Basic Information | |
---|---|
Family ID | F101542 |
Family Type | Metagenome / Metatranscriptome |
Number of Sequences | 102 |
Average Sequence Length | 45 residues |
Representative Sequence | VPGAQYFTGIDYLLSLPVILLTLFALGILLIDLMIPPEWKW |
Number of Associated Samples | 95 |
Number of Associated Scaffolds | 102 |
Quality Assessment | |
---|---|
Transcriptomic Evidence | Yes |
Most common taxonomic group | Bacteria |
% of genes with valid RBS motifs | 74.68 % |
% of genes near scaffold ends (potentially truncated) | 76.47 % |
% of genes from short scaffolds (< 2000 bps) | 67.65 % |
Associated GOLD sequencing projects | 92 |
AlphaFold2 3D model prediction | Yes |
3D model pTM-score | 0.56 |
Hidden Markov Model |
---|
Powered by Skylign |
Most Common Taxonomy | |
---|---|
Group | Bacteria (74.510 % of family members) |
NCBI Taxonomy ID | 2 |
Taxonomy | All Organisms → cellular organisms → Bacteria |
Most Common Ecosystem | |
---|---|
GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil (10.784 % of family members) |
Environment Ontology (ENVO) | Unclassified (19.608 % of family members) |
Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (55.882 % of family members) |
⦗Top⦘ |
⦗Top⦘ |
Predicted Topology & Secondary Structure | |||||
---|---|---|---|---|---|
Classification: | Transmembrane (alpha-helical) | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 43.48% β-sheet: 0.00% Coil/Unstructured: 56.52% | Feature Viewer |
|
|||||
Powered by Feature Viewer |
Structure Viewer | |
---|---|
| |
Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.56 |
Powered by PDBe Molstar |
⦗Top⦘ |
Pfam ID | Name | % Frequency in 102 Family Scaffolds |
---|---|---|
PF00361 | Proton_antipo_M | 61.76 |
PF01059 | Oxidored_q5_N | 4.90 |
PF00155 | Aminotran_1_2 | 0.98 |
PF01336 | tRNA_anti-codon | 0.98 |
⦗Top⦘ |
Name | Rank | Taxonomy | Distribution |
All Organisms | root | All Organisms | 75.49 % |
Unclassified | root | N/A | 24.51 % |
Visualization |
---|
Powered by ApexCharts |
Scaffold | Taxonomy | Length | IMG/M Link |
---|---|---|---|
3300001471|JGI12712J15308_10197216 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 528 | Open in IMG/M |
3300001867|JGI12627J18819_10047014 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 1803 | Open in IMG/M |
3300002557|JGI25381J37097_1020196 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 1167 | Open in IMG/M |
3300002911|JGI25390J43892_10062189 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 869 | Open in IMG/M |
3300004080|Ga0062385_10253779 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter | 982 | Open in IMG/M |
3300004082|Ga0062384_101491208 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter | 500 | Open in IMG/M |
3300005174|Ga0066680_10044413 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter | 2584 | Open in IMG/M |
3300005176|Ga0066679_10127003 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter | 1577 | Open in IMG/M |
3300005445|Ga0070708_100894756 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter | 833 | Open in IMG/M |
3300005450|Ga0066682_10037559 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter | 2881 | Open in IMG/M |
3300005458|Ga0070681_10840967 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter | 835 | Open in IMG/M |
3300005553|Ga0066695_10435826 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 809 | Open in IMG/M |
3300005598|Ga0066706_11491335 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter | 509 | Open in IMG/M |
3300005834|Ga0068851_11022680 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter | 522 | Open in IMG/M |
3300005905|Ga0075269_10096326 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter | 559 | Open in IMG/M |
3300006176|Ga0070765_101329368 | All Organisms → cellular organisms → Bacteria | 678 | Open in IMG/M |
3300006358|Ga0068871_100749577 | All Organisms → cellular organisms → Bacteria | 897 | Open in IMG/M |
3300006755|Ga0079222_10216667 | All Organisms → cellular organisms → Bacteria | 1168 | Open in IMG/M |
3300007819|Ga0104322_117324 | All Organisms → cellular organisms → Bacteria | 1215 | Open in IMG/M |
3300007959|Ga0079306_1168724 | All Organisms → cellular organisms → Bacteria | 559 | Open in IMG/M |
3300009089|Ga0099828_11837839 | All Organisms → cellular organisms → Bacteria | 532 | Open in IMG/M |
3300009524|Ga0116225_1377261 | All Organisms → cellular organisms → Bacteria | 631 | Open in IMG/M |
3300010379|Ga0136449_104466184 | All Organisms → cellular organisms → Bacteria | 515 | Open in IMG/M |
3300012208|Ga0137376_11476944 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 571 | Open in IMG/M |
3300012977|Ga0134087_10261710 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 797 | Open in IMG/M |
3300012977|Ga0134087_10786033 | All Organisms → cellular organisms → Bacteria | 514 | Open in IMG/M |
3300013297|Ga0157378_11601859 | All Organisms → cellular organisms → Bacteria | 697 | Open in IMG/M |
3300014150|Ga0134081_10009926 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 2536 | Open in IMG/M |
3300016422|Ga0182039_11967555 | All Organisms → cellular organisms → Bacteria | 537 | Open in IMG/M |
3300016445|Ga0182038_10158523 | Not Available | 1737 | Open in IMG/M |
3300017659|Ga0134083_10542753 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 525 | Open in IMG/M |
3300017934|Ga0187803_10182485 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 826 | Open in IMG/M |
3300017961|Ga0187778_11085762 | All Organisms → cellular organisms → Bacteria | 557 | Open in IMG/M |
3300017974|Ga0187777_10935721 | All Organisms → cellular organisms → Bacteria | 624 | Open in IMG/M |
3300018001|Ga0187815_10305372 | All Organisms → cellular organisms → Bacteria | 675 | Open in IMG/M |
3300018007|Ga0187805_10431560 | All Organisms → cellular organisms → Bacteria | 614 | Open in IMG/M |
3300018088|Ga0187771_10361073 | All Organisms → cellular organisms → Bacteria | 1222 | Open in IMG/M |
3300018431|Ga0066655_10844323 | All Organisms → cellular organisms → Bacteria | 624 | Open in IMG/M |
3300018468|Ga0066662_10280846 | All Organisms → cellular organisms → Bacteria | 1384 | Open in IMG/M |
3300019284|Ga0187797_1807082 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 766 | Open in IMG/M |
3300020004|Ga0193755_1069829 | All Organisms → cellular organisms → Bacteria | 1136 | Open in IMG/M |
3300020170|Ga0179594_10279896 | All Organisms → cellular organisms → Bacteria | 631 | Open in IMG/M |
3300020579|Ga0210407_11270578 | All Organisms → cellular organisms → Bacteria | 551 | Open in IMG/M |
3300020580|Ga0210403_11486031 | All Organisms → cellular organisms → Bacteria | 510 | Open in IMG/M |
3300021180|Ga0210396_11432926 | All Organisms → cellular organisms → Bacteria | 570 | Open in IMG/M |
3300021403|Ga0210397_11179305 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 595 | Open in IMG/M |
3300021407|Ga0210383_10572812 | All Organisms → cellular organisms → Bacteria | 974 | Open in IMG/M |
3300021420|Ga0210394_10361430 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 1276 | Open in IMG/M |
3300021432|Ga0210384_10092294 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 2719 | Open in IMG/M |
3300021477|Ga0210398_10552916 | All Organisms → cellular organisms → Bacteria | 936 | Open in IMG/M |
3300021477|Ga0210398_11409843 | All Organisms → cellular organisms → Bacteria | 544 | Open in IMG/M |
3300025924|Ga0207694_10344273 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 1233 | Open in IMG/M |
3300025931|Ga0207644_11224685 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 631 | Open in IMG/M |
3300025939|Ga0207665_10745431 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 772 | Open in IMG/M |
3300025981|Ga0207640_10419189 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 1095 | Open in IMG/M |
3300025990|Ga0208527_1038787 | All Organisms → cellular organisms → Bacteria | 586 | Open in IMG/M |
3300026530|Ga0209807_1027129 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 2768 | Open in IMG/M |
3300026542|Ga0209805_1013139 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 4428 | Open in IMG/M |
3300026542|Ga0209805_1018349 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 3689 | Open in IMG/M |
3300027047|Ga0208730_1042963 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 531 | Open in IMG/M |
3300027696|Ga0208696_1134587 | All Organisms → cellular organisms → Bacteria | 806 | Open in IMG/M |
3300027867|Ga0209167_10087358 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 1579 | Open in IMG/M |
3300027867|Ga0209167_10184700 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 1106 | Open in IMG/M |
3300028884|Ga0307308_10285224 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 791 | Open in IMG/M |
3300028906|Ga0308309_10213458 | Not Available | 1597 | Open in IMG/M |
3300028906|Ga0308309_11462435 | All Organisms → cellular organisms → Bacteria | 584 | Open in IMG/M |
3300030862|Ga0265753_1107336 | All Organisms → cellular organisms → Bacteria | 572 | Open in IMG/M |
3300031241|Ga0265325_10200095 | All Organisms → cellular organisms → Bacteria | 922 | Open in IMG/M |
3300031524|Ga0302320_12106126 | All Organisms → cellular organisms → Bacteria | 525 | Open in IMG/M |
3300031715|Ga0307476_10506844 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 894 | Open in IMG/M |
3300031820|Ga0307473_10977373 | All Organisms → cellular organisms → Bacteria | 617 | Open in IMG/M |
3300031910|Ga0306923_10111852 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 3090 | Open in IMG/M |
3300031939|Ga0308174_11133687 | All Organisms → cellular organisms → Bacteria | 666 | Open in IMG/M |
3300032783|Ga0335079_10109654 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter | 3121 | Open in IMG/M |
3300032805|Ga0335078_10621568 | All Organisms → cellular organisms → Eukaryota | 1357 | Open in IMG/M |
3300032828|Ga0335080_11276964 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 734 | Open in IMG/M |
3300032897|Ga0335071_10088479 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter | 3036 | Open in IMG/M |
3300033158|Ga0335077_10516637 | All Organisms → cellular organisms → Bacteria | 1260 | Open in IMG/M |
3300033402|Ga0326728_10985641 | All Organisms → cellular organisms → Bacteria | 586 | Open in IMG/M |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
⦗Top⦘ |
Habitat | Taxonomy | Distribution |
Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 10.78% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 8.82% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 6.86% |
Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 5.88% |
Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 4.90% |
Freshwater Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment | 3.92% |
Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 3.92% |
Peatlands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil | 3.92% |
Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 3.92% |
Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 3.92% |
Bog Forest Soil | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil | 2.94% |
Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 2.94% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 2.94% |
Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 2.94% |
Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 2.94% |
Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil | 2.94% |
Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 1.96% |
Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 1.96% |
Rice Paddy Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Rice Paddy Soil | 1.96% |
Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 1.96% |
Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 0.98% |
Permafrost Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Permafrost Soil | 0.98% |
Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 0.98% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 0.98% |
Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Peatland | 0.98% |
Corn Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere | 0.98% |
Sandy Soil | Environmental → Terrestrial → Soil → Sand → Unclassified → Sandy Soil | 0.98% |
Deep Subsurface | Environmental → Terrestrial → Deep Subsurface → Unclassified → Unclassified → Deep Subsurface | 0.98% |
Bog | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Bog | 0.98% |
Peat Soil | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Peat Soil | 0.98% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.98% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 0.98% |
Miscanthus Rhizosphere | Host-Associated → Plants → Roots → Rhizosphere → Soil → Miscanthus Rhizosphere | 0.98% |
Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 0.98% |
Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 0.98% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.98% |
Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Rhizosphere | 0.98% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 0.98% |
Visualization |
---|
Powered by ApexCharts |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
Taxon OID | Sample Name | Habitat Type | IMG/M Link |
---|---|---|---|
2228664022 | Soil microbial communities from Great Prairies - Iowa, Native Prairie soil | Environmental | Open in IMG/M |
3300001471 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_Ref_O2 | Environmental | Open in IMG/M |
3300001867 | Texas A ecozone_OM1H0_M2 (Combined assembly for Texas A ecozone Site metagenome samples, ASSEMBLY_DATE=20130705) | Environmental | Open in IMG/M |
3300002557 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 08_20_2013_1_20cm | Environmental | Open in IMG/M |
3300002911 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 10_02_2013_2_20cm | Environmental | Open in IMG/M |
3300004080 | Coassembly of ECP04_OM1, ECP04_OM2, ECP04_OM3 | Environmental | Open in IMG/M |
3300004082 | Coassembly of ECP03_0M1, ECP03_OM2, ECP03_OM3 | Environmental | Open in IMG/M |
3300005174 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_129 | Environmental | Open in IMG/M |
3300005176 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_128 | Environmental | Open in IMG/M |
3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 | Host-Associated | Open in IMG/M |
3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Environmental | Open in IMG/M |
3300005450 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_131 | Environmental | Open in IMG/M |
3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Environmental | Open in IMG/M |
3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Environmental | Open in IMG/M |
3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Environmental | Open in IMG/M |
3300005553 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_144 | Environmental | Open in IMG/M |
3300005598 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_155 | Environmental | Open in IMG/M |
3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Host-Associated | Open in IMG/M |
3300005905 | Rice paddy soil microbial communities from Twitchell Island, California, USA - SF_Rice_5C_0N_105 | Environmental | Open in IMG/M |
3300006162 | Freshwater sediment microbial communities from Pennsylvania, USA - Little Laurel Run_MetaG_LLR_2012 | Environmental | Open in IMG/M |
3300006176 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5 | Environmental | Open in IMG/M |
3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Host-Associated | Open in IMG/M |
3300006755 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Plitter | Environmental | Open in IMG/M |
3300006904 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD3 | Host-Associated | Open in IMG/M |
3300007819 | Permafrost core soil microbial communities from Svalbard, Norway - sample 2-1-2 Soapdenovo | Environmental | Open in IMG/M |
3300007959 | Deep subsurface shale carbon reservoir microbial communities from Ohio, USA - Methanotroph_Enrichment_5 | Environmental | Open in IMG/M |
3300009089 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H1.8 metaG | Environmental | Open in IMG/M |
3300009524 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_c_BC metaG | Environmental | Open in IMG/M |
3300010379 | Sb_50d combined assembly | Environmental | Open in IMG/M |
3300010401 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-1 | Environmental | Open in IMG/M |
3300012208 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_20_16 metaG | Environmental | Open in IMG/M |
3300012977 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Glu_20cm_5_24_1 metaG | Environmental | Open in IMG/M |
3300012984 | Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_247_MG | Environmental | Open in IMG/M |
3300012986 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_217_MG | Environmental | Open in IMG/M |
3300012989 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_237_MG | Environmental | Open in IMG/M |
3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Host-Associated | Open in IMG/M |
3300014150 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Met_20cm_5_24_1 metaG | Environmental | Open in IMG/M |
3300016422 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111 | Environmental | Open in IMG/M |
3300016445 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108 | Environmental | Open in IMG/M |
3300017659 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Met_40cm_5_24_1 metaG | Environmental | Open in IMG/M |
3300017927 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SourceSoil_4 | Environmental | Open in IMG/M |
3300017934 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_3 | Environmental | Open in IMG/M |
3300017961 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP5_20_MG | Environmental | Open in IMG/M |
3300017974 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP5_10_MG | Environmental | Open in IMG/M |
3300018001 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW-S_5 | Environmental | Open in IMG/M |
3300018007 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_5 | Environmental | Open in IMG/M |
3300018088 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP15_10_MG | Environmental | Open in IMG/M |
3300018431 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_104 | Environmental | Open in IMG/M |
3300018468 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_111 | Environmental | Open in IMG/M |
3300019284 | Metatranscriptome of tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_BV02_MP05_10_MT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300019885 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L1m2 | Environmental | Open in IMG/M |
3300020004 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? H1a2 | Environmental | Open in IMG/M |
3300020170 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad1_1_08_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
3300020579 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-M | Environmental | Open in IMG/M |
3300020580 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-M | Environmental | Open in IMG/M |
3300021088 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-28-M | Environmental | Open in IMG/M |
3300021180 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-O | Environmental | Open in IMG/M |
3300021403 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-O | Environmental | Open in IMG/M |
3300021407 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-O | Environmental | Open in IMG/M |
3300021420 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-12-M | Environmental | Open in IMG/M |
3300021432 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-M | Environmental | Open in IMG/M |
3300021474 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-11-O | Environmental | Open in IMG/M |
3300021477 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-4-O | Environmental | Open in IMG/M |
3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) | Environmental | Open in IMG/M |
3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) | Environmental | Open in IMG/M |
3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300025990 | Rice paddy soil microbial communities from Twitchell Island, California, USA - SF_Rice_5C_80N_102 (SPAdes) | Environmental | Open in IMG/M |
3300026530 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_154 (SPAdes) | Environmental | Open in IMG/M |
3300026542 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_148 (SPAdes) | Environmental | Open in IMG/M |
3300027047 | Forest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaG HF042 (SPAdes) | Environmental | Open in IMG/M |
3300027696 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_b_LC metaG (SPAdes) | Environmental | Open in IMG/M |
3300027825 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP12_OM1 (SPAdes) | Environmental | Open in IMG/M |
3300027867 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen05_05102014_R1 (SPAdes) | Environmental | Open in IMG/M |
3300027905 | Peat soil microbial communities from Weissenstadt, Germany - SII-SIP-2007 (SPAdes) | Environmental | Open in IMG/M |
3300027911 | Freshwater sediment microbial communities from Pennsylvania, USA - Little Laurel Run_MetaG_LLR_2012 (SPAdes) | Environmental | Open in IMG/M |
3300028884 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_195 | Environmental | Open in IMG/M |
3300028906 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5 (v2) | Environmental | Open in IMG/M |
3300030862 | Metatranscriptome of soil microbial communities from Maridalen valley, Oslo, Norway - NSE5 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300031150 (restricted) | Sandy soil microbial communities from University of British Columbia, Vancouver, Canada - EtOH4_T0_E4 | Environmental | Open in IMG/M |
3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Host-Associated | Open in IMG/M |
3300031524 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Bog_T0_3 | Environmental | Open in IMG/M |
3300031715 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM2C_05 | Environmental | Open in IMG/M |
3300031820 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_515 | Environmental | Open in IMG/M |
3300031910 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108 (v2) | Environmental | Open in IMG/M |
3300031939 | Soil microbial communities from UC Gill Tract Community Farm, Albany, California, United States - DLSLS.P.R2 | Environmental | Open in IMG/M |
3300032180 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515 | Environmental | Open in IMG/M |
3300032783 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.3 | Environmental | Open in IMG/M |
3300032805 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.2 | Environmental | Open in IMG/M |
3300032828 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.4 | Environmental | Open in IMG/M |
3300032897 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_1.5 | Environmental | Open in IMG/M |
3300033158 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.1 | Environmental | Open in IMG/M |
3300033402 | Lab enriched peat soil microbial communities from McLean, Ithaca, NY, United States - MB31MN | Environmental | Open in IMG/M |
Geographical Distribution | |
---|---|
Zoom: | Powered by OpenStreetMap |
⦗Top⦘ |
Note: Some of these sequences are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
Protein ID | Sample Taxon ID | Habitat | Sequence |
INPgaii200_06378232 | 2228664022 | Soil | VPSLAQFGSDYTSSLPIILLTLFALGILLIDLLVPPELKSINAVAAFIGILFAVF |
JGI12712J15308_101972162 | 3300001471 | Forest Soil | MPQYFTATDYLLSLPIVMLTVFALGILLIDLIIPPEWKWTNALTAFI |
JGI12627J18819_100470142 | 3300001867 | Forest Soil | VSASIAQYFTGTDYLLSLPVILLTLFALGILIIDLMLPRE |
JGI25381J37097_10201962 | 3300002557 | Grasslands Soil | VIGSMAQFFTLSDYSMSLPVILLTLFALGILLMDLIIPAEWKW |
JGI25390J43892_100621892 | 3300002911 | Grasslands Soil | VPGNFSQFFTGTDYLMSLPIILLTLFALGILLIDLMVPAEWKG |
Ga0062385_102537792 | 3300004080 | Bog Forest Soil | MGGAQYFTGIDYLLSLPIILLTLFALGILLIDLMVPPEWKWTNAATAFV |
Ga0062384_1014912081 | 3300004082 | Bog Forest Soil | VPGTFQYFSGTDYLLSLPIVMLTVFALGILLIDLMIPPEW |
Ga0066680_100444133 | 3300005174 | Soil | VSGTISQYFTGTDYLLSLPMVLLTLFALGILLIDLMLPREWKWANAVAAFVG |
Ga0066679_101270032 | 3300005176 | Soil | VPVTIAQFFQRSDYLMSLPMILLTIFALGILLIDLMLPEDWKWANAMMAFVGV |
Ga0065715_111209701 | 3300005293 | Miscanthus Rhizosphere | VFGNLSSSFGAVDYLMSLPIMLLTLFALGILLGDLLLPAEWKWMNPLTALI |
Ga0070708_1008947561 | 3300005445 | Corn, Switchgrass And Miscanthus Rhizosphere | VPGNFSQFFTGTDYLMSLPIILLTLFALGILLIDLMVPVEWKWVNAVTAL |
Ga0066682_100375593 | 3300005450 | Soil | MTQFFTIVDYVMSLPIIMLTLFALGILLMDLMVPAQWKWT |
Ga0070681_108409672 | 3300005458 | Corn Rhizosphere | VPPISQMFERSDYLMSLPMMLLTIFALGILLIDLMLPTEWKWAN |
Ga0070699_1001550641 | 3300005518 | Corn, Switchgrass And Miscanthus Rhizosphere | VFGNLGQNFGRVDYLMSLPIILLTLFALGILLVDLMLPAEWKWTNALTALVGIFFSAAG |
Ga0070696_1015738602 | 3300005546 | Corn, Switchgrass And Miscanthus Rhizosphere | VFGNLSSSFGAVDYLMSLPIMLLTLFALGILLGDLLLPAEWKWMNPLTAL |
Ga0066695_104358262 | 3300005553 | Soil | VPGNFSQFFTGTDYLMSLPIILLTLFALGILLIDLMV |
Ga0066706_114913351 | 3300005598 | Soil | VPGNLSQFFTGTDYLMSLPIILLTLFALGILLIDLMVPAEWKGVNAI |
Ga0068851_110226801 | 3300005834 | Corn Rhizosphere | VPPISQMFERSDYLMSLPMMLLTIFALGILLIDLMLPTEWKWANALTA |
Ga0075269_100963262 | 3300005905 | Rice Paddy Soil | MESTSLQYFVRADYALALPMILLTLFALGILMIDLILPAEWK |
Ga0075030_1007939802 | 3300006162 | Watersheds | MLQNFGRVDYLMSLPIILLTLFALGILLVDLMLPVDWKWTNALTALA |
Ga0070765_1013293681 | 3300006176 | Soil | VPGSLGQYFTSTDYLLSLPIVLLTLFALGILLIDLMLPKEW |
Ga0068871_1007495771 | 3300006358 | Miscanthus Rhizosphere | VPPISQMFERSDYLMSLPMMLLTIFALGILLIDLMLPTEWKWANALTAFVGVLFAAFGV |
Ga0079222_102166671 | 3300006755 | Agricultural Soil | VPPISQMFERSDYLMSLPMMLLTIFALGILLIDLMLPTEWKWANALTAFVGVLFAAF |
Ga0075424_1002888442 | 3300006904 | Populus Rhizosphere | VFGNLSSSFGAVDYLMSLPIMLLTLFALGILLGDLLLP |
Ga0104322_1173243 | 3300007819 | Permafrost Soil | VLTHAANLFSSPQYLLSLPVILLTLFAAGVLLIDSVIPEEWKWMNAVT |
Ga0079306_11687242 | 3300007959 | Deep Subsurface | MIVTGSIQQFFTGTDYALSLPMMLLTLFALGILIIDLLLPKEW |
Ga0099828_118378391 | 3300009089 | Vadose Zone Soil | VPGTISQYFTGTDYLLGLPIILLTLFALGILLIDLMLPTEWKWANAVTA |
Ga0116225_13772612 | 3300009524 | Peatlands Soil | MPQYFTGTDYLLSLPIVMLTVFALGILLIDLMIPPEWKWTNAV |
Ga0136449_1044661842 | 3300010379 | Peatlands Soil | VPGSLQQYFTATDYLLSLPIILLTLFALGILLIDLLVPPEW |
Ga0134121_100321474 | 3300010401 | Terrestrial Soil | MAQNFGRVDYLMALPVILLTLFALGILLLDLMLPA |
Ga0137376_114769442 | 3300012208 | Vadose Zone Soil | MTQFFTIVDYVMSLPIIMLTLFALGILLMDLMVPAQWKWTNAVTAM |
Ga0134087_102617101 | 3300012977 | Grasslands Soil | VIGSMAQFFTLSDYSMSLPVILLTLFALGILLMDLMIPAEWK |
Ga0134087_107860332 | 3300012977 | Grasslands Soil | MTQFFSIVDYVMSLPIIMLTLFALGILLMDLMVPAQWKWTNAVTA |
Ga0164309_107369161 | 3300012984 | Soil | VSGNIVQNFGRVDYLMALPIMMLTLFGMGVLLLDLTLPVEWKRLNRLT |
Ga0164304_106512561 | 3300012986 | Soil | LLGNLSTSFGAVDYLMSLPIVLLTLFALGILLGDLLLPAEWKWMNP |
Ga0164305_107458432 | 3300012989 | Soil | LLGNLSTSFGAVDYLMSLPIVLLTLFALGILLIDLMLP |
Ga0157378_116018591 | 3300013297 | Miscanthus Rhizosphere | MTTPPFNLADYIMSLPIILLTLFALGILLIDLVTPKRWKWM |
Ga0134081_100099263 | 3300014150 | Grasslands Soil | VIGSMAQFFTLSDYSMSLPVILLTLFALGILLMDLIIPAEWK |
Ga0182039_119675552 | 3300016422 | Soil | VAGAQYFTGMDYLLSLPVIMLTMFALGILLIDLMLPPESKWINPATA |
Ga0182038_101585231 | 3300016445 | Soil | VPGAQYFSGMDYLLSLPFILLTLFALFILLFDLMIPPEWKWLNALIAL |
Ga0134083_105427531 | 3300017659 | Grasslands Soil | MAQFFTLSDYSMSLPVILLTLFALGILLMDLMIPAEWKWFN |
Ga0187824_102171201 | 3300017927 | Freshwater Sediment | VTSFSQFFTSTDYLLALPMILLALFGLGILVFDLLLPP |
Ga0187803_101824852 | 3300017934 | Freshwater Sediment | VPGMQQFFTGTDYVLSLPILLLTIFALGILLIDLMIPPEGKWTNA |
Ga0187778_110857621 | 3300017961 | Tropical Peatland | VAGAQYFTGTDYLLSLPIIMLTMFALGILLIDLMLPPESKWINPATALL |
Ga0187777_109357211 | 3300017974 | Tropical Peatland | MGQYFTLIDYRLSLPIIELTLFALGILLFDLLFPREWKWMNAVLALAGLAS |
Ga0187815_103053722 | 3300018001 | Freshwater Sediment | MPQYFTGTDYLLSLPIVMLTVFALGILLIDLMIPPEWKW |
Ga0187805_104315601 | 3300018007 | Freshwater Sediment | VVIGAQYFTGTDYLLSLPVILLTLFALGILLIDLMVPPEWKW |
Ga0187771_103610732 | 3300018088 | Tropical Peatland | VPGAQYFTGIDYLLSLPVILLTLFALGILLIDLMIPPEWKW |
Ga0066655_108443231 | 3300018431 | Grasslands Soil | MAQFFTLSDYSMSLPVILLTLFALGILLMDLIIPAEWKWFNAVTAF |
Ga0066662_102808462 | 3300018468 | Grasslands Soil | VPVSIAQFFQRSDYLMSLPMILLTIFALGILLIDLMLPDDWKWA |
Ga0187797_18070821 | 3300019284 | Peatland | VPGLQQFFTGTDYVLSLPMLLLTIFAVGILLIDLMIPPEGKWTNAGIAL |
Ga0193747_10629572 | 3300019885 | Soil | VFGNLAQNFGRVDYLMSLPIILLTLFALGILLVDLM |
Ga0193755_10698292 | 3300020004 | Soil | VPGNFSQFFTGTDYLMSLPIILLTLFALGILLIDLMVPDEWKW |
Ga0179594_102798961 | 3300020170 | Vadose Zone Soil | MAQFFTLSDYSMSLPVILLTLFALGILLMDLIIPAEWKWFNA |
Ga0210407_112705782 | 3300020579 | Soil | MSQYFTGTDYLLSLPIVMLTVFALGILLIDLMIPPEWKWTNAVTAFMGVL |
Ga0210403_114860312 | 3300020580 | Soil | MPQYFTGTDYLLSLPIVMLTVFALGILLIDLMIPPEWK |
Ga0210404_101220912 | 3300021088 | Soil | VFGTLAQNFGLGDYLLALPILLLTLFAVGILLIDLMLPAEWKW |
Ga0210396_114329262 | 3300021180 | Soil | MSQYFTGTDYLLSLPIVLLTVFALGILLIDLMIPPEWKW |
Ga0210397_111793052 | 3300021403 | Soil | VPGMPQYFTGTDYLLSLPIVMLTVFALGILLIDLMIPREWKWTNAVTALMGIL |
Ga0210383_105728122 | 3300021407 | Soil | VPGAQQFFTSSDYVLSLPIILLTLFALGILLIDLMI |
Ga0210394_103614302 | 3300021420 | Soil | VLVNLPSPFSGTDYLLSLPMILLTLFALGILLIDLMLPPEWKWVDAATALVGV |
Ga0210384_100922943 | 3300021432 | Soil | MPSQYFTGTDYLLSLPIVMLTVFALGILLIDLMIPPEWKWTNS |
Ga0210390_115279521 | 3300021474 | Soil | MAQNFGRVDYLMALPITLLTLFALGILMLDLMLPAQRKWMNPLVAL |
Ga0210398_105529162 | 3300021477 | Soil | MVGAQYFTGTDYLLSLPIILLTLFALGILLIDLMVPRELKW |
Ga0210398_114098431 | 3300021477 | Soil | MPSQYFTGTDYLLSLPIVMLTVFALGILLIDLMIPPEWKWTN |
Ga0207642_108763552 | 3300025899 | Miscanthus Rhizosphere | VSGNLAQNFGRVDYLMALPVILLTLFALGILLLDL |
Ga0207699_105868651 | 3300025906 | Corn, Switchgrass And Miscanthus Rhizosphere | VFENLAQNFGRVDYLMSLPIILLTLFALGILMVDLLLPAEWKWTNALTALVG |
Ga0207694_103442731 | 3300025924 | Corn Rhizosphere | VPPISQMFERSDYLMSLPMMLLTIFALGILLIDLMLPTEWKWANAVTAF |
Ga0207644_112246851 | 3300025931 | Switchgrass Rhizosphere | VPPISQMFERSDYLMSLPMMLLTIFALGILLIDLMLPTEWKWANALTAF |
Ga0207665_107454312 | 3300025939 | Corn, Switchgrass And Miscanthus Rhizosphere | MFTWTDYLLALPIILLTLFALGILLIDLMIPPEWKWANAMT |
Ga0207640_104191891 | 3300025981 | Corn Rhizosphere | VPPISQMFERSDYLMSLPMMLLTIFALGILLIDLMLPTEWKWANALTAFVG |
Ga0208527_10387871 | 3300025990 | Rice Paddy Soil | MIVTGSIQQFFTGTDYALSLPMMLLTLFALGILVIDLILPKEW |
Ga0209807_10271293 | 3300026530 | Soil | MAQYFTLSDYSMSLPIILLTLFALDILLIDLWIPIDR |
Ga0209805_10131394 | 3300026542 | Soil | VPGTISQYFTGTDYLLGLPIILLTLFALGILLIDLMLPPEWKWANAVTAFVGVL |
Ga0209805_10183491 | 3300026542 | Soil | VPVTIAQFFQRSDYLMSLPMILLTIFALGILLIDLMLPEDWKWANAMMAFVGVLFATAGL |
Ga0208730_10429632 | 3300027047 | Forest Soil | VPGMPQYFTGTDYLLSLPIIMLTVFALGILLIDLIIPPEWKWTNAVTAFIG |
Ga0208696_11345871 | 3300027696 | Peatlands Soil | VPGMPQYFTATDYLLSLPIVMLTVFALGILLIDLMIPPEWKWTNAMTAFM |
Ga0209039_101654782 | 3300027825 | Bog Forest Soil | VGPSLGFSATDYVLALPMILLTLFALGILLIDLMLPREQKWLNAITAFIG |
Ga0209167_100873582 | 3300027867 | Surface Soil | MSQYFTGTDYLLSLPIVLLTVFALGILLIDLMIPPEWKWTNAVT |
Ga0209167_101847002 | 3300027867 | Surface Soil | VPGAISQWFSAGDYLLALPMILLSIFALGILLIDLMLPPEWKSINAWT |
Ga0209415_104013661 | 3300027905 | Peatlands Soil | VLVNLPSSFSGTDYLLSLPMILLTLFALGILLIDLMLPAELKWVDAVTAFV |
Ga0209698_107466742 | 3300027911 | Watersheds | MLQNFGRVDYLMSLPIILLTLFALGILLVDLMLPVDWKWTNALTA |
Ga0307308_102852241 | 3300028884 | Soil | VPGNFSQFFTGTDYLMSLPIILLTLFALGILLIDLMVPAEWKGVNAI |
Ga0308309_102134581 | 3300028906 | Soil | MGGAQYFTGIDYLLSLPVILLTLFALGILLIDLMVPPEW |
Ga0308309_114624352 | 3300028906 | Soil | MPSQYFTGTDYLLSLPIVMLTVFALGILLIDLMIPPEWKWTNSVTAL |
Ga0265753_11073362 | 3300030862 | Soil | MPSQYFTGTDYLLSLPILMLTVFALGILLIDLIIPPE |
(restricted) Ga0255311_10521772 | 3300031150 | Sandy Soil | MAQNFGRVDYLMALPVILLTLFALGILIVDLMLTPAR |
Ga0265325_102000952 | 3300031241 | Rhizosphere | VPVSLQQYFTATDYLLSLPIILLTFFALAILLMDLWVPPDSKWLN |
Ga0302320_121061261 | 3300031524 | Bog | VPGSLQQYFSATDYLLSLPIILLTLFALGILLIDLLVPPEWKWLN |
Ga0307476_105068441 | 3300031715 | Hardwood Forest Soil | MPQYFTGTDYLLSLPILMLTVFALGILLIDLMIPPEWKWTNAVTAFMGVLFSA |
Ga0307473_106880672 | 3300031820 | Hardwood Forest Soil | MAQNFGRVDYLMALPVILLTLFALGILLLDLMLPAQWKKINAVTA |
Ga0307473_109773731 | 3300031820 | Hardwood Forest Soil | VPGNFSQFFTGTDYLMSLPIILLTLFALGILLIDLMVPVEWKWVNAV |
Ga0306923_101118525 | 3300031910 | Soil | VGGAQYLTGMDYLLSLPVILLTLFALGILLIDLSRNG |
Ga0308174_111336872 | 3300031939 | Soil | VSASMSQFFSGTDYLLTLPMILLTLFALGILLIDLMVPPHWKWANA |
Ga0307471_1006927261 | 3300032180 | Hardwood Forest Soil | VFGNLAQNFGRVDYLMSLPIILLTLFALGILLVDLMLPSEWK |
Ga0335079_101096541 | 3300032783 | Soil | VPGAQFFTGTDYLLSLPVILLTLFALGILLIDLMIPPEWKWANAVT |
Ga0335078_106215682 | 3300032805 | Soil | VQVAPQFFTSTDYLLSLPIILLTLFALGILLIDLMV |
Ga0335080_112769641 | 3300032828 | Soil | VPGHVSQFFTSTDYLMSLPMILLALFALGILLIDLLVPPEWK |
Ga0335080_120370681 | 3300032828 | Soil | VPGAASNFFTPTDYLLSLPMLLLTLFALGILLIDLMVPKDWKWFNAAVALVGVMFSASS |
Ga0335071_100884791 | 3300032897 | Soil | VPGAQFFTATDYLLSLPVILLTLFALGILLIDLMIPPEWK |
Ga0335077_105166372 | 3300033158 | Soil | MTQYFTATDYLLSLPIIELTLFALGILLFDLLLPREWKWVNAA |
Ga0326728_109856412 | 3300033402 | Peat Soil | VATPISQYFTSSDYLLSLPIILLTLFAVGILLIDLVLP |
⦗Top⦘ |