NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F101542

Metagenome / Metatranscriptome Family F101542

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F101542
Family Type Metagenome / Metatranscriptome
Number of Sequences 102
Average Sequence Length 45 residues
Representative Sequence VPGAQYFTGIDYLLSLPVILLTLFALGILLIDLMIPPEWKW
Number of Associated Samples 95
Number of Associated Scaffolds 102

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 74.68 %
% of genes near scaffold ends (potentially truncated) 76.47 %
% of genes from short scaffolds (< 2000 bps) 67.65 %
Associated GOLD sequencing projects 92
AlphaFold2 3D model prediction Yes
3D model pTM-score0.56

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (74.510 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil
(10.784 % of family members)
Environment Ontology (ENVO) Unclassified
(19.608 % of family members)
Earth Microbiome Project Ontology (EMPO) Free-living → Non-saline → Soil (non-saline)
(55.882 % of family members)



 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      


 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Transmembrane (alpha-helical) Signal Peptide: No Secondary Structure distribution: α-helix: 43.48%    β-sheet: 0.00%    Coil/Unstructured: 56.52%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  
pTM-score: 0.56
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.


 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 102 Family Scaffolds
PF00361Proton_antipo_M 61.76
PF01059Oxidored_q5_N 4.90
PF00155Aminotran_1_2 0.98
PF01336tRNA_anti-codon 0.98



 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms75.49 %
UnclassifiedrootN/A24.51 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
3300001471|JGI12712J15308_10197216All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis528Open in IMG/M
3300001867|JGI12627J18819_10047014All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis1803Open in IMG/M
3300002557|JGI25381J37097_1020196All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis1167Open in IMG/M
3300002911|JGI25390J43892_10062189All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis869Open in IMG/M
3300004080|Ga0062385_10253779All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter982Open in IMG/M
3300004082|Ga0062384_101491208All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter500Open in IMG/M
3300005174|Ga0066680_10044413All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter2584Open in IMG/M
3300005176|Ga0066679_10127003All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter1577Open in IMG/M
3300005445|Ga0070708_100894756All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter833Open in IMG/M
3300005450|Ga0066682_10037559All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter2881Open in IMG/M
3300005458|Ga0070681_10840967All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter835Open in IMG/M
3300005553|Ga0066695_10435826All Organisms → cellular organisms → Bacteria → Acidobacteria809Open in IMG/M
3300005598|Ga0066706_11491335All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter509Open in IMG/M
3300005834|Ga0068851_11022680All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter522Open in IMG/M
3300005905|Ga0075269_10096326All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter559Open in IMG/M
3300006176|Ga0070765_101329368All Organisms → cellular organisms → Bacteria678Open in IMG/M
3300006358|Ga0068871_100749577All Organisms → cellular organisms → Bacteria897Open in IMG/M
3300006755|Ga0079222_10216667All Organisms → cellular organisms → Bacteria1168Open in IMG/M
3300007819|Ga0104322_117324All Organisms → cellular organisms → Bacteria1215Open in IMG/M
3300007959|Ga0079306_1168724All Organisms → cellular organisms → Bacteria559Open in IMG/M
3300009089|Ga0099828_11837839All Organisms → cellular organisms → Bacteria532Open in IMG/M
3300009524|Ga0116225_1377261All Organisms → cellular organisms → Bacteria631Open in IMG/M
3300010379|Ga0136449_104466184All Organisms → cellular organisms → Bacteria515Open in IMG/M
3300012208|Ga0137376_11476944All Organisms → cellular organisms → Bacteria → Acidobacteria571Open in IMG/M
3300012977|Ga0134087_10261710All Organisms → cellular organisms → Bacteria → Acidobacteria797Open in IMG/M
3300012977|Ga0134087_10786033All Organisms → cellular organisms → Bacteria514Open in IMG/M
3300013297|Ga0157378_11601859All Organisms → cellular organisms → Bacteria697Open in IMG/M
3300014150|Ga0134081_10009926All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis2536Open in IMG/M
3300016422|Ga0182039_11967555All Organisms → cellular organisms → Bacteria537Open in IMG/M
3300016445|Ga0182038_10158523Not Available1737Open in IMG/M
3300017659|Ga0134083_10542753All Organisms → cellular organisms → Bacteria → Acidobacteria525Open in IMG/M
3300017934|Ga0187803_10182485All Organisms → cellular organisms → Bacteria → Acidobacteria826Open in IMG/M
3300017961|Ga0187778_11085762All Organisms → cellular organisms → Bacteria557Open in IMG/M
3300017974|Ga0187777_10935721All Organisms → cellular organisms → Bacteria624Open in IMG/M
3300018001|Ga0187815_10305372All Organisms → cellular organisms → Bacteria675Open in IMG/M
3300018007|Ga0187805_10431560All Organisms → cellular organisms → Bacteria614Open in IMG/M
3300018088|Ga0187771_10361073All Organisms → cellular organisms → Bacteria1222Open in IMG/M
3300018431|Ga0066655_10844323All Organisms → cellular organisms → Bacteria624Open in IMG/M
3300018468|Ga0066662_10280846All Organisms → cellular organisms → Bacteria1384Open in IMG/M
3300019284|Ga0187797_1807082All Organisms → cellular organisms → Bacteria → Acidobacteria766Open in IMG/M
3300020004|Ga0193755_1069829All Organisms → cellular organisms → Bacteria1136Open in IMG/M
3300020170|Ga0179594_10279896All Organisms → cellular organisms → Bacteria631Open in IMG/M
3300020579|Ga0210407_11270578All Organisms → cellular organisms → Bacteria551Open in IMG/M
3300020580|Ga0210403_11486031All Organisms → cellular organisms → Bacteria510Open in IMG/M
3300021180|Ga0210396_11432926All Organisms → cellular organisms → Bacteria570Open in IMG/M
3300021403|Ga0210397_11179305All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis595Open in IMG/M
3300021407|Ga0210383_10572812All Organisms → cellular organisms → Bacteria974Open in IMG/M
3300021420|Ga0210394_10361430All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis1276Open in IMG/M
3300021432|Ga0210384_10092294All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis2719Open in IMG/M
3300021477|Ga0210398_10552916All Organisms → cellular organisms → Bacteria936Open in IMG/M
3300021477|Ga0210398_11409843All Organisms → cellular organisms → Bacteria544Open in IMG/M
3300025924|Ga0207694_10344273All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis1233Open in IMG/M
3300025931|Ga0207644_11224685All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis631Open in IMG/M
3300025939|Ga0207665_10745431All Organisms → cellular organisms → Bacteria → Acidobacteria772Open in IMG/M
3300025981|Ga0207640_10419189All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis1095Open in IMG/M
3300025990|Ga0208527_1038787All Organisms → cellular organisms → Bacteria586Open in IMG/M
3300026530|Ga0209807_1027129All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis2768Open in IMG/M
3300026542|Ga0209805_1013139All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis4428Open in IMG/M
3300026542|Ga0209805_1018349All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis3689Open in IMG/M
3300027047|Ga0208730_1042963All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis531Open in IMG/M
3300027696|Ga0208696_1134587All Organisms → cellular organisms → Bacteria806Open in IMG/M
3300027867|Ga0209167_10087358All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria1579Open in IMG/M
3300027867|Ga0209167_10184700All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis1106Open in IMG/M
3300028884|Ga0307308_10285224All Organisms → cellular organisms → Bacteria → Acidobacteria791Open in IMG/M
3300028906|Ga0308309_10213458Not Available1597Open in IMG/M
3300028906|Ga0308309_11462435All Organisms → cellular organisms → Bacteria584Open in IMG/M
3300030862|Ga0265753_1107336All Organisms → cellular organisms → Bacteria572Open in IMG/M
3300031241|Ga0265325_10200095All Organisms → cellular organisms → Bacteria922Open in IMG/M
3300031524|Ga0302320_12106126All Organisms → cellular organisms → Bacteria525Open in IMG/M
3300031715|Ga0307476_10506844All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis894Open in IMG/M
3300031820|Ga0307473_10977373All Organisms → cellular organisms → Bacteria617Open in IMG/M
3300031910|Ga0306923_10111852All Organisms → cellular organisms → Bacteria → Acidobacteria3090Open in IMG/M
3300031939|Ga0308174_11133687All Organisms → cellular organisms → Bacteria666Open in IMG/M
3300032783|Ga0335079_10109654All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter3121Open in IMG/M
3300032805|Ga0335078_10621568All Organisms → cellular organisms → Eukaryota1357Open in IMG/M
3300032828|Ga0335080_11276964All Organisms → cellular organisms → Bacteria → Acidobacteria734Open in IMG/M
3300032897|Ga0335071_10088479All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter3036Open in IMG/M
3300033158|Ga0335077_10516637All Organisms → cellular organisms → Bacteria1260Open in IMG/M
3300033402|Ga0326728_10985641All Organisms → cellular organisms → Bacteria586Open in IMG/M

Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).



 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil10.78%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Soil8.82%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil6.86%
SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Soil5.88%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere4.90%
Freshwater SedimentEnvironmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment3.92%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil3.92%
Peatlands SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil3.92%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil3.92%
Hardwood Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil3.92%
Bog Forest SoilEnvironmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil2.94%
Vadose Zone SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil2.94%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil2.94%
Tropical PeatlandEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland2.94%
Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil2.94%
SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Soil2.94%
WatershedsEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds1.96%
Surface SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil1.96%
Rice Paddy SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Rice Paddy Soil1.96%
Corn RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere1.96%
Terrestrial SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil0.98%
Permafrost SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Permafrost Soil0.98%
Agricultural SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil0.98%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural → Soil0.98%
PeatlandEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Peatland0.98%
Corn RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere0.98%
Sandy SoilEnvironmental → Terrestrial → Soil → Sand → Unclassified → Sandy Soil0.98%
Deep SubsurfaceEnvironmental → Terrestrial → Deep Subsurface → Unclassified → Unclassified → Deep Subsurface0.98%
BogEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Bog0.98%
Peat SoilEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Peat Soil0.98%
Miscanthus RhizosphereHost-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Miscanthus Rhizosphere0.98%
Miscanthus RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere0.98%
Miscanthus RhizosphereHost-Associated → Plants → Roots → Rhizosphere → Soil → Miscanthus Rhizosphere0.98%
Populus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere0.98%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere0.98%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere0.98%
RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Rhizosphere0.98%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere0.98%

Visualization
Powered by ApexCharts



Associated Samples

Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).

Taxon OIDSample NameHabitat TypeIMG/M Link
2228664022Soil microbial communities from Great Prairies - Iowa, Native Prairie soilEnvironmentalOpen in IMG/M
3300001471Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_Ref_O2EnvironmentalOpen in IMG/M
3300001867Texas A ecozone_OM1H0_M2 (Combined assembly for Texas A ecozone Site metagenome samples, ASSEMBLY_DATE=20130705)EnvironmentalOpen in IMG/M
3300002557Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 08_20_2013_1_20cmEnvironmentalOpen in IMG/M
3300002911Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 10_02_2013_2_20cmEnvironmentalOpen in IMG/M
3300004080Coassembly of ECP04_OM1, ECP04_OM2, ECP04_OM3EnvironmentalOpen in IMG/M
3300004082Coassembly of ECP03_0M1, ECP03_OM2, ECP03_OM3EnvironmentalOpen in IMG/M
3300005174Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_129EnvironmentalOpen in IMG/M
3300005176Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_128EnvironmentalOpen in IMG/M
3300005293Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1Host-AssociatedOpen in IMG/M
3300005445Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaGEnvironmentalOpen in IMG/M
3300005450Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_131EnvironmentalOpen in IMG/M
3300005458Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaGEnvironmentalOpen in IMG/M
3300005518Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaGEnvironmentalOpen in IMG/M
3300005546Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaGEnvironmentalOpen in IMG/M
3300005553Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_144EnvironmentalOpen in IMG/M
3300005598Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_155EnvironmentalOpen in IMG/M
3300005834Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2Host-AssociatedOpen in IMG/M
3300005905Rice paddy soil microbial communities from Twitchell Island, California, USA - SF_Rice_5C_0N_105EnvironmentalOpen in IMG/M
3300006162Freshwater sediment microbial communities from Pennsylvania, USA - Little Laurel Run_MetaG_LLR_2012EnvironmentalOpen in IMG/M
3300006176Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5EnvironmentalOpen in IMG/M
3300006358Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2Host-AssociatedOpen in IMG/M
3300006755Agricultural soil microbial communities from Georgia to study Nitrogen management - GA PlitterEnvironmentalOpen in IMG/M
3300006904Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD3Host-AssociatedOpen in IMG/M
3300007819Permafrost core soil microbial communities from Svalbard, Norway - sample 2-1-2 SoapdenovoEnvironmentalOpen in IMG/M
3300007959Deep subsurface shale carbon reservoir microbial communities from Ohio, USA - Methanotroph_Enrichment_5EnvironmentalOpen in IMG/M
3300009089Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H1.8 metaGEnvironmentalOpen in IMG/M
3300009524Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_c_BC metaGEnvironmentalOpen in IMG/M
3300010379Sb_50d combined assemblyEnvironmentalOpen in IMG/M
3300010401Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-1EnvironmentalOpen in IMG/M
3300012208Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_20_16 metaGEnvironmentalOpen in IMG/M
3300012977Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Glu_20cm_5_24_1 metaGEnvironmentalOpen in IMG/M
3300012984Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_247_MGEnvironmentalOpen in IMG/M
3300012986Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_217_MGEnvironmentalOpen in IMG/M
3300012989Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_237_MGEnvironmentalOpen in IMG/M
3300013297Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaGHost-AssociatedOpen in IMG/M
3300014150Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Met_20cm_5_24_1 metaGEnvironmentalOpen in IMG/M
3300016422Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111EnvironmentalOpen in IMG/M
3300016445Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108EnvironmentalOpen in IMG/M
3300017659Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Met_40cm_5_24_1 metaGEnvironmentalOpen in IMG/M
3300017927Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SourceSoil_4EnvironmentalOpen in IMG/M
3300017934Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_3EnvironmentalOpen in IMG/M
3300017961Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP5_20_MGEnvironmentalOpen in IMG/M
3300017974Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP5_10_MGEnvironmentalOpen in IMG/M
3300018001Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW-S_5EnvironmentalOpen in IMG/M
3300018007Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_5EnvironmentalOpen in IMG/M
3300018088Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP15_10_MGEnvironmentalOpen in IMG/M
3300018431Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_104EnvironmentalOpen in IMG/M
3300018468Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_111EnvironmentalOpen in IMG/M
3300019284Metatranscriptome of tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_BV02_MP05_10_MT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300019885Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L1m2EnvironmentalOpen in IMG/M
3300020004Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? H1a2EnvironmentalOpen in IMG/M
3300020170Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad1_1_08_16fungal (Illumina Assembly)EnvironmentalOpen in IMG/M
3300020579Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-MEnvironmentalOpen in IMG/M
3300020580Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-MEnvironmentalOpen in IMG/M
3300021088Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-28-MEnvironmentalOpen in IMG/M
3300021180Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-OEnvironmentalOpen in IMG/M
3300021403Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-OEnvironmentalOpen in IMG/M
3300021407Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-OEnvironmentalOpen in IMG/M
3300021420Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-12-MEnvironmentalOpen in IMG/M
3300021432Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-MEnvironmentalOpen in IMG/M
3300021474Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-11-OEnvironmentalOpen in IMG/M
3300021477Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-4-OEnvironmentalOpen in IMG/M
3300025899Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300025906Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025924Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025931Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025939Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025981Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300025990Rice paddy soil microbial communities from Twitchell Island, California, USA - SF_Rice_5C_80N_102 (SPAdes)EnvironmentalOpen in IMG/M
3300026530Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_154 (SPAdes)EnvironmentalOpen in IMG/M
3300026542Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_148 (SPAdes)EnvironmentalOpen in IMG/M
3300027047Forest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaG HF042 (SPAdes)EnvironmentalOpen in IMG/M
3300027696Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_b_LC metaG (SPAdes)EnvironmentalOpen in IMG/M
3300027825Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP12_OM1 (SPAdes)EnvironmentalOpen in IMG/M
3300027867Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen05_05102014_R1 (SPAdes)EnvironmentalOpen in IMG/M
3300027905Peat soil microbial communities from Weissenstadt, Germany - SII-SIP-2007 (SPAdes)EnvironmentalOpen in IMG/M
3300027911Freshwater sediment microbial communities from Pennsylvania, USA - Little Laurel Run_MetaG_LLR_2012 (SPAdes)EnvironmentalOpen in IMG/M
3300028884Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_195EnvironmentalOpen in IMG/M
3300028906Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5 (v2)EnvironmentalOpen in IMG/M
3300030862Metatranscriptome of soil microbial communities from Maridalen valley, Oslo, Norway - NSE5 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300031150 (restricted)Sandy soil microbial communities from University of British Columbia, Vancouver, Canada - EtOH4_T0_E4EnvironmentalOpen in IMG/M
3300031241Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaGHost-AssociatedOpen in IMG/M
3300031524Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Bog_T0_3EnvironmentalOpen in IMG/M
3300031715Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM2C_05EnvironmentalOpen in IMG/M
3300031820Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_515EnvironmentalOpen in IMG/M
3300031910Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108 (v2)EnvironmentalOpen in IMG/M
3300031939Soil microbial communities from UC Gill Tract Community Farm, Albany, California, United States - DLSLS.P.R2EnvironmentalOpen in IMG/M
3300032180Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515EnvironmentalOpen in IMG/M
3300032783Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.3EnvironmentalOpen in IMG/M
3300032805Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.2EnvironmentalOpen in IMG/M
3300032828Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.4EnvironmentalOpen in IMG/M
3300032897Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_1.5EnvironmentalOpen in IMG/M
3300033158Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.1EnvironmentalOpen in IMG/M
3300033402Lab enriched peat soil microbial communities from McLean, Ithaca, NY, United States - MB31MNEnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap



 ⦗Top⦘

Family Sequences

Note: Some of these sequences are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).

Protein ID Sample Taxon ID Habitat Sequence
INPgaii200_063782322228664022SoilVPSLAQFGSDYTSSLPIILLTLFALGILLIDLLVPPELKSINAVAAFIGILFAVF
JGI12712J15308_1019721623300001471Forest SoilMPQYFTATDYLLSLPIVMLTVFALGILLIDLIIPPEWKWTNALTAFI
JGI12627J18819_1004701423300001867Forest SoilVSASIAQYFTGTDYLLSLPVILLTLFALGILIIDLMLPRE
JGI25381J37097_102019623300002557Grasslands SoilVIGSMAQFFTLSDYSMSLPVILLTLFALGILLMDLIIPAEWKW
JGI25390J43892_1006218923300002911Grasslands SoilVPGNFSQFFTGTDYLMSLPIILLTLFALGILLIDLMVPAEWKG
Ga0062385_1025377923300004080Bog Forest SoilMGGAQYFTGIDYLLSLPIILLTLFALGILLIDLMVPPEWKWTNAATAFV
Ga0062384_10149120813300004082Bog Forest SoilVPGTFQYFSGTDYLLSLPIVMLTVFALGILLIDLMIPPEW
Ga0066680_1004441333300005174SoilVSGTISQYFTGTDYLLSLPMVLLTLFALGILLIDLMLPREWKWANAVAAFVG
Ga0066679_1012700323300005176SoilVPVTIAQFFQRSDYLMSLPMILLTIFALGILLIDLMLPEDWKWANAMMAFVGV
Ga0065715_1112097013300005293Miscanthus RhizosphereVFGNLSSSFGAVDYLMSLPIMLLTLFALGILLGDLLLPAEWKWMNPLTALI
Ga0070708_10089475613300005445Corn, Switchgrass And Miscanthus RhizosphereVPGNFSQFFTGTDYLMSLPIILLTLFALGILLIDLMVPVEWKWVNAVTAL
Ga0066682_1003755933300005450SoilMTQFFTIVDYVMSLPIIMLTLFALGILLMDLMVPAQWKWT
Ga0070681_1084096723300005458Corn RhizosphereVPPISQMFERSDYLMSLPMMLLTIFALGILLIDLMLPTEWKWAN
Ga0070699_10015506413300005518Corn, Switchgrass And Miscanthus RhizosphereVFGNLGQNFGRVDYLMSLPIILLTLFALGILLVDLMLPAEWKWTNALTALVGIFFSAAG
Ga0070696_10157386023300005546Corn, Switchgrass And Miscanthus RhizosphereVFGNLSSSFGAVDYLMSLPIMLLTLFALGILLGDLLLPAEWKWMNPLTAL
Ga0066695_1043582623300005553SoilVPGNFSQFFTGTDYLMSLPIILLTLFALGILLIDLMV
Ga0066706_1149133513300005598SoilVPGNLSQFFTGTDYLMSLPIILLTLFALGILLIDLMVPAEWKGVNAI
Ga0068851_1102268013300005834Corn RhizosphereVPPISQMFERSDYLMSLPMMLLTIFALGILLIDLMLPTEWKWANALTA
Ga0075269_1009632623300005905Rice Paddy SoilMESTSLQYFVRADYALALPMILLTLFALGILMIDLILPAEWK
Ga0075030_10079398023300006162WatershedsMLQNFGRVDYLMSLPIILLTLFALGILLVDLMLPVDWKWTNALTALA
Ga0070765_10132936813300006176SoilVPGSLGQYFTSTDYLLSLPIVLLTLFALGILLIDLMLPKEW
Ga0068871_10074957713300006358Miscanthus RhizosphereVPPISQMFERSDYLMSLPMMLLTIFALGILLIDLMLPTEWKWANALTAFVGVLFAAFGV
Ga0079222_1021666713300006755Agricultural SoilVPPISQMFERSDYLMSLPMMLLTIFALGILLIDLMLPTEWKWANALTAFVGVLFAAF
Ga0075424_10028884423300006904Populus RhizosphereVFGNLSSSFGAVDYLMSLPIMLLTLFALGILLGDLLLP
Ga0104322_11732433300007819Permafrost SoilVLTHAANLFSSPQYLLSLPVILLTLFAAGVLLIDSVIPEEWKWMNAVT
Ga0079306_116872423300007959Deep SubsurfaceMIVTGSIQQFFTGTDYALSLPMMLLTLFALGILIIDLLLPKEW
Ga0099828_1183783913300009089Vadose Zone SoilVPGTISQYFTGTDYLLGLPIILLTLFALGILLIDLMLPTEWKWANAVTA
Ga0116225_137726123300009524Peatlands SoilMPQYFTGTDYLLSLPIVMLTVFALGILLIDLMIPPEWKWTNAV
Ga0136449_10446618423300010379Peatlands SoilVPGSLQQYFTATDYLLSLPIILLTLFALGILLIDLLVPPEW
Ga0134121_1003214743300010401Terrestrial SoilMAQNFGRVDYLMALPVILLTLFALGILLLDLMLPA
Ga0137376_1147694423300012208Vadose Zone SoilMTQFFTIVDYVMSLPIIMLTLFALGILLMDLMVPAQWKWTNAVTAM
Ga0134087_1026171013300012977Grasslands SoilVIGSMAQFFTLSDYSMSLPVILLTLFALGILLMDLMIPAEWK
Ga0134087_1078603323300012977Grasslands SoilMTQFFSIVDYVMSLPIIMLTLFALGILLMDLMVPAQWKWTNAVTA
Ga0164309_1073691613300012984SoilVSGNIVQNFGRVDYLMALPIMMLTLFGMGVLLLDLTLPVEWKRLNRLT
Ga0164304_1065125613300012986SoilLLGNLSTSFGAVDYLMSLPIVLLTLFALGILLGDLLLPAEWKWMNP
Ga0164305_1074584323300012989SoilLLGNLSTSFGAVDYLMSLPIVLLTLFALGILLIDLMLP
Ga0157378_1160185913300013297Miscanthus RhizosphereMTTPPFNLADYIMSLPIILLTLFALGILLIDLVTPKRWKWM
Ga0134081_1000992633300014150Grasslands SoilVIGSMAQFFTLSDYSMSLPVILLTLFALGILLMDLIIPAEWK
Ga0182039_1196755523300016422SoilVAGAQYFTGMDYLLSLPVIMLTMFALGILLIDLMLPPESKWINPATA
Ga0182038_1015852313300016445SoilVPGAQYFSGMDYLLSLPFILLTLFALFILLFDLMIPPEWKWLNALIAL
Ga0134083_1054275313300017659Grasslands SoilMAQFFTLSDYSMSLPVILLTLFALGILLMDLMIPAEWKWFN
Ga0187824_1021712013300017927Freshwater SedimentVTSFSQFFTSTDYLLALPMILLALFGLGILVFDLLLPP
Ga0187803_1018248523300017934Freshwater SedimentVPGMQQFFTGTDYVLSLPILLLTIFALGILLIDLMIPPEGKWTNA
Ga0187778_1108576213300017961Tropical PeatlandVAGAQYFTGTDYLLSLPIIMLTMFALGILLIDLMLPPESKWINPATALL
Ga0187777_1093572113300017974Tropical PeatlandMGQYFTLIDYRLSLPIIELTLFALGILLFDLLFPREWKWMNAVLALAGLAS
Ga0187815_1030537223300018001Freshwater SedimentMPQYFTGTDYLLSLPIVMLTVFALGILLIDLMIPPEWKW
Ga0187805_1043156013300018007Freshwater SedimentVVIGAQYFTGTDYLLSLPVILLTLFALGILLIDLMVPPEWKW
Ga0187771_1036107323300018088Tropical PeatlandVPGAQYFTGIDYLLSLPVILLTLFALGILLIDLMIPPEWKW
Ga0066655_1084432313300018431Grasslands SoilMAQFFTLSDYSMSLPVILLTLFALGILLMDLIIPAEWKWFNAVTAF
Ga0066662_1028084623300018468Grasslands SoilVPVSIAQFFQRSDYLMSLPMILLTIFALGILLIDLMLPDDWKWA
Ga0187797_180708213300019284PeatlandVPGLQQFFTGTDYVLSLPMLLLTIFAVGILLIDLMIPPEGKWTNAGIAL
Ga0193747_106295723300019885SoilVFGNLAQNFGRVDYLMSLPIILLTLFALGILLVDLM
Ga0193755_106982923300020004SoilVPGNFSQFFTGTDYLMSLPIILLTLFALGILLIDLMVPDEWKW
Ga0179594_1027989613300020170Vadose Zone SoilMAQFFTLSDYSMSLPVILLTLFALGILLMDLIIPAEWKWFNA
Ga0210407_1127057823300020579SoilMSQYFTGTDYLLSLPIVMLTVFALGILLIDLMIPPEWKWTNAVTAFMGVL
Ga0210403_1148603123300020580SoilMPQYFTGTDYLLSLPIVMLTVFALGILLIDLMIPPEWK
Ga0210404_1012209123300021088SoilVFGTLAQNFGLGDYLLALPILLLTLFAVGILLIDLMLPAEWKW
Ga0210396_1143292623300021180SoilMSQYFTGTDYLLSLPIVLLTVFALGILLIDLMIPPEWKW
Ga0210397_1117930523300021403SoilVPGMPQYFTGTDYLLSLPIVMLTVFALGILLIDLMIPREWKWTNAVTALMGIL
Ga0210383_1057281223300021407SoilVPGAQQFFTSSDYVLSLPIILLTLFALGILLIDLMI
Ga0210394_1036143023300021420SoilVLVNLPSPFSGTDYLLSLPMILLTLFALGILLIDLMLPPEWKWVDAATALVGV
Ga0210384_1009229433300021432SoilMPSQYFTGTDYLLSLPIVMLTVFALGILLIDLMIPPEWKWTNS
Ga0210390_1152795213300021474SoilMAQNFGRVDYLMALPITLLTLFALGILMLDLMLPAQRKWMNPLVAL
Ga0210398_1055291623300021477SoilMVGAQYFTGTDYLLSLPIILLTLFALGILLIDLMVPRELKW
Ga0210398_1140984313300021477SoilMPSQYFTGTDYLLSLPIVMLTVFALGILLIDLMIPPEWKWTN
Ga0207642_1087635523300025899Miscanthus RhizosphereVSGNLAQNFGRVDYLMALPVILLTLFALGILLLDL
Ga0207699_1058686513300025906Corn, Switchgrass And Miscanthus RhizosphereVFENLAQNFGRVDYLMSLPIILLTLFALGILMVDLLLPAEWKWTNALTALVG
Ga0207694_1034427313300025924Corn RhizosphereVPPISQMFERSDYLMSLPMMLLTIFALGILLIDLMLPTEWKWANAVTAF
Ga0207644_1122468513300025931Switchgrass RhizosphereVPPISQMFERSDYLMSLPMMLLTIFALGILLIDLMLPTEWKWANALTAF
Ga0207665_1074543123300025939Corn, Switchgrass And Miscanthus RhizosphereMFTWTDYLLALPIILLTLFALGILLIDLMIPPEWKWANAMT
Ga0207640_1041918913300025981Corn RhizosphereVPPISQMFERSDYLMSLPMMLLTIFALGILLIDLMLPTEWKWANALTAFVG
Ga0208527_103878713300025990Rice Paddy SoilMIVTGSIQQFFTGTDYALSLPMMLLTLFALGILVIDLILPKEW
Ga0209807_102712933300026530SoilMAQYFTLSDYSMSLPIILLTLFALDILLIDLWIPIDR
Ga0209805_101313943300026542SoilVPGTISQYFTGTDYLLGLPIILLTLFALGILLIDLMLPPEWKWANAVTAFVGVL
Ga0209805_101834913300026542SoilVPVTIAQFFQRSDYLMSLPMILLTIFALGILLIDLMLPEDWKWANAMMAFVGVLFATAGL
Ga0208730_104296323300027047Forest SoilVPGMPQYFTGTDYLLSLPIIMLTVFALGILLIDLIIPPEWKWTNAVTAFIG
Ga0208696_113458713300027696Peatlands SoilVPGMPQYFTATDYLLSLPIVMLTVFALGILLIDLMIPPEWKWTNAMTAFM
Ga0209039_1016547823300027825Bog Forest SoilVGPSLGFSATDYVLALPMILLTLFALGILLIDLMLPREQKWLNAITAFIG
Ga0209167_1008735823300027867Surface SoilMSQYFTGTDYLLSLPIVLLTVFALGILLIDLMIPPEWKWTNAVT
Ga0209167_1018470023300027867Surface SoilVPGAISQWFSAGDYLLALPMILLSIFALGILLIDLMLPPEWKSINAWT
Ga0209415_1040136613300027905Peatlands SoilVLVNLPSSFSGTDYLLSLPMILLTLFALGILLIDLMLPAELKWVDAVTAFV
Ga0209698_1074667423300027911WatershedsMLQNFGRVDYLMSLPIILLTLFALGILLVDLMLPVDWKWTNALTA
Ga0307308_1028522413300028884SoilVPGNFSQFFTGTDYLMSLPIILLTLFALGILLIDLMVPAEWKGVNAI
Ga0308309_1021345813300028906SoilMGGAQYFTGIDYLLSLPVILLTLFALGILLIDLMVPPEW
Ga0308309_1146243523300028906SoilMPSQYFTGTDYLLSLPIVMLTVFALGILLIDLMIPPEWKWTNSVTAL
Ga0265753_110733623300030862SoilMPSQYFTGTDYLLSLPILMLTVFALGILLIDLIIPPE
(restricted) Ga0255311_105217723300031150Sandy SoilMAQNFGRVDYLMALPVILLTLFALGILIVDLMLTPAR
Ga0265325_1020009523300031241RhizosphereVPVSLQQYFTATDYLLSLPIILLTFFALAILLMDLWVPPDSKWLN
Ga0302320_1210612613300031524BogVPGSLQQYFSATDYLLSLPIILLTLFALGILLIDLLVPPEWKWLN
Ga0307476_1050684413300031715Hardwood Forest SoilMPQYFTGTDYLLSLPILMLTVFALGILLIDLMIPPEWKWTNAVTAFMGVLFSA
Ga0307473_1068806723300031820Hardwood Forest SoilMAQNFGRVDYLMALPVILLTLFALGILLLDLMLPAQWKKINAVTA
Ga0307473_1097737313300031820Hardwood Forest SoilVPGNFSQFFTGTDYLMSLPIILLTLFALGILLIDLMVPVEWKWVNAV
Ga0306923_1011185253300031910SoilVGGAQYLTGMDYLLSLPVILLTLFALGILLIDLSRNG
Ga0308174_1113368723300031939SoilVSASMSQFFSGTDYLLTLPMILLTLFALGILLIDLMVPPHWKWANA
Ga0307471_10069272613300032180Hardwood Forest SoilVFGNLAQNFGRVDYLMSLPIILLTLFALGILLVDLMLPSEWK
Ga0335079_1010965413300032783SoilVPGAQFFTGTDYLLSLPVILLTLFALGILLIDLMIPPEWKWANAVT
Ga0335078_1062156823300032805SoilVQVAPQFFTSTDYLLSLPIILLTLFALGILLIDLMV
Ga0335080_1127696413300032828SoilVPGHVSQFFTSTDYLMSLPMILLALFALGILLIDLLVPPEWK
Ga0335080_1203706813300032828SoilVPGAASNFFTPTDYLLSLPMLLLTLFALGILLIDLMVPKDWKWFNAAVALVGVMFSASS
Ga0335071_1008847913300032897SoilVPGAQFFTATDYLLSLPVILLTLFALGILLIDLMIPPEWK
Ga0335077_1051663723300033158SoilMTQYFTATDYLLSLPIIELTLFALGILLFDLLLPREWKWVNAA
Ga0326728_1098564123300033402Peat SoilVATPISQYFTSSDYLLSLPIILLTLFAVGILLIDLVLP


 ⦗Top⦘


© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.