| Basic Information | |
|---|---|
| Family ID | F101609 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 102 |
| Average Sequence Length | 44 residues |
| Representative Sequence | FGVISFELFGQLHNVVAEPPAGRDAFFAECIRRWITFTAIT |
| Number of Associated Samples | 89 |
| Number of Associated Scaffolds | 102 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 3.92 % |
| % of genes near scaffold ends (potentially truncated) | 88.24 % |
| % of genes from short scaffolds (< 2000 bps) | 91.18 % |
| Associated GOLD sequencing projects | 84 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.53 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (72.549 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil (34.314 % of family members) |
| Environment Ontology (ENVO) | Unclassified (30.392 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (39.216 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 23.19% β-sheet: 20.29% Coil/Unstructured: 56.52% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.53 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 102 Family Scaffolds |
|---|---|---|
| PF08450 | SGL | 53.92 |
| PF00293 | NUDIX | 5.88 |
| PF02720 | DUF222 | 3.92 |
| PF00920 | ILVD_EDD | 2.94 |
| PF12706 | Lactamase_B_2 | 2.94 |
| PF07690 | MFS_1 | 1.96 |
| PF00155 | Aminotran_1_2 | 0.98 |
| PF03988 | DUF347 | 0.98 |
| PF00884 | Sulfatase | 0.98 |
| PF01230 | HIT | 0.98 |
| PF13520 | AA_permease_2 | 0.98 |
| PF01136 | Peptidase_U32 | 0.98 |
| PF07592 | DDE_Tnp_ISAZ013 | 0.98 |
| PF01636 | APH | 0.98 |
| COG ID | Name | Functional Category | % Frequency in 102 Family Scaffolds |
|---|---|---|---|
| COG3386 | Sugar lactone lactonase YvrE | Carbohydrate transport and metabolism [G] | 53.92 |
| COG3391 | DNA-binding beta-propeller fold protein YncE | General function prediction only [R] | 53.92 |
| COG0129 | Dihydroxyacid dehydratase/phosphogluconate dehydratase | Carbohydrate transport and metabolism [G] | 5.88 |
| COG0826 | 23S rRNA C2501 and tRNA U34 5'-hydroxylation protein RlhA/YrrN/YrrO, U32 peptidase family | Translation, ribosomal structure and biogenesis [J] | 0.98 |
| COG4705 | Uncharacterized membrane-anchored protein | Function unknown [S] | 0.98 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 72.55 % |
| Unclassified | root | N/A | 27.45 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 2170459017|G14TP7Y01CQ05C | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales | 626 | Open in IMG/M |
| 3300004091|Ga0062387_101773131 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → Pseudonocardiaceae → Pseudonocardia → Pseudonocardia asaccharolytica | 503 | Open in IMG/M |
| 3300005172|Ga0066683_10784242 | All Organisms → cellular organisms → Bacteria | 556 | Open in IMG/M |
| 3300005343|Ga0070687_100915723 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 630 | Open in IMG/M |
| 3300005434|Ga0070709_10389212 | Not Available | 1038 | Open in IMG/M |
| 3300005437|Ga0070710_10531510 | All Organisms → cellular organisms → Bacteria | 809 | Open in IMG/M |
| 3300005439|Ga0070711_101578757 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 573 | Open in IMG/M |
| 3300005535|Ga0070684_100858847 | All Organisms → cellular organisms → Bacteria | 849 | Open in IMG/M |
| 3300005553|Ga0066695_10699002 | All Organisms → cellular organisms → Bacteria | 595 | Open in IMG/M |
| 3300005563|Ga0068855_101365239 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 731 | Open in IMG/M |
| 3300005617|Ga0068859_102100302 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 624 | Open in IMG/M |
| 3300006050|Ga0075028_100694300 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 612 | Open in IMG/M |
| 3300006059|Ga0075017_100315842 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1157 | Open in IMG/M |
| 3300006175|Ga0070712_101412333 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 607 | Open in IMG/M |
| 3300006175|Ga0070712_101681043 | All Organisms → cellular organisms → Bacteria | 555 | Open in IMG/M |
| 3300006175|Ga0070712_102045579 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 502 | Open in IMG/M |
| 3300006176|Ga0070765_100134173 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2189 | Open in IMG/M |
| 3300006575|Ga0074053_11484943 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 545 | Open in IMG/M |
| 3300009092|Ga0105250_10323432 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 671 | Open in IMG/M |
| 3300009098|Ga0105245_12525393 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 567 | Open in IMG/M |
| 3300009174|Ga0105241_12357100 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 531 | Open in IMG/M |
| 3300009522|Ga0116218_1132682 | Not Available | 1132 | Open in IMG/M |
| 3300010046|Ga0126384_12152780 | All Organisms → cellular organisms → Bacteria | 536 | Open in IMG/M |
| 3300010047|Ga0126382_10201831 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1415 | Open in IMG/M |
| 3300010047|Ga0126382_10699860 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 850 | Open in IMG/M |
| 3300010301|Ga0134070_10438216 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 521 | Open in IMG/M |
| 3300010329|Ga0134111_10513272 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 527 | Open in IMG/M |
| 3300010339|Ga0074046_10872232 | Not Available | 525 | Open in IMG/M |
| 3300010343|Ga0074044_10444533 | Not Available | 848 | Open in IMG/M |
| 3300010376|Ga0126381_104263727 | Not Available | 554 | Open in IMG/M |
| 3300010379|Ga0136449_101291089 | Not Available | 1139 | Open in IMG/M |
| 3300012200|Ga0137382_10759389 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 696 | Open in IMG/M |
| 3300012285|Ga0137370_10512936 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 735 | Open in IMG/M |
| 3300012357|Ga0137384_10051893 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 3395 | Open in IMG/M |
| 3300012357|Ga0137384_10374779 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1177 | Open in IMG/M |
| 3300012357|Ga0137384_10501079 | Not Available | 997 | Open in IMG/M |
| 3300012363|Ga0137390_10990724 | Not Available | 793 | Open in IMG/M |
| 3300012502|Ga0157347_1003579 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1399 | Open in IMG/M |
| 3300012989|Ga0164305_10258834 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1262 | Open in IMG/M |
| 3300016270|Ga0182036_11936209 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 500 | Open in IMG/M |
| 3300016294|Ga0182041_11511790 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 618 | Open in IMG/M |
| 3300016422|Ga0182039_11386622 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 638 | Open in IMG/M |
| 3300017926|Ga0187807_1124502 | Not Available | 817 | Open in IMG/M |
| 3300017972|Ga0187781_10765675 | Not Available | 700 | Open in IMG/M |
| 3300017973|Ga0187780_11201414 | Not Available | 556 | Open in IMG/M |
| 3300017974|Ga0187777_10487445 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 860 | Open in IMG/M |
| 3300018001|Ga0187815_10066556 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales | 1515 | Open in IMG/M |
| 3300018001|Ga0187815_10334889 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 642 | Open in IMG/M |
| 3300018032|Ga0187788_10536345 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 510 | Open in IMG/M |
| 3300018086|Ga0187769_10743402 | Not Available | 742 | Open in IMG/M |
| 3300020581|Ga0210399_10699428 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 833 | Open in IMG/M |
| 3300021088|Ga0210404_10591543 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 630 | Open in IMG/M |
| 3300021180|Ga0210396_10721948 | Not Available | 859 | Open in IMG/M |
| 3300021181|Ga0210388_10643251 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 926 | Open in IMG/M |
| 3300021401|Ga0210393_11116824 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 636 | Open in IMG/M |
| 3300021407|Ga0210383_10211419 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 1660 | Open in IMG/M |
| 3300021432|Ga0210384_10881238 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 795 | Open in IMG/M |
| 3300021479|Ga0210410_11350671 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 605 | Open in IMG/M |
| 3300024288|Ga0179589_10445203 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 597 | Open in IMG/M |
| 3300025915|Ga0207693_10739553 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 760 | Open in IMG/M |
| 3300025916|Ga0207663_10367045 | Not Available | 1093 | Open in IMG/M |
| 3300025927|Ga0207687_11559274 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 567 | Open in IMG/M |
| 3300025932|Ga0207690_10848540 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 756 | Open in IMG/M |
| 3300027047|Ga0208730_1032585 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Acetobacteraceae | 606 | Open in IMG/M |
| 3300027604|Ga0208324_1169118 | Not Available | 589 | Open in IMG/M |
| 3300027812|Ga0209656_10046656 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 2474 | Open in IMG/M |
| 3300028782|Ga0307306_10253135 | All Organisms → cellular organisms → Bacteria | 516 | Open in IMG/M |
| 3300028906|Ga0308309_10158257 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1830 | Open in IMG/M |
| 3300028906|Ga0308309_10229326 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1544 | Open in IMG/M |
| 3300031543|Ga0318516_10617147 | Not Available | 619 | Open in IMG/M |
| 3300031543|Ga0318516_10766226 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 546 | Open in IMG/M |
| 3300031544|Ga0318534_10236456 | Not Available | 1054 | Open in IMG/M |
| 3300031640|Ga0318555_10010223 | All Organisms → cellular organisms → Bacteria | 4098 | Open in IMG/M |
| 3300031668|Ga0318542_10571881 | Not Available | 589 | Open in IMG/M |
| 3300031680|Ga0318574_10023656 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 3030 | Open in IMG/M |
| 3300031680|Ga0318574_10073380 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1852 | Open in IMG/M |
| 3300031713|Ga0318496_10538330 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Sphingobacteriia → Sphingobacteriales → Sphingobacteriaceae → Mucilaginibacter → Mucilaginibacter gotjawali | 645 | Open in IMG/M |
| 3300031723|Ga0318493_10328980 | Not Available | 828 | Open in IMG/M |
| 3300031740|Ga0307468_100854200 | Not Available | 783 | Open in IMG/M |
| 3300031751|Ga0318494_10050368 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2199 | Open in IMG/M |
| 3300031765|Ga0318554_10041257 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2507 | Open in IMG/M |
| 3300031769|Ga0318526_10077238 | Not Available | 1308 | Open in IMG/M |
| 3300031770|Ga0318521_10230246 | Not Available | 1077 | Open in IMG/M |
| 3300031770|Ga0318521_10679373 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 625 | Open in IMG/M |
| 3300031792|Ga0318529_10383979 | Not Available | 654 | Open in IMG/M |
| 3300031797|Ga0318550_10365621 | Not Available | 699 | Open in IMG/M |
| 3300031797|Ga0318550_10478866 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 601 | Open in IMG/M |
| 3300031835|Ga0318517_10211805 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 874 | Open in IMG/M |
| 3300031910|Ga0306923_10954423 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 935 | Open in IMG/M |
| 3300031946|Ga0310910_11046401 | Not Available | 637 | Open in IMG/M |
| 3300031947|Ga0310909_10978984 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae | 692 | Open in IMG/M |
| 3300032009|Ga0318563_10639040 | Not Available | 573 | Open in IMG/M |
| 3300032039|Ga0318559_10104923 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1254 | Open in IMG/M |
| 3300032041|Ga0318549_10275994 | All Organisms → cellular organisms → Bacteria | 757 | Open in IMG/M |
| 3300032042|Ga0318545_10057706 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1322 | Open in IMG/M |
| 3300032055|Ga0318575_10167949 | Not Available | 1096 | Open in IMG/M |
| 3300032055|Ga0318575_10378160 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae | 718 | Open in IMG/M |
| 3300032066|Ga0318514_10037227 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2308 | Open in IMG/M |
| 3300032205|Ga0307472_100771458 | Not Available | 874 | Open in IMG/M |
| 3300032770|Ga0335085_10228729 | All Organisms → cellular organisms → Bacteria | 2253 | Open in IMG/M |
| 3300032770|Ga0335085_11235472 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae | 792 | Open in IMG/M |
| 3300033158|Ga0335077_10841865 | All Organisms → cellular organisms → Bacteria | 930 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 34.31% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 7.84% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 6.86% |
| Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 4.90% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 3.92% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 3.92% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment | 2.94% |
| Peatlands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil | 2.94% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 2.94% |
| Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil | 2.94% |
| Bog Forest Soil | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil | 1.96% |
| Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 1.96% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 1.96% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 1.96% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 1.96% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 1.96% |
| Bog Forest Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Bog Forest Soil | 1.96% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 1.96% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 0.98% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 0.98% |
| Corn Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere | 0.98% |
| Switchgrass Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere | 0.98% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 0.98% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 0.98% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Roots → Rhizosphere → Unclassified → Arabidopsis Rhizosphere | 0.98% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.98% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 0.98% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere | 0.98% |
| Switchgrass, Maize And Mischanthus Litter | Engineered → Solid Waste → Grass → Composting → Unclassified → Switchgrass, Maize And Mischanthus Litter | 0.98% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 2170459017 | Litter degradation ZMR4 | Engineered | Open in IMG/M |
| 3300004091 | Coassembly of ECP14_OM1, ECP14_OM2, ECP14_OM3 | Environmental | Open in IMG/M |
| 3300005172 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_132 | Environmental | Open in IMG/M |
| 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Environmental | Open in IMG/M |
| 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Environmental | Open in IMG/M |
| 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Environmental | Open in IMG/M |
| 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Environmental | Open in IMG/M |
| 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Environmental | Open in IMG/M |
| 3300005553 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_144 | Environmental | Open in IMG/M |
| 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Host-Associated | Open in IMG/M |
| 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Host-Associated | Open in IMG/M |
| 3300006050 | Freshwater sediment microbial communities from Pennsylvania, USA - Little Laurel Run_MetaG_LLR_2014 | Environmental | Open in IMG/M |
| 3300006059 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Alex Branch Run_MetaG_ABR_2012 | Environmental | Open in IMG/M |
| 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Environmental | Open in IMG/M |
| 3300006176 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5 | Environmental | Open in IMG/M |
| 3300006575 | Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtLAA (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300009092 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG | Host-Associated | Open in IMG/M |
| 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Host-Associated | Open in IMG/M |
| 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Host-Associated | Open in IMG/M |
| 3300009522 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_5_LS metaG | Environmental | Open in IMG/M |
| 3300010046 | Tropical forest soil microbial communities from Panama - MetaG Plot_36 | Environmental | Open in IMG/M |
| 3300010047 | Tropical forest soil microbial communities from Panama - MetaG Plot_30 | Environmental | Open in IMG/M |
| 3300010301 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_2_09082015 | Environmental | Open in IMG/M |
| 3300010329 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_2_11112015 | Environmental | Open in IMG/M |
| 3300010339 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - Bog Forest MetaG ECP23OM3 | Environmental | Open in IMG/M |
| 3300010343 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - Bog Forest MetaG ECP23OM1 | Environmental | Open in IMG/M |
| 3300010376 | Tropical forest soil microbial communities from Panama - MetaG Plot_28 | Environmental | Open in IMG/M |
| 3300010379 | Sb_50d combined assembly | Environmental | Open in IMG/M |
| 3300012200 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_20_16 metaG | Environmental | Open in IMG/M |
| 3300012285 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_20_16 metaG | Environmental | Open in IMG/M |
| 3300012357 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_60_16 metaG | Environmental | Open in IMG/M |
| 3300012363 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4A metaG | Environmental | Open in IMG/M |
| 3300012502 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.2.yng.040610 | Host-Associated | Open in IMG/M |
| 3300012989 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_237_MG | Environmental | Open in IMG/M |
| 3300016270 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080 | Environmental | Open in IMG/M |
| 3300016294 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178 | Environmental | Open in IMG/M |
| 3300016422 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111 | Environmental | Open in IMG/M |
| 3300017926 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW_2 | Environmental | Open in IMG/M |
| 3300017972 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0715_SJ02_MP02_20_MG | Environmental | Open in IMG/M |
| 3300017973 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP10_20_MG | Environmental | Open in IMG/M |
| 3300017974 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP5_10_MG | Environmental | Open in IMG/M |
| 3300018001 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW-S_5 | Environmental | Open in IMG/M |
| 3300018032 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_BV01_MP10_20_MG | Environmental | Open in IMG/M |
| 3300018086 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP02_10_MG | Environmental | Open in IMG/M |
| 3300020581 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-M | Environmental | Open in IMG/M |
| 3300021088 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-28-M | Environmental | Open in IMG/M |
| 3300021180 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-O | Environmental | Open in IMG/M |
| 3300021181 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-O | Environmental | Open in IMG/M |
| 3300021401 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-O | Environmental | Open in IMG/M |
| 3300021407 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-O | Environmental | Open in IMG/M |
| 3300021432 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-M | Environmental | Open in IMG/M |
| 3300021479 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-4-M | Environmental | Open in IMG/M |
| 3300024288 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_08_16fungal | Environmental | Open in IMG/M |
| 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300027047 | Forest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaG HF042 (SPAdes) | Environmental | Open in IMG/M |
| 3300027604 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_5_LS metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027812 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP12_OM2 (SPAdes) | Environmental | Open in IMG/M |
| 3300028782 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_193 | Environmental | Open in IMG/M |
| 3300028906 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5 (v2) | Environmental | Open in IMG/M |
| 3300031543 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f20 | Environmental | Open in IMG/M |
| 3300031544 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.117b4f26 | Environmental | Open in IMG/M |
| 3300031640 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f23 | Environmental | Open in IMG/M |
| 3300031668 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.168b4f23 | Environmental | Open in IMG/M |
| 3300031680 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f22 | Environmental | Open in IMG/M |
| 3300031713 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.109b1f22 | Environmental | Open in IMG/M |
| 3300031723 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.108b1f23 | Environmental | Open in IMG/M |
| 3300031740 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gases AM2C_05 | Environmental | Open in IMG/M |
| 3300031751 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.108b1f24 | Environmental | Open in IMG/M |
| 3300031765 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f22 | Environmental | Open in IMG/M |
| 3300031769 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f24 | Environmental | Open in IMG/M |
| 3300031770 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f17 | Environmental | Open in IMG/M |
| 3300031792 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f23 | Environmental | Open in IMG/M |
| 3300031797 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f23 | Environmental | Open in IMG/M |
| 3300031835 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f21 | Environmental | Open in IMG/M |
| 3300031910 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108 (v2) | Environmental | Open in IMG/M |
| 3300031946 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.HF172 | Environmental | Open in IMG/M |
| 3300031947 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.T000H | Environmental | Open in IMG/M |
| 3300032009 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.066b5f19 | Environmental | Open in IMG/M |
| 3300032039 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f21 | Environmental | Open in IMG/M |
| 3300032041 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f22 | Environmental | Open in IMG/M |
| 3300032042 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.168b4f26 | Environmental | Open in IMG/M |
| 3300032055 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f23 | Environmental | Open in IMG/M |
| 3300032066 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f18 | Environmental | Open in IMG/M |
| 3300032205 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_05 | Environmental | Open in IMG/M |
| 3300032770 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.5 | Environmental | Open in IMG/M |
| 3300033158 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.1 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| 4ZMR_01241680 | 2170459017 | Switchgrass, Maize And Mischanthus Litter | MVWTNLFGVISFELFGQLRNVVAEPPAGRDAFFAESIRRWLEFTAIT |
| Ga0062387_1017731311 | 3300004091 | Bog Forest Soil | MAWTGLFGLVSFELYGQLHEVVGENPGDRDAFFVECVRRWIHLVGIA* |
| Ga0066683_107842421 | 3300005172 | Soil | VWTNLFGVISFELFGQLHNVVAEPPAGRDAFFAECIRRWTTFIIGLTVSS* |
| Ga0070687_1009157231 | 3300005343 | Switchgrass Rhizosphere | ISFELFGQLHNVVAEPPAGRDAFFAESIRRWLEFTAITP* |
| Ga0070709_103892122 | 3300005434 | Corn, Switchgrass And Miscanthus Rhizosphere | FGVISFELFGQLHNVVAEPPVGRDAFFAECIRRWITFTAIT* |
| Ga0070710_105315102 | 3300005437 | Corn, Switchgrass And Miscanthus Rhizosphere | ALMVWTNLFGVISFELFGQLRNVVAEPPAGRDAFFAECIRRWITFTAIT* |
| Ga0070711_1015787572 | 3300005439 | Corn, Switchgrass And Miscanthus Rhizosphere | VVSFELYGQLHNVVGEESGDREAFFAECIRRWIQLTGIA* |
| Ga0070684_1008588471 | 3300005535 | Corn Rhizosphere | WTNLFGVISFELFGQLHNVVAEPPADRDAFFAESIRRWLEFTAITP* |
| Ga0066695_106990021 | 3300005553 | Soil | VISFELFGQLHNVVAEPPAGRDAFFAECIRHWTTFTAIT* |
| Ga0068855_1013652392 | 3300005563 | Corn Rhizosphere | VISFELFGQLHNVVAEPPAGRDAFFAESIRRWLEFTAIT* |
| Ga0068859_1021003022 | 3300005617 | Switchgrass Rhizosphere | WTNLFGVISFELFGQLHNVVAEPPAGRDAFFAESIRRWLEFTAIS* |
| Ga0075028_1006943002 | 3300006050 | Watersheds | MVWTNLFGVVSFELYGQLHSVVGEEPGDREAFFAECIRRWIHLTGIT* |
| Ga0075017_1003158422 | 3300006059 | Watersheds | VQRALMVWTNLFGVISFELYGQLHQVVGEEPGDRDTFFAECIHRWIRFTGIA* |
| Ga0070712_1014123331 | 3300006175 | Corn, Switchgrass And Miscanthus Rhizosphere | VISFELFGQLHNVVAEPPAGRDAFFAECIRRWITFTAIT* |
| Ga0070712_1016810431 | 3300006175 | Corn, Switchgrass And Miscanthus Rhizosphere | FGVISFELFGQLHNVVAEPPAGRDAFFAASIRHWITFTAIT* |
| Ga0070712_1020455791 | 3300006175 | Corn, Switchgrass And Miscanthus Rhizosphere | LMVWTNLFGVISFELFGQLHNVVAEPPAGRDAFFAESIRRWLEFTAITP* |
| Ga0070765_1001341732 | 3300006176 | Soil | MASITSLFGTVSFELYGQLHQVVADPPADREAFFATCIRHWTDFINLRVVP* |
| Ga0074053_114849431 | 3300006575 | Soil | FGVISFELFGQLHNVVAEPPAGRDAFFAESIRRWLEFTAIS* |
| Ga0105250_103234322 | 3300009092 | Switchgrass Rhizosphere | ELFGQLHNVVAEPPAGRDAFFAESIRRWLEFTAITP* |
| Ga0105245_125253932 | 3300009098 | Miscanthus Rhizosphere | ALMVWTNLFGVISFELFGQLHNVVAEPPAGRDAFFAECIRRWITFTAIT* |
| Ga0105241_123571001 | 3300009174 | Corn Rhizosphere | VISFELFGQLHNVVAEPPAGRDAFFAASIRHWITITAIT* |
| Ga0116218_11326822 | 3300009522 | Peatlands Soil | MVWTGLFGLISFELNGQRPQVVGRNPGDRDAFFAECVRRWICFIGIG* |
| Ga0126384_121527801 | 3300010046 | Tropical Forest Soil | LMVWTNLFGVISFELFGQLHSVVGEDPADRDVFFAECIRYWITFTAIGRSPSSV* |
| Ga0126382_102018311 | 3300010047 | Tropical Forest Soil | VSFELFGQLHNVVADDPPDRDTFFAESIRHWLTFTGIT* |
| Ga0126382_106998602 | 3300010047 | Tropical Forest Soil | VWTNLFGVISFELFGQLHNVVAEPSADRDAFFAESIRRWLTFTAIT* |
| Ga0134070_104382162 | 3300010301 | Grasslands Soil | SFELFGQLHNVVAEPPAGRDAFFAECVRRWITFTAIT* |
| Ga0134111_105132722 | 3300010329 | Grasslands Soil | SFELFSQLHNVVAEPPADRDAFFAECIHRWITFTAIT* |
| Ga0074046_108722321 | 3300010339 | Bog Forest Soil | MAWTGLSGVISFELNGQRRQVVGRNPGDRDAFFAECVRHWICFTGLG* |
| Ga0074044_104445332 | 3300010343 | Bog Forest Soil | MVWTNLFGVISFELYGQLHEVVGEGPGDRDAFFAECVRRWIQSIGI* |
| Ga0126381_1042637272 | 3300010376 | Tropical Forest Soil | QRALMAWTGLFGVVSFDLYGQLHQVVGEEPADRDTFFAECIRRWLQFMNLG* |
| Ga0136449_1012910892 | 3300010379 | Peatlands Soil | VVSFELYGQLHEVVEEEPGDRDAFFAECVRHWIQFVGI* |
| Ga0137382_107593892 | 3300012200 | Vadose Zone Soil | FGVISFELFGQLHNVVAEPPAGRDAFFAECIRRWITFTAIT* |
| Ga0137370_105129362 | 3300012285 | Vadose Zone Soil | VVSFELFGQLHNVVAEPPADRDAFFAECIRRWTTFTAIT* |
| Ga0137384_100518931 | 3300012357 | Vadose Zone Soil | ALMVWTNLFGVISFELYGQLHEVVGEAPGDRDAFFTECVRRWIQFVGIA* |
| Ga0137384_103747793 | 3300012357 | Vadose Zone Soil | TNLFGVISFELFGQLHNVVAEPPADRDAFFAESIRRWLAFTAIT* |
| Ga0137384_105010792 | 3300012357 | Vadose Zone Soil | VSFALFGQLHNVVAEPPADRDAFFAECIRRWTTFTAIT* |
| Ga0137390_109907242 | 3300012363 | Vadose Zone Soil | ISFELYGQLHNVVGEAPAARDAFFAECIRRWIHFTSIT* |
| Ga0157347_10035791 | 3300012502 | Arabidopsis Rhizosphere | LFGQLHNVVAEPPGGRDAFFAECIRRWTTFTAIT* |
| Ga0164305_102588343 | 3300012989 | Soil | FGQLHTVVAEPPFGRDAFFAESIRRWLEFTAITP* |
| Ga0182036_119362092 | 3300016270 | Soil | VSFEVFGQLHNVVGEDPADRDAFFAECVRRWITFTPIT |
| Ga0182041_115117902 | 3300016294 | Soil | VVSFEVFGQLHNVVGEDPADRDTFFAECVRRWITFTPIP |
| Ga0182039_113866222 | 3300016422 | Soil | WTNLFGVVSFELFGQLHNVVAEDPADRDAFFAECVRHWITFTNLT |
| Ga0187807_11245023 | 3300017926 | Freshwater Sediment | MVWTGLFGVISFELYGQLHQVVGEGPADRDTFFAECIRRWLQFMNLA |
| Ga0187781_107656752 | 3300017972 | Tropical Peatland | MVWTGLFGVVSFELYGQLHQVIGDDRPDRDAFFAECVTRWITFMKLS |
| Ga0187780_112014141 | 3300017973 | Tropical Peatland | ELYGQLRNVVGENPGDRGTFFAECVRRWIHFTGLA |
| Ga0187777_104874453 | 3300017974 | Tropical Peatland | SFELYGQLHQVVGEEPADRDTFFAECIRRWLGFMDLG |
| Ga0187815_100665563 | 3300018001 | Freshwater Sediment | ELYGQLHQVVAEKPADRDTFFAECIRRWLQFMNLG |
| Ga0187815_103348892 | 3300018001 | Freshwater Sediment | LVQRGLMAWTGLFGVVSFELYGQLHQVVAEDPAGREAFFAECISRWITFVGLTNGR |
| Ga0187788_105363451 | 3300018032 | Tropical Peatland | MVWTNLFGVISFELFGQLHNVVGEEPGDRDAFFADCARRWFR |
| Ga0187769_107434021 | 3300018086 | Tropical Peatland | GLFGVVSFELYGQLHQVVAEDPADRDAFFAECISRWITFVGLT |
| Ga0210399_106994281 | 3300020581 | Soil | VWTNLFGVISFELFGQLHNVIAEPPAGHDAFFAECIRRWITFTAIT |
| Ga0210404_105915432 | 3300021088 | Soil | GVISFELFGQLHNVIAEPPAGRDAFFAECIRRWITFTAIT |
| Ga0210396_107219481 | 3300021180 | Soil | SFELYGQLHEVVGENPGDRDAFFVECVRRWIHLVGIA |
| Ga0210388_106432511 | 3300021181 | Soil | RVGVISFELYGQLHQVVGEEPGDRDTFFAACIHRWIRFTGIA |
| Ga0210393_111168241 | 3300021401 | Soil | ISFELYGQLHQVVGEEPGDRDTFFAECIHRWIRFTGIA |
| Ga0210383_102114194 | 3300021407 | Soil | GVISFELYGQLHQVVGEEPGDRDTFFAECIHRWIRFTGIA |
| Ga0210384_108812381 | 3300021432 | Soil | FGVISFELFGQLHNVIAEPPAGRDAFFAECIRRWITFTAIT |
| Ga0210410_113506711 | 3300021479 | Soil | LMVWTNLFGVISFELFGQLHNVIAEPPAGRDAFFAECIRRWITFTAIT |
| Ga0179589_104452031 | 3300024288 | Vadose Zone Soil | GVVSFELFGQLHNVVAEPPAGRDAFFAECIRRWTTFTAIT |
| Ga0207693_107395532 | 3300025915 | Corn, Switchgrass And Miscanthus Rhizosphere | NLFGVISFELFGQLHNVVAEPPAGRDAFFAASIRHWITFTAIT |
| Ga0207663_103670451 | 3300025916 | Corn, Switchgrass And Miscanthus Rhizosphere | RALMVWTNLFGVVSFELFGQLHSVVAEEPGDRAAFFTECIRRWLAFTAVS |
| Ga0207687_115592742 | 3300025927 | Miscanthus Rhizosphere | ALMVWTNLFGVISFELFGQLHNVVAEPPAGRDAFFAECIRRWITFTAIT |
| Ga0207690_108485401 | 3300025932 | Corn Rhizosphere | TLMVWTNLFGVISFELFGQLHNVVAEPPAGRDAFFAESIRRWLEFTAIS |
| Ga0208730_10325851 | 3300027047 | Forest Soil | MASITSLFGTVSFELYGQLHEVVAEAPADREAFFATCIRHWTDFINLRVVP |
| Ga0208324_11691181 | 3300027604 | Peatlands Soil | MVWTGLFGLISFELNGQRPQVVGRNPGDRDAFFAECVRRWICFIGIG |
| Ga0209656_100466563 | 3300027812 | Bog Forest Soil | MAWTGLSGVISFELNGQRRQVVGRNPGDRDAFFAECVRHWICFTGLG |
| Ga0307306_102531351 | 3300028782 | Soil | NLFGVISFELFGQLRNVVAEPPAGRDAFFAESIRRWFAFTAIT |
| Ga0308309_101582572 | 3300028906 | Soil | MASITSLFGTVSFELYGQLHQVVADPPADREAFFATCIRHWTDFINLRVVP |
| Ga0308309_102293263 | 3300028906 | Soil | FELYGQLHQVIGEPPADRDAFFAECVHGWLQFMNLG |
| Ga0318516_106171472 | 3300031543 | Soil | ALMVWTGLFGVISFELYGQLHQVVAEEPADRDTFFAECIRRWLDFMNLG |
| Ga0318516_107662262 | 3300031543 | Soil | VWTNLFGVVSFEVFGQLHNVVGEDPADRDTFFAECVRRWITFTPIT |
| Ga0318534_102364562 | 3300031544 | Soil | QRALMVWTGLFGVISFELYGQLHQVVGEEPADRDVFYAECIRRWLQFMDLG |
| Ga0318555_100102235 | 3300031640 | Soil | FELYGQLHQVVAEEPADRDTFFAECIRRWLDFMNLG |
| Ga0318542_105718812 | 3300031668 | Soil | TGLFGVISFELYGQLHQVVAEEPADRDTFFAECIRRWLDFMNLG |
| Ga0318574_100236561 | 3300031680 | Soil | LMVWTGLFGVISFELYGQLHQVVAEEPADRDTFFAECIRRWLDFMNLG |
| Ga0318574_100733803 | 3300031680 | Soil | VISFELFGQLHNVVEEDPADRDAFFADCIRRWITFTAMT |
| Ga0318496_105383301 | 3300031713 | Soil | IQRALMVWTGLFGVISFELYGQLHQVVAEEPADRDTFFAECIRRWLDFMNLG |
| Ga0318493_103289802 | 3300031723 | Soil | NLFGVISFELFGQLHHVVGEEPGDRDAFFAGCVRRWIDLTALT |
| Ga0307468_1008542001 | 3300031740 | Hardwood Forest Soil | VSFELFGQLHNVVAEPRAGRDAFFAECIRRWTTFITGLTVSS |
| Ga0318494_100503684 | 3300031751 | Soil | LMVWTNLFGVISFELFGQLHSVVGEDPADRDAFFAECIRRWITFTAIT |
| Ga0318554_100412571 | 3300031765 | Soil | WTNLFGVISFELFGQLHSVVGEDPADRDAFFAECIRRWITFTAIT |
| Ga0318526_100772382 | 3300031769 | Soil | TGLFGVISFELYGQLHQVVGEEPADRDVFYAECIRRWLQFMDLG |
| Ga0318521_102302461 | 3300031770 | Soil | LMVWTNLFGVVSFEVFGQLHNVVGEDPADRDTFFAECVRRWITFTPIT |
| Ga0318521_106793732 | 3300031770 | Soil | TNLFGVVSFELFGQLHNVVAEDPADRDAFFAACVRHWISFTNLT |
| Ga0318529_103839791 | 3300031792 | Soil | VWTGLFGVISFELYGQLHQVVGEEPADRDVFYAECIRRWLQFMDLG |
| Ga0318550_103656212 | 3300031797 | Soil | LVQRALMVWTGLFGVISFELYGQLHQVVGEEPADRDVFYAECIRRWLQFMDLG |
| Ga0318550_104788661 | 3300031797 | Soil | TGLFGVISFELYGQLHQVVGEEPADRDTFFAECIRRWLDFMNLG |
| Ga0318517_102118052 | 3300031835 | Soil | TNLFGVVAFEVFGQLHNVVGEDPADRDTFFAECVRRWITFTPIT |
| Ga0306923_109544231 | 3300031910 | Soil | QRALMVWTGLFGVISFELYGQLHQVVGEKPADRDTFFAECIRRWLDFMNLG |
| Ga0310910_110464012 | 3300031946 | Soil | TNLFGVVSFELFGQLHNVVEEDPADRDAFFADCIRRWITFTAMT |
| Ga0310909_109789841 | 3300031947 | Soil | FGVISFELYGQLHQVVGEKPADRDTFFAECIRRWLDFMNLG |
| Ga0318563_106390402 | 3300032009 | Soil | TWTGLFGVVSFELYGQLHQVVGELPTDRDAFFAECIRRWLAFMDLG |
| Ga0318559_101049231 | 3300032039 | Soil | MVWTNLFGVISFELFGQLHSVVGEDPADRDAFFAECIRRWITFTAIT |
| Ga0318549_102759941 | 3300032041 | Soil | TNLFGVISFELFGQLHSVVGEDPADRDAFFAECIRRWITFTAIT |
| Ga0318545_100577061 | 3300032042 | Soil | GVISFELYGQLHQVVAEEPADRDTFFAECIRRWLDFMNLG |
| Ga0318575_101679492 | 3300032055 | Soil | IQRALMVWTGLFGVISFELYGQLHQVVGEEPADRDVFYAECIRRWLQFMDLG |
| Ga0318575_103781601 | 3300032055 | Soil | FGVISFELYGQLHQVVAEEPADRDTFFAECIRRWLDFMNLG |
| Ga0318514_100372274 | 3300032066 | Soil | RALMVWTGLFGVISFELYGQLHQVVAEEPADRDTFFAECIRRWLDFMNLG |
| Ga0307472_1007714581 | 3300032205 | Hardwood Forest Soil | LFGVISFELFGQLHNVVAEPPAGRDAFFAESIRRWLEFTAIS |
| Ga0335085_102287294 | 3300032770 | Soil | QRALMVWTNLFGVISFELFGQLHSVVGEDPADRDVFFAECIRYWITFTAIGRSPSSV |
| Ga0335085_112354721 | 3300032770 | Soil | ELYGQLHNVVGEPSRDRGTFFAECIRHWIRFTGII |
| Ga0335077_108418651 | 3300033158 | Soil | PAVPAPLVQRALMVWTNLFGVISFELYGQLHNVVGEPSRDRGTFFAECIRHWIHLTGII |
| ⦗Top⦘ |