| Basic Information | |
|---|---|
| Family ID | F101552 |
| Family Type | Metagenome |
| Number of Sequences | 102 |
| Average Sequence Length | 41 residues |
| Representative Sequence | VNATSADYGQTTFAQRLRGVFDTLAHLPARTRWSRMLHTVH |
| Number of Associated Samples | 95 |
| Number of Associated Scaffolds | 102 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | No |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 0.00 % |
| % of genes near scaffold ends (potentially truncated) | 100.00 % |
| % of genes from short scaffolds (< 2000 bps) | 92.16 % |
| Associated GOLD sequencing projects | 91 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.33 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (100.000 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil (17.647 % of family members) |
| Environment Ontology (ENVO) | Unclassified (31.373 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (60.784 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 37.68% β-sheet: 0.00% Coil/Unstructured: 62.32% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.33 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 102 Family Scaffolds |
|---|---|---|
| PF05170 | AsmA | 78.43 |
| PF13502 | AsmA_2 | 1.96 |
| PF12344 | UvrB | 0.98 |
| COG ID | Name | Functional Category | % Frequency in 102 Family Scaffolds |
|---|---|---|---|
| COG2982 | Uncharacterized conserved protein AsmA involved in outer membrane biogenesis | Cell wall/membrane/envelope biogenesis [M] | 78.43 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 100.00 % |
| Unclassified | root | N/A | 0.00 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300000955|JGI1027J12803_100746865 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1417 | Open in IMG/M |
| 3300002245|JGIcombinedJ26739_100695700 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 895 | Open in IMG/M |
| 3300002908|JGI25382J43887_10233015 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 859 | Open in IMG/M |
| 3300004091|Ga0062387_101575543 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 529 | Open in IMG/M |
| 3300005180|Ga0066685_10580175 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 772 | Open in IMG/M |
| 3300005332|Ga0066388_100873850 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1481 | Open in IMG/M |
| 3300005332|Ga0066388_108848014 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 500 | Open in IMG/M |
| 3300005921|Ga0070766_10736953 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 669 | Open in IMG/M |
| 3300006176|Ga0070765_100990094 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 795 | Open in IMG/M |
| 3300006904|Ga0075424_101396641 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 744 | Open in IMG/M |
| 3300009038|Ga0099829_10081900 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2473 | Open in IMG/M |
| 3300009088|Ga0099830_10804774 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 775 | Open in IMG/M |
| 3300009089|Ga0099828_10493752 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1104 | Open in IMG/M |
| 3300009522|Ga0116218_1237344 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 820 | Open in IMG/M |
| 3300009545|Ga0105237_11698747 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 639 | Open in IMG/M |
| 3300009824|Ga0116219_10758471 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 530 | Open in IMG/M |
| 3300010048|Ga0126373_10195992 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1954 | Open in IMG/M |
| 3300010320|Ga0134109_10046151 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1430 | Open in IMG/M |
| 3300010339|Ga0074046_10120970 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1681 | Open in IMG/M |
| 3300010360|Ga0126372_11268704 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 764 | Open in IMG/M |
| 3300010361|Ga0126378_12432621 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 598 | Open in IMG/M |
| 3300010362|Ga0126377_12864037 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 556 | Open in IMG/M |
| 3300010366|Ga0126379_10216384 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1857 | Open in IMG/M |
| 3300011120|Ga0150983_10062753 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 572 | Open in IMG/M |
| 3300012200|Ga0137382_10096469 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1944 | Open in IMG/M |
| 3300012202|Ga0137363_10642515 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 897 | Open in IMG/M |
| 3300012203|Ga0137399_10084771 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2414 | Open in IMG/M |
| 3300012203|Ga0137399_10520186 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 999 | Open in IMG/M |
| 3300012203|Ga0137399_11460616 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 570 | Open in IMG/M |
| 3300012208|Ga0137376_11113744 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 675 | Open in IMG/M |
| 3300012361|Ga0137360_10020836 | All Organisms → cellular organisms → Bacteria | 4379 | Open in IMG/M |
| 3300012582|Ga0137358_10538506 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 785 | Open in IMG/M |
| 3300012918|Ga0137396_11078877 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 576 | Open in IMG/M |
| 3300012923|Ga0137359_10303724 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1421 | Open in IMG/M |
| 3300012925|Ga0137419_11119065 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 656 | Open in IMG/M |
| 3300012927|Ga0137416_10178066 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1689 | Open in IMG/M |
| 3300012989|Ga0164305_11723784 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 563 | Open in IMG/M |
| 3300013832|Ga0120132_1067155 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 716 | Open in IMG/M |
| 3300014157|Ga0134078_10215299 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 790 | Open in IMG/M |
| 3300014969|Ga0157376_11174886 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 795 | Open in IMG/M |
| 3300015053|Ga0137405_1424806 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2513 | Open in IMG/M |
| 3300015168|Ga0167631_1034440 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 823 | Open in IMG/M |
| 3300016319|Ga0182033_10350202 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1235 | Open in IMG/M |
| 3300017943|Ga0187819_10259991 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1014 | Open in IMG/M |
| 3300017943|Ga0187819_10784165 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 535 | Open in IMG/M |
| 3300017948|Ga0187847_10707463 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 567 | Open in IMG/M |
| 3300017961|Ga0187778_10306092 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1029 | Open in IMG/M |
| 3300017961|Ga0187778_10894599 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 610 | Open in IMG/M |
| 3300018033|Ga0187867_10268368 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 959 | Open in IMG/M |
| 3300020140|Ga0179590_1097256 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 791 | Open in IMG/M |
| 3300020579|Ga0210407_10342388 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1169 | Open in IMG/M |
| 3300020580|Ga0210403_10628248 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 865 | Open in IMG/M |
| 3300020581|Ga0210399_10938021 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 700 | Open in IMG/M |
| 3300021168|Ga0210406_10470038 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 998 | Open in IMG/M |
| 3300021171|Ga0210405_10674862 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 800 | Open in IMG/M |
| 3300021178|Ga0210408_11248576 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 565 | Open in IMG/M |
| 3300021181|Ga0210388_11367164 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 596 | Open in IMG/M |
| 3300021404|Ga0210389_10458979 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1002 | Open in IMG/M |
| 3300021420|Ga0210394_11486245 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 573 | Open in IMG/M |
| 3300021475|Ga0210392_10037467 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 2902 | Open in IMG/M |
| 3300021478|Ga0210402_10419108 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1243 | Open in IMG/M |
| 3300021479|Ga0210410_11276565 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 626 | Open in IMG/M |
| 3300021559|Ga0210409_10230764 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1679 | Open in IMG/M |
| 3300021559|Ga0210409_10923172 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 747 | Open in IMG/M |
| 3300024283|Ga0247670_1074270 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 620 | Open in IMG/M |
| 3300025448|Ga0208037_1017967 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1729 | Open in IMG/M |
| 3300025910|Ga0207684_11620481 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 523 | Open in IMG/M |
| 3300025961|Ga0207712_12065197 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 510 | Open in IMG/M |
| 3300026214|Ga0209838_1016084 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1036 | Open in IMG/M |
| 3300026285|Ga0209438_1193749 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 540 | Open in IMG/M |
| 3300026308|Ga0209265_1036850 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1513 | Open in IMG/M |
| 3300026318|Ga0209471_1254091 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 601 | Open in IMG/M |
| 3300026330|Ga0209473_1166162 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 878 | Open in IMG/M |
| 3300026515|Ga0257158_1005226 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1804 | Open in IMG/M |
| 3300026869|Ga0207821_1013004 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 858 | Open in IMG/M |
| 3300026879|Ga0207763_1009710 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1016 | Open in IMG/M |
| 3300027024|Ga0207819_1012632 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1211 | Open in IMG/M |
| 3300027535|Ga0209734_1007010 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2012 | Open in IMG/M |
| 3300027616|Ga0209106_1044742 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 985 | Open in IMG/M |
| 3300027651|Ga0209217_1111683 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 775 | Open in IMG/M |
| 3300027660|Ga0209736_1024188 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1843 | Open in IMG/M |
| 3300027660|Ga0209736_1183500 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 547 | Open in IMG/M |
| 3300027775|Ga0209177_10050842 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1174 | Open in IMG/M |
| 3300027846|Ga0209180_10245128 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1031 | Open in IMG/M |
| 3300027854|Ga0209517_10553805 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 617 | Open in IMG/M |
| 3300027867|Ga0209167_10192954 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1083 | Open in IMG/M |
| 3300027889|Ga0209380_10208751 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1147 | Open in IMG/M |
| 3300027911|Ga0209698_11228391 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 551 | Open in IMG/M |
| 3300028906|Ga0308309_10966794 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 738 | Open in IMG/M |
| 3300029993|Ga0302304_10344419 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 543 | Open in IMG/M |
| 3300031231|Ga0170824_116844872 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 759 | Open in IMG/M |
| 3300031474|Ga0170818_106261548 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 945 | Open in IMG/M |
| 3300031715|Ga0307476_10649745 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 782 | Open in IMG/M |
| 3300031718|Ga0307474_10927402 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 689 | Open in IMG/M |
| 3300031823|Ga0307478_10696653 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 851 | Open in IMG/M |
| 3300031941|Ga0310912_10277660 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1294 | Open in IMG/M |
| 3300031946|Ga0310910_10376120 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1124 | Open in IMG/M |
| 3300031954|Ga0306926_12604732 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 552 | Open in IMG/M |
| 3300032001|Ga0306922_10025334 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 5973 | Open in IMG/M |
| 3300032174|Ga0307470_10468815 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 910 | Open in IMG/M |
| 3300032261|Ga0306920_100828421 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1357 | Open in IMG/M |
| 3300032897|Ga0335071_10094459 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2932 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 17.65% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 17.65% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 6.86% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 4.90% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 4.90% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 4.90% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 3.92% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 3.92% |
| Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil | 3.92% |
| Peatlands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil | 2.94% |
| Peatland | Environmental → Aquatic → Freshwater → Wetlands → Bog → Peatland | 1.96% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment | 1.96% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 1.96% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 1.96% |
| Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil | 1.96% |
| Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 1.96% |
| Bog Forest Soil | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil | 0.98% |
| Peatland | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Peatland | 0.98% |
| Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 0.98% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 0.98% |
| Glacier Forefield Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Glacier Forefield Soil | 0.98% |
| Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 0.98% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 0.98% |
| Permafrost | Environmental → Terrestrial → Soil → Unclassified → Permafrost → Permafrost | 0.98% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 0.98% |
| Bog Forest Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Bog Forest Soil | 0.98% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Soil | 0.98% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 0.98% |
| Palsa | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa | 0.98% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 0.98% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.98% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 0.98% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.98% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300000955 | Soil microbial communities from Great Prairies - Iowa, Native Prairie soil | Environmental | Open in IMG/M |
| 3300002245 | Jack Pine, Ontario site 1_JW_OM2H0_M3 (Jack Pine, Ontario combined, ASSEMBLY_DATE=20131027) | Environmental | Open in IMG/M |
| 3300002908 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 08_20_2013_1_40cm | Environmental | Open in IMG/M |
| 3300004091 | Coassembly of ECP14_OM1, ECP14_OM2, ECP14_OM3 | Environmental | Open in IMG/M |
| 3300005180 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_134 | Environmental | Open in IMG/M |
| 3300005332 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300005921 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 6 | Environmental | Open in IMG/M |
| 3300006176 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5 | Environmental | Open in IMG/M |
| 3300006904 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD3 | Host-Associated | Open in IMG/M |
| 3300009038 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaG | Environmental | Open in IMG/M |
| 3300009088 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H3.8 metaG | Environmental | Open in IMG/M |
| 3300009089 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H1.8 metaG | Environmental | Open in IMG/M |
| 3300009522 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_5_LS metaG | Environmental | Open in IMG/M |
| 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Host-Associated | Open in IMG/M |
| 3300009824 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_6_BS metaG | Environmental | Open in IMG/M |
| 3300010048 | Tropical forest soil microbial communities from Panama - MetaG Plot_11 | Environmental | Open in IMG/M |
| 3300010320 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_2_11112015 | Environmental | Open in IMG/M |
| 3300010339 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - Bog Forest MetaG ECP23OM3 | Environmental | Open in IMG/M |
| 3300010360 | Tropical forest soil microbial communities from Panama - MetaG Plot_6 | Environmental | Open in IMG/M |
| 3300010361 | Tropical forest soil microbial communities from Panama - MetaG Plot_23 | Environmental | Open in IMG/M |
| 3300010362 | Tropical forest soil microbial communities from Panama - MetaG Plot_22 | Environmental | Open in IMG/M |
| 3300010366 | Tropical forest soil microbial communities from Panama - MetaG Plot_24 | Environmental | Open in IMG/M |
| 3300011120 | Combined assembly of Microbial Forest Soil metaT | Environmental | Open in IMG/M |
| 3300012200 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_20_16 metaG | Environmental | Open in IMG/M |
| 3300012202 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_115_16 metaG | Environmental | Open in IMG/M |
| 3300012203 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz3.16 metaG | Environmental | Open in IMG/M |
| 3300012208 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_20_16 metaG | Environmental | Open in IMG/M |
| 3300012361 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_60_16 metaG | Environmental | Open in IMG/M |
| 3300012582 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_20_16 metaG | Environmental | Open in IMG/M |
| 3300012918 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czcobulk3.16 metaG | Environmental | Open in IMG/M |
| 3300012923 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_40_16 metaG | Environmental | Open in IMG/M |
| 3300012925 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012927 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012989 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_237_MG | Environmental | Open in IMG/M |
| 3300013832 | Permafrost microbial communities from Nunavut, Canada - A3_5cm_0M | Environmental | Open in IMG/M |
| 3300014157 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Met_20cm_2_24_1 metaG | Environmental | Open in IMG/M |
| 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Host-Associated | Open in IMG/M |
| 3300015053 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (PacBio error correction) | Environmental | Open in IMG/M |
| 3300015168 | Arctic soil microbial communities from a glacier forefield, Russell Glacier, Kangerlussuaq, Greenland (Sample G4A, Ice margin, adjacent to proglacial lake) | Environmental | Open in IMG/M |
| 3300016319 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.00H | Environmental | Open in IMG/M |
| 3300017943 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_4 | Environmental | Open in IMG/M |
| 3300017948 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_4_10 | Environmental | Open in IMG/M |
| 3300017961 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP5_20_MG | Environmental | Open in IMG/M |
| 3300018033 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_13_10 | Environmental | Open in IMG/M |
| 3300020140 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_08_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300020579 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-M | Environmental | Open in IMG/M |
| 3300020580 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-M | Environmental | Open in IMG/M |
| 3300020581 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-M | Environmental | Open in IMG/M |
| 3300021168 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-30-M | Environmental | Open in IMG/M |
| 3300021171 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-11-M | Environmental | Open in IMG/M |
| 3300021178 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-4-M | Environmental | Open in IMG/M |
| 3300021181 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-O | Environmental | Open in IMG/M |
| 3300021404 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-28-O | Environmental | Open in IMG/M |
| 3300021420 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-12-M | Environmental | Open in IMG/M |
| 3300021475 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-30-O | Environmental | Open in IMG/M |
| 3300021478 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-M | Environmental | Open in IMG/M |
| 3300021479 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-4-M | Environmental | Open in IMG/M |
| 3300021559 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-M | Environmental | Open in IMG/M |
| 3300024283 | Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK11 | Environmental | Open in IMG/M |
| 3300025448 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_13_100 (SPAdes) | Environmental | Open in IMG/M |
| 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026214 | Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil replicate 2 DNA2013-047 (SPAdes) | Environmental | Open in IMG/M |
| 3300026285 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_20cm (SPAdes) | Environmental | Open in IMG/M |
| 3300026308 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_103 (SPAdes) | Environmental | Open in IMG/M |
| 3300026318 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_128 (SPAdes) | Environmental | Open in IMG/M |
| 3300026330 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_133 (SPAdes) | Environmental | Open in IMG/M |
| 3300026515 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - NL-03-A | Environmental | Open in IMG/M |
| 3300026869 | Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 53 (SPAdes) | Environmental | Open in IMG/M |
| 3300026879 | Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 50 (SPAdes) | Environmental | Open in IMG/M |
| 3300027024 | Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 42 (SPAdes) | Environmental | Open in IMG/M |
| 3300027535 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM1_M2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027616 | Forest soil microbial communities from El Dorado National Forest, California, USA - Mediterranean Blodgett CA OM1_M3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027651 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM3H0_M2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027660 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_Ref_M3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027775 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Control (SPAdes) | Environmental | Open in IMG/M |
| 3300027846 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027854 | Peat soil microbial communities from Weissenstadt, Germany - SII-2010 (SPAdes) | Environmental | Open in IMG/M |
| 3300027867 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen05_05102014_R1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027889 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 6 (SPAdes) | Environmental | Open in IMG/M |
| 3300027911 | Freshwater sediment microbial communities from Pennsylvania, USA - Little Laurel Run_MetaG_LLR_2012 (SPAdes) | Environmental | Open in IMG/M |
| 3300028906 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5 (v2) | Environmental | Open in IMG/M |
| 3300029993 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Palsa_E2_2 | Environmental | Open in IMG/M |
| 3300031231 | Coassembly Site 11 (all samples) - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031474 | Fir Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031715 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM2C_05 | Environmental | Open in IMG/M |
| 3300031718 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_05 | Environmental | Open in IMG/M |
| 3300031823 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_05 | Environmental | Open in IMG/M |
| 3300031941 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.OX080 | Environmental | Open in IMG/M |
| 3300031946 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.HF172 | Environmental | Open in IMG/M |
| 3300031954 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178 (v2) | Environmental | Open in IMG/M |
| 3300032001 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082 (v2) | Environmental | Open in IMG/M |
| 3300032174 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_05 | Environmental | Open in IMG/M |
| 3300032261 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 (v2) | Environmental | Open in IMG/M |
| 3300032897 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_1.5 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| JGI1027J12803_1007468651 | 3300000955 | Soil | ATSGDYIGDTTFWSRLTAIFQTLAHLPSRTRWSRMLRTVH* |
| JGIcombinedJ26739_1006957002 | 3300002245 | Forest Soil | YGQTSFFQRLKSVVDTLLHLPQRTRWSRMLRTVH* |
| JGI25382J43887_102330152 | 3300002908 | Grasslands Soil | PFLVYWSVDATSGDYSGETTFWSRLTGIFQTLAHLPSRTRWSRMLRTVH* |
| Ga0062387_1015755431 | 3300004091 | Bog Forest Soil | YWSVDATTADYAKETTFFSRLTSVFDNIRHLPARTRWGRMLHTVH* |
| Ga0066685_105801752 | 3300005180 | Soil | PFLIYWSVEAKSGDYSGESTFWSRLAGVVQTLAHLPSRTRWSRMLHTVH* |
| Ga0066388_1008738501 | 3300005332 | Tropical Forest Soil | WSVQATSVDYGESTFAQRLRAVLQTVAHLPARTRWSRMLHTVH* |
| Ga0066388_1088480141 | 3300005332 | Tropical Forest Soil | SVEATTDDYAQSTFLQRVAGVLDTLMHLPARTRWSRMLHTVH* |
| Ga0070766_107369531 | 3300005921 | Soil | SSADYSASTFFQRLAGIFDTLLHLPTRTRWSRMLHTVH* |
| Ga0070765_1009900942 | 3300006176 | Soil | IYWSVDATSNDYTQTTFIQRLIGVFDTLVHLPARTRWSRMLHTVR* |
| Ga0075424_1013966412 | 3300006904 | Populus Rhizosphere | ADYGESTFMQRLRGVLVTIAHLPARTRWSRMLHTVH* |
| Ga0099829_100819001 | 3300009038 | Vadose Zone Soil | SVEASSADYGQSTFLQRLKSVVDTLLHLPQRTRWSRMLRTVH* |
| Ga0099830_108047742 | 3300009088 | Vadose Zone Soil | SVNATSADYSSESTFWTRLSGVIDTLIHLPARTRWSRMLHTVH* |
| Ga0099828_104937521 | 3300009089 | Vadose Zone Soil | SADYGQSSFLQRLKSVVDTLLHLPQRTRWSRMLRTVH* |
| Ga0116218_12373442 | 3300009522 | Peatlands Soil | YNETSFGQRIIGVLDTLLHLPARTRWSRMLRTVH* |
| Ga0105237_116987472 | 3300009545 | Corn Rhizosphere | SVEATSADYGESTFAQRLRAVLQTVAHLPARTRWARMLRTVH* |
| Ga0116219_107584712 | 3300009824 | Peatlands Soil | YSDTSFGQRIIGILDTLLHLPARTRWSRMLHTVH* |
| Ga0126373_101959921 | 3300010048 | Tropical Forest Soil | SSADYGSTTFGERIFGIFDTLSHLPARTRWNRMLHTVH* |
| Ga0134109_100461512 | 3300010320 | Grasslands Soil | SDYTGESTFWSRLAGVFDTLAHLPTRTRWSRMLHTVH* |
| Ga0074046_101209701 | 3300010339 | Bog Forest Soil | SSDYSETSFGQRIIGILDTLVHLPARTRWSRMLHTVH* |
| Ga0126372_112687041 | 3300010360 | Tropical Forest Soil | RPLFIYWSIDATSSDYSADTSFLKRLLAVLDTIVHLPKRTRWSRMLRTVH* |
| Ga0126378_124326212 | 3300010361 | Tropical Forest Soil | LIYWSVEAKSSDYSGESTFWSRLAGVFDTLAHLPTRTRWSRMIHTVH* |
| Ga0126377_128640372 | 3300010362 | Tropical Forest Soil | FLIYWSVEATADDYAQNSTFFQRLAGIADTLAHLPARTRWNRMLRTVH* |
| Ga0126379_102163842 | 3300010366 | Tropical Forest Soil | YSDSTFGQRIIGIFDALMHLPARTRWSRMLHTVH* |
| Ga0150983_100627532 | 3300011120 | Forest Soil | LIYWSVDAKSSDYNTETTFWSRLVGVFETLAHLPTRTRWSRMLHTVH* |
| Ga0137382_100964692 | 3300012200 | Vadose Zone Soil | FLIYWSVEAKSSDYSGDTTFWSRLTGILQTLVHLPSRTRWGRMLHTVH* |
| Ga0137363_106425151 | 3300012202 | Vadose Zone Soil | RPFLIYWSVEAKSSDYSGDTTFWSRLTGILQTLVHLPSRTRWGRMLHTVH* |
| Ga0137399_100847712 | 3300012203 | Vadose Zone Soil | VDAKSADYSGESTFWSRLSGVFETLVHLPSRTRWSRMLHTVH* |
| Ga0137399_105201862 | 3300012203 | Vadose Zone Soil | WSVDATSGDYSGDSTFWSRLTGILQTLAHLPSRTRWSRMLRTVH* |
| Ga0137399_114606162 | 3300012203 | Vadose Zone Soil | IYWSVDANSADYTGESTYWSRLVGVFETLVHLPSRTRWSRMLHTVH* |
| Ga0137376_111137442 | 3300012208 | Vadose Zone Soil | LIYWSVEAKSSDYSGDTTFWSRLTGILQTLVHLPSRTRWGRMLHTVH* |
| Ga0137360_100208363 | 3300012361 | Vadose Zone Soil | ADYGQSSFLQRLKSVIDTLLHLPQRTRWSRMLRTVH* |
| Ga0137358_105385062 | 3300012582 | Vadose Zone Soil | ATSGDYSGETTFWSRLTGIFQTLAHLPSRTRWSRMLRTVH* |
| Ga0137396_110788772 | 3300012918 | Vadose Zone Soil | YWSVDANSNDYSESSFGQRILAIFDTITHLPARTRWNRMLHTVH* |
| Ga0137359_103037242 | 3300012923 | Vadose Zone Soil | YWSVEASSADYGQSSFFQRLKSVIDTLLHLPQRTRWGRMLRTVH* |
| Ga0137419_111190651 | 3300012925 | Vadose Zone Soil | IYWSVDAKSADYSGESTFWSRLSGIFETMVHLPSRTRWSRMLHTVH* |
| Ga0137416_101780662 | 3300012927 | Vadose Zone Soil | RPFLIYWSVEAKSSDYGGDTTFWSRLTGILQTLVHLPSRTRWGRMLHTVH* |
| Ga0164305_117237841 | 3300012989 | Soil | VEASSSDYSPSTFFQRLAGIFETIAHLPSRTRWSRMLHTVH* |
| Ga0120132_10671552 | 3300013832 | Permafrost | IYWSVDATSADYAGDSSFLQRLAGIFDTIVPLPARTRWHRMFHTVH* |
| Ga0134078_102152992 | 3300014157 | Grasslands Soil | LIYWSVEAKSSDYTGESTFWSRLAGVFDTLAHLPTRTRWSRMLHTVH* |
| Ga0157376_111748862 | 3300014969 | Miscanthus Rhizosphere | YGESTFGQRLRAVLQTVAHLPARTRWSRMLHTVH* |
| Ga0137405_14248061 | 3300015053 | Vadose Zone Soil | HGRPVFIYWSIDASSADYAGDATFLKRLGGVLDTIIHLPQRTRWSRMLHTVH* |
| Ga0167631_10344402 | 3300015168 | Glacier Forefield Soil | DATSADYTGDSTFLRRLGGILDTLVHLPARTRWKRMLHTVH* |
| Ga0182033_103502021 | 3300016319 | Soil | SSDYADSTFSQRVVAVFDTLLHLPARTRWSRMLHTVH |
| Ga0187819_102599912 | 3300017943 | Freshwater Sediment | SVDARSDDYAGDTTFFQRLRGVFETLGHLPSRTRWARMLHTVH |
| Ga0187819_107841652 | 3300017943 | Freshwater Sediment | LIYWSIDASSADYTDNTFGQRIIGIFDTLLHLPARTRWGRMLHTVH |
| Ga0187847_107074631 | 3300017948 | Peatland | SADYAKETTFWSRLSSVFDNVAHLPARTRWSRMLHTVR |
| Ga0187778_103060921 | 3300017961 | Tropical Peatland | IDANSNDYSDSTFGQRLVGIFDALMHLPARTRWSRMLHTVR |
| Ga0187778_108945992 | 3300017961 | Tropical Peatland | DYSDSSFAQRIVGIFDTLMHLPARTRWSRMLHTVH |
| Ga0187867_102683681 | 3300018033 | Peatland | SSDYSDTSFMQRIAGVFDTLLHLPARTRWSRMLHTVH |
| Ga0179590_10972562 | 3300020140 | Vadose Zone Soil | SVDANSNDYSESSFGQRILAIFDTITHLPARTRWNRMLHTVH |
| Ga0210407_103423881 | 3300020579 | Soil | SVEATSSDYTGDSSFWSRLTGVFDTLMHLPSRTRWSRMLHTVH |
| Ga0210403_106282482 | 3300020580 | Soil | NDYSDSSFGQRILAIFDTITHLPARTRWSRMLHTVH |
| Ga0210399_109380212 | 3300020581 | Soil | NSADYGQSSFFQRLKSVIDTLLHLPQRTRWGRMLRTVH |
| Ga0210406_104700381 | 3300021168 | Soil | DYNTETTFWSRLVGVFETLAHLPTRTRWSRMLHTVH |
| Ga0210405_106748621 | 3300021171 | Soil | WSVEASSADYNPSTFWQRLAGVFDTLLHLPSRTRWSRMLHTVH |
| Ga0210408_112485762 | 3300021178 | Soil | DYNRSTFFQRLAGIFETLAHLPTRTRWSRMLHTVH |
| Ga0210388_113671642 | 3300021181 | Soil | VDATSNDYSDSSFTQRILAIFDTLTHLPARTRWNRMLHTVH |
| Ga0210389_104589791 | 3300021404 | Soil | ASSADYGQSSFFQRLKSVIDTLLHLPQRTRWGRMLRTVH |
| Ga0210394_114862451 | 3300021420 | Soil | ATSNDYTQTTFIQRLIGVFDTIAHLPARTRWSRMLHTVH |
| Ga0210392_100374673 | 3300021475 | Soil | ATSNDYSDSSFGQRILAIFDTITHLPARTRWSRMLHTVH |
| Ga0210402_104191082 | 3300021478 | Soil | DATSNDYTQTTFIQRLIGVFDTIAHLPARTRWSRMLHTVH |
| Ga0210410_112765651 | 3300021479 | Soil | TSNDYTQSTFLQRLVAVFDTLTHLPARTRWSRMLHTVH |
| Ga0210409_102307642 | 3300021559 | Soil | WSVDATSNDYSDSSFGERILAIFDTITHLPARTRWSRMLHTVH |
| Ga0210409_109231721 | 3300021559 | Soil | SVDATSSDYNNESTFWTRLTGIFQTLAHLPSRTRWSRMLRTVH |
| Ga0247670_10742702 | 3300024283 | Soil | NDYSDSSFGRRILAIFDTLTHLPARTRWNRMLHTVH |
| Ga0208037_10179672 | 3300025448 | Peatland | IEADSSDYSADTSLWSRLTGMADTLVHLPTRTRWSRMFHLVH |
| Ga0207684_116204811 | 3300025910 | Corn, Switchgrass And Miscanthus Rhizosphere | NSADYGQSSFPQRLKSVVDTLLHLPQRTRWSRMLRTVH |
| Ga0207712_120651971 | 3300025961 | Switchgrass Rhizosphere | ATSADYGESTFAQRLRAVLQTVAHLPARTRWARMLRTVH |
| Ga0209838_10160841 | 3300026214 | Soil | ADYTNDSTFWRRLGGIFDTLAHLPKRTRWKRMLHTVH |
| Ga0209438_11937492 | 3300026285 | Grasslands Soil | SADYGQSSFLQRLKSVVDTLLHLPQRTRWSRMLRTVH |
| Ga0209265_10368501 | 3300026308 | Soil | LIYWSVEAKSSDYSGESTFWSRLAGVFDTLAHLPKRTRWSRMLHTVH |
| Ga0209471_12540912 | 3300026318 | Soil | DAQSADYSRESTYWSRLVGVLETLVHLPSRTRWSRMLHTVH |
| Ga0209473_11661622 | 3300026330 | Soil | FLIYWSVEAKSNDYTGESTFWSRLVGVFDTLAHLPSRTRWSRMLHTVH |
| Ga0257158_10052261 | 3300026515 | Soil | YWSVDAKSADYSGESTFWSRLSGVFETLVHLPSRTRWGRMLHTVH |
| Ga0207821_10130042 | 3300026869 | Tropical Forest Soil | SDYGEASFGQRIVGIFDTLLHLPARTRWSRMLHTVH |
| Ga0207763_10097102 | 3300026879 | Tropical Forest Soil | VEASSSDYGEASFGQRIVGIFDTLLHLPARTRWSRMLHTVH |
| Ga0207819_10126322 | 3300027024 | Tropical Forest Soil | SSSDYGEASFGQRIVGIFDTLLHLPARTRWSRMLHTVH |
| Ga0209734_10070101 | 3300027535 | Forest Soil | FLIYWSVEATGTDYGPSTFWQRLVSVFQTLAHLPQRTRWGRMLRTVH |
| Ga0209106_10447421 | 3300027616 | Forest Soil | SSDYGGDTTFWSRLTGILQTLVHLPSRTRWGRMLHTVH |
| Ga0209217_11116832 | 3300027651 | Forest Soil | SIEASSADYGQSSFRERLSGVIDTLAHLPARTRWGRMLHSVH |
| Ga0209736_10241882 | 3300027660 | Forest Soil | WSVDANSNDYSNTSFGQRVLGIFDTLTHLPARTRWSRMLHTVH |
| Ga0209736_11835001 | 3300027660 | Forest Soil | KSSDYGGDTTFWSRLTGILQTLVHLPSRTRWSRMLHTVH |
| Ga0209177_100508421 | 3300027775 | Agricultural Soil | WSVEAKSSDYSGESTFWSRLAGVFDTLAHLPTRTRWSRMLHTVH |
| Ga0209180_102451282 | 3300027846 | Vadose Zone Soil | SVEASSADYGQSTFLQRLKSVVDTLLHLPQRTRWSRMLRTVH |
| Ga0209517_105538051 | 3300027854 | Peatlands Soil | SSDYNETSFGQRIIGILDTLLHLPARTRWSRMLRTVH |
| Ga0209167_101929541 | 3300027867 | Surface Soil | VNATSADYGQSTFGERLRAVLDTIAHLPARTRWSRMLRTVH |
| Ga0209380_102087511 | 3300027889 | Soil | SSADYSASTFFQRLAGIFDTLLHLPTRTRWSRMLHTVH |
| Ga0209698_112283912 | 3300027911 | Watersheds | LIYWSVEATSGDYSSETSFGTRLWGVIDTLMHLPARTRWSRMLHTVH |
| Ga0308309_109667941 | 3300028906 | Soil | EANSSDYAESTFGQRIVGVFDTLLHLPARTRWSRMLHTVH |
| Ga0302304_103444192 | 3300029993 | Palsa | SSADYAQTTFGQRLRGIFETIAHLPSRTRWSRMLRTVH |
| Ga0170824_1168448722 | 3300031231 | Forest Soil | VNATSADYGQTTFAQRLRGVFDTLAHLPARTRWSRMLHTVH |
| Ga0170818_1062615483 | 3300031474 | Forest Soil | EATSADYAGDSSFFQRLAGIFDTIVHLPARTRWHRMFHTVH |
| Ga0307476_106497451 | 3300031715 | Hardwood Forest Soil | SVEANSADYGQTSFFQRLKSVVDTLLHLPQRTRWSRMLRTVH |
| Ga0307474_109274021 | 3300031718 | Hardwood Forest Soil | TSSDYAGDSTFWQRLVGIFDTLMHLPARTRWHRMFHTVH |
| Ga0307478_106966531 | 3300031823 | Hardwood Forest Soil | EASSADYGQASFFQRLKSVIDTLLHLPQRTRWSRMLHTVH |
| Ga0310912_102776602 | 3300031941 | Soil | NSNDYGDSSFSQRLVGIFDTLRHLPARTRWSRMLHTVH |
| Ga0310910_103761202 | 3300031946 | Soil | SIEASSSDYGEASFGQRIVGIFDTLLHLPRRTRWSRMLHTVH |
| Ga0306926_126047322 | 3300031954 | Soil | SSDYGEASFGQRIVGIFDTLLHLPGRTRWSRMLHTVH |
| Ga0306922_100253341 | 3300032001 | Soil | ADYSDSTFGQRIIGIFDTLMHLPARTRWSRMLHTVH |
| Ga0307470_104688152 | 3300032174 | Hardwood Forest Soil | ATSNDYSDSSFTQRILGVFDTITHLPARTRWSRMLHTVH |
| Ga0306920_1008284212 | 3300032261 | Soil | DASTSDYADSTFFQRVVAIFDTLLHLPARTRWSRMLHTVH |
| Ga0335071_100944591 | 3300032897 | Soil | VEANSSDYADSNFAQRIVGVFDTLAHLPSRTRWSRMLHTVH |
| ⦗Top⦘ |