102821 | 3300031564 | Soil | MSSDRIIVDAIKVAQDLLLQNLPPAHSFTDAATVMRFRELVRSQPIRSALE |
| Ga0310915_100959371 | 3300031573 | Soil | MSSDRVIVDAIKVAQDLLRQNLPPAHHLTDAAAVLRFRELVRSQA |
| Ga0318572_100363781 | 3300031681 | Soil | MSSDRVIIDAIKVAKDLLWQNLPPTHNLTDAATVMRFRELVR |
| Ga0306917_102124652 | 3300031719 | Soil | MSSDRIIVDTIKVAQDLLLQNLPPAHNLTDAATVMRFRELFRSQAIRSALD |
| Ga0306917_109285891 | 3300031719 | Soil | MSSDRIIVDAIKVAQDLLLQNLPPAHNFTDAATVMRFR |
| Ga0306918_110293401 | 3300031744 | Soil | MSSDRIIVDAIKVAQDLLLQNLPPAHNFTDAATVMRFRELVRSQ |
| Ga0318554_107419332 | 3300031765 | Soil | MSSDRTIVDAIKVAQDLLRQNLPPTHNLTDAATVMRFRELVRSQAIRSALE |
| Ga0318509_107713621 | 3300031768 | Soil | MSSDRIIVDAIKVAQDLLRQNLPPMHNLTDAATVMRFRELVRSQ |
| Ga0318508_10755451 | 3300031780 | Soil | MSSERIIVDAIKVAQNLLNQNLPPAHNLTDAATVLRFRELVRSQAIRSA |
| Ga0318547_110756732 | 3300031781 | Soil | MSSDRTIFDAIKVAQDLLRQNLPSTHNLTDAAAVMRFRELVRSQAIRS |
| Ga0318512_101602731 | 3300031846 | Soil | MSSDRIIVDAIKVAQDLLLQNLPPAHNFTDAATVMRFRELV |
| Ga0306923_114217202 | 3300031910 | Soil | MSSDRIIVDAIKVAQDLLRQNLPPMHNLTDAATVMRFRELVRSQAIRSALVR |
| Ga0310910_110561411 | 3300031946 | Soil | MSSDRTIVEAIKVAQDWLRQNLPPTHNLTDAATVMRFRELVRSQ |
| Ga0310909_101233774 | 3300031947 | Soil | MSSDRVIVDAIKVAQDLLRQNLPTAHHLTDAAAVLRFRELV |
| Ga0310909_108113451 | 3300031947 | Soil | MSSDRTIFDAIKVAQDLLRQNLPSTHNLTDAAAVMRFRELV |
| Ga0306926_114389171 | 3300031954 | Soil | MSSDRVIVDAIKVAQDLLCQNLPPAHNLTDAATVMRFRELV |
| Ga0306926_115338501 | 3300031954 | Soil | MSSDRIIVDAIKVAQDLLLQNLPPAHNFTDAATVMRF |
| Ga0306926_117102301 | 3300031954 | Soil | MSSERIIVDAIKVAQNLLNQNLPPAHNLTDAATVLRFRELVR |
| Ga0306926_128531901 | 3300031954 | Soil | MSSDRVIVDAIKVAQDLLRQNLPPAHHLTDAAAVLRFRELVRSQAVRSALD |
| Ga0306922_108330161 | 3300032001 | Soil | MSSDRIIVDTIKVAQDLLLQNLPPAHNLTDAATVMRFRDILARES |
| Ga0318545_101116841 | 3300032042 | Soil | MSSDRTIVDAIKVAQDLLRQNLTPTHNLTDAATVM |
| Ga0318558_101255311 | 3300032044 | Soil | MSSDRTIVDAIKVAQDLLRQNLPPAHNLTDAATVM |
| Ga0318533_104072921 | 3300032059 | Soil | MSSDRVIVDAIKVAQDLLRQNLPPAHHLTDAAAVLRFRELVRSQAVRSA |
| Ga0318533_105464662 | 3300032059 | Soil | MSSDRIIVDAIKVAQDLLLQNLPPAHNFTDAATVMRFRELVRSQAIRSALE |
| Ga0318505_102854312 | 3300032060 | Soil | MSSDRTIVDAIKVAQDLLRQNLPSTHNLTDAAAVM |
| Ga0318514_107090072 | 3300032066 | Soil | MHSDRTIVDAIKVAQDLLRQNLASTHNLTDAAAVMRFRELVRSQVIR |
| Ga0306924_121625502 | 3300032076 | Soil | MSSDRTIFDAIKVAQDLLRQNLPSTHNLTDAAAVMRFRELVRSQAIR |
| Ga0318577_100175277 | 3300032091 | Soil | MSSDRIIVDTIKVAQDLLLQNLPPAHNLTDAATVMRF |
| Ga0318540_105559771 | 3300032094 | Soil | VPMSSDRTIVDAIKVAQDLLRQNLPPAHNLTDAATV |
| Ga0307472_1012982203 | 3300032205 | Hardwood Forest Soil | MSSDRLIVEAIKVAQELLRQNLPPTHNLTDAATVLRLRELMRSPSIQ |
| Ga0306920_1008700581 | 3300032261 | Soil | MSSDRTIVDAIKVAQDLLRQNLLSTHNLTDAATVMRFRELVRSQA |
| Ga0306920_1032924801 | 3300032261 | Soil | MSSDRTIVEAIKVAQDWLRQNLPPTHNLTDAATVMRFRELVRSQAI |
| Ga0310914_113431581 | 3300033289 | Soil | MSSDRIIIDAIKVAKDLLWQNLPPTHNLTDAATVMRFR |
| ⦗Top⦘ |
|
Bioinformatics & Integrated Biology Lab Institute for Fundamental Biomedical Research Biomedical Sciences Research Center "Alexander Fleming" |