| Basic Information | |
|---|---|
| Family ID | F101541 |
| Family Type | Metagenome |
| Number of Sequences | 102 |
| Average Sequence Length | 51 residues |
| Representative Sequence | MRDAIEFLRTSAEELRELASSAPDISDHLRRLADELDATAADLERGGGIPN |
| Number of Associated Samples | 87 |
| Number of Associated Scaffolds | 102 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | No |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 22.55 % |
| % of genes near scaffold ends (potentially truncated) | 28.43 % |
| % of genes from short scaffolds (< 2000 bps) | 92.16 % |
| Associated GOLD sequencing projects | 79 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.65 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (53.922 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil (17.647 % of family members) |
| Environment Ontology (ENVO) | Unclassified (32.353 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (49.020 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 51.90% β-sheet: 0.00% Coil/Unstructured: 48.10% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.65 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 102 Family Scaffolds |
|---|---|---|
| PF02515 | CoA_transf_3 | 16.67 |
| PF08241 | Methyltransf_11 | 8.82 |
| PF01425 | Amidase | 1.96 |
| PF05988 | DUF899 | 0.98 |
| PF16113 | ECH_2 | 0.98 |
| PF13561 | adh_short_C2 | 0.98 |
| PF00437 | T2SSE | 0.98 |
| PF02653 | BPD_transp_2 | 0.98 |
| PF04828 | GFA | 0.98 |
| PF03739 | LptF_LptG | 0.98 |
| PF02538 | Hydantoinase_B | 0.98 |
| PF01323 | DSBA | 0.98 |
| PF13358 | DDE_3 | 0.98 |
| COG ID | Name | Functional Category | % Frequency in 102 Family Scaffolds |
|---|---|---|---|
| COG1804 | Crotonobetainyl-CoA:carnitine CoA-transferase CaiB and related acyl-CoA transferases | Lipid transport and metabolism [I] | 16.67 |
| COG0146 | N-methylhydantoinase B/oxoprolinase/acetone carboxylase, alpha subunit | Amino acid transport and metabolism [E] | 1.96 |
| COG0154 | Asp-tRNAAsn/Glu-tRNAGln amidotransferase A subunit or related amidase | Translation, ribosomal structure and biogenesis [J] | 1.96 |
| COG0795 | Lipopolysaccharide export LptBFGC system, permease protein LptF | Cell wall/membrane/envelope biogenesis [M] | 0.98 |
| COG3791 | Uncharacterized conserved protein | Function unknown [S] | 0.98 |
| COG4312 | Predicted dithiol-disulfide oxidoreductase, DUF899 family | General function prediction only [R] | 0.98 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 53.92 % |
| Unclassified | root | N/A | 46.08 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300000912|JGI12032J12867_1015098 | Not Available | 501 | Open in IMG/M |
| 3300002245|JGIcombinedJ26739_100838374 | Not Available | 800 | Open in IMG/M |
| 3300002245|JGIcombinedJ26739_100912911 | Not Available | 761 | Open in IMG/M |
| 3300004153|Ga0063455_101436140 | All Organisms → cellular organisms → Bacteria | 534 | Open in IMG/M |
| 3300004157|Ga0062590_101575764 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 663 | Open in IMG/M |
| 3300004479|Ga0062595_100128829 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1421 | Open in IMG/M |
| 3300004479|Ga0062595_102253217 | Not Available | 535 | Open in IMG/M |
| 3300004643|Ga0062591_100371581 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1167 | Open in IMG/M |
| 3300005175|Ga0066673_10429162 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 775 | Open in IMG/M |
| 3300005176|Ga0066679_10359073 | All Organisms → cellular organisms → Bacteria | 953 | Open in IMG/M |
| 3300005330|Ga0070690_100710063 | Not Available | 773 | Open in IMG/M |
| 3300005332|Ga0066388_100271265 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 2339 | Open in IMG/M |
| 3300005341|Ga0070691_10727424 | Not Available | 598 | Open in IMG/M |
| 3300005343|Ga0070687_100903730 | Not Available | 633 | Open in IMG/M |
| 3300005353|Ga0070669_101095006 | All Organisms → cellular organisms → Bacteria | 686 | Open in IMG/M |
| 3300005355|Ga0070671_101135184 | Not Available | 687 | Open in IMG/M |
| 3300005356|Ga0070674_102018874 | Not Available | 525 | Open in IMG/M |
| 3300005434|Ga0070709_10601597 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 846 | Open in IMG/M |
| 3300005436|Ga0070713_100515482 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1129 | Open in IMG/M |
| 3300005451|Ga0066681_10710552 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 611 | Open in IMG/M |
| 3300005454|Ga0066687_10135064 | All Organisms → cellular organisms → Bacteria | 1288 | Open in IMG/M |
| 3300005454|Ga0066687_10487634 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 727 | Open in IMG/M |
| 3300005454|Ga0066687_10932199 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 518 | Open in IMG/M |
| 3300005458|Ga0070681_10194946 | All Organisms → cellular organisms → Bacteria | 1945 | Open in IMG/M |
| 3300005458|Ga0070681_12040840 | Not Available | 502 | Open in IMG/M |
| 3300005468|Ga0070707_101368575 | Not Available | 674 | Open in IMG/M |
| 3300005535|Ga0070684_100475829 | Not Available | 1156 | Open in IMG/M |
| 3300005542|Ga0070732_10384986 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Methylocystaceae → unclassified Methylocystaceae → Methylocystaceae bacterium | 845 | Open in IMG/M |
| 3300005556|Ga0066707_10400209 | All Organisms → cellular organisms → Bacteria | 894 | Open in IMG/M |
| 3300005576|Ga0066708_10079544 | All Organisms → cellular organisms → Bacteria | 1907 | Open in IMG/M |
| 3300005617|Ga0068859_102306012 | Not Available | 594 | Open in IMG/M |
| 3300005764|Ga0066903_106394140 | Not Available | 614 | Open in IMG/M |
| 3300005841|Ga0068863_101119269 | Not Available | 792 | Open in IMG/M |
| 3300006028|Ga0070717_11255591 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae | 674 | Open in IMG/M |
| 3300006031|Ga0066651_10253742 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 933 | Open in IMG/M |
| 3300006031|Ga0066651_10585296 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 593 | Open in IMG/M |
| 3300006046|Ga0066652_101656646 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 585 | Open in IMG/M |
| 3300006176|Ga0070765_101349919 | Not Available | 672 | Open in IMG/M |
| 3300006794|Ga0066658_10749696 | All Organisms → cellular organisms → Bacteria | 545 | Open in IMG/M |
| 3300006796|Ga0066665_10248763 | Not Available | 1406 | Open in IMG/M |
| 3300006796|Ga0066665_11045918 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 624 | Open in IMG/M |
| 3300006797|Ga0066659_10990564 | Not Available | 702 | Open in IMG/M |
| 3300006800|Ga0066660_11678612 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 506 | Open in IMG/M |
| 3300006804|Ga0079221_11780021 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 504 | Open in IMG/M |
| 3300007004|Ga0079218_11535073 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 724 | Open in IMG/M |
| 3300007076|Ga0075435_101294486 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 638 | Open in IMG/M |
| 3300007788|Ga0099795_10635509 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Salmonella → Salmonella enterica | 510 | Open in IMG/M |
| 3300009012|Ga0066710_100670038 | Not Available | 1579 | Open in IMG/M |
| 3300009012|Ga0066710_103927614 | Not Available | 557 | Open in IMG/M |
| 3300009012|Ga0066710_104114190 | Not Available | 544 | Open in IMG/M |
| 3300009088|Ga0099830_10049108 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 2969 | Open in IMG/M |
| 3300009094|Ga0111539_10094619 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 3510 | Open in IMG/M |
| 3300009137|Ga0066709_100660127 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1498 | Open in IMG/M |
| 3300009137|Ga0066709_102182633 | Not Available | 764 | Open in IMG/M |
| 3300009137|Ga0066709_103987214 | Not Available | 537 | Open in IMG/M |
| 3300009137|Ga0066709_104602017 | Not Available | 504 | Open in IMG/M |
| 3300009137|Ga0066709_104637161 | Not Available | 503 | Open in IMG/M |
| 3300009143|Ga0099792_10595954 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 704 | Open in IMG/M |
| 3300009156|Ga0111538_10095727 | All Organisms → cellular organisms → Bacteria | 3775 | Open in IMG/M |
| 3300009156|Ga0111538_13092402 | Not Available | 580 | Open in IMG/M |
| 3300009553|Ga0105249_12383917 | Not Available | 602 | Open in IMG/M |
| 3300009789|Ga0126307_10311340 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1267 | Open in IMG/M |
| 3300010037|Ga0126304_10269794 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1123 | Open in IMG/M |
| 3300010038|Ga0126315_10706592 | Not Available | 658 | Open in IMG/M |
| 3300010040|Ga0126308_10224857 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1213 | Open in IMG/M |
| 3300010335|Ga0134063_10515850 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 600 | Open in IMG/M |
| 3300012685|Ga0137397_11269737 | Not Available | 526 | Open in IMG/M |
| 3300012927|Ga0137416_11482378 | Not Available | 616 | Open in IMG/M |
| 3300012975|Ga0134110_10518877 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 544 | Open in IMG/M |
| 3300012986|Ga0164304_10423872 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 952 | Open in IMG/M |
| 3300014487|Ga0182000_10518136 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 558 | Open in IMG/M |
| 3300014968|Ga0157379_11447660 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 667 | Open in IMG/M |
| 3300015371|Ga0132258_11538421 | All Organisms → cellular organisms → Bacteria | 1680 | Open in IMG/M |
| 3300018422|Ga0190265_10625611 | Not Available | 1196 | Open in IMG/M |
| 3300020020|Ga0193738_1108171 | Not Available | 788 | Open in IMG/M |
| 3300020582|Ga0210395_10468361 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 948 | Open in IMG/M |
| 3300021388|Ga0213875_10164060 | Not Available | 1042 | Open in IMG/M |
| 3300025900|Ga0207710_10028904 | All Organisms → cellular organisms → Bacteria | 2408 | Open in IMG/M |
| 3300025901|Ga0207688_10919365 | Not Available | 554 | Open in IMG/M |
| 3300025903|Ga0207680_10461131 | Not Available | 903 | Open in IMG/M |
| 3300025912|Ga0207707_10111835 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2388 | Open in IMG/M |
| 3300025915|Ga0207693_10974564 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 648 | Open in IMG/M |
| 3300025918|Ga0207662_10458988 | Not Available | 872 | Open in IMG/M |
| 3300025921|Ga0207652_11770916 | Not Available | 523 | Open in IMG/M |
| 3300025923|Ga0207681_11820093 | Not Available | 508 | Open in IMG/M |
| 3300025930|Ga0207701_10154078 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2036 | Open in IMG/M |
| 3300025930|Ga0207701_10194544 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1784 | Open in IMG/M |
| 3300025931|Ga0207644_11139288 | Not Available | 656 | Open in IMG/M |
| 3300025936|Ga0207670_10971516 | Not Available | 714 | Open in IMG/M |
| 3300025941|Ga0207711_10360188 | Not Available | 1347 | Open in IMG/M |
| 3300026041|Ga0207639_11599595 | Not Available | 611 | Open in IMG/M |
| 3300026116|Ga0207674_10226408 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1818 | Open in IMG/M |
| 3300026329|Ga0209375_1081034 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1505 | Open in IMG/M |
| 3300026523|Ga0209808_1192474 | Not Available | 694 | Open in IMG/M |
| 3300026548|Ga0209161_10428742 | Not Available | 581 | Open in IMG/M |
| 3300027842|Ga0209580_10248527 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 884 | Open in IMG/M |
| 3300027862|Ga0209701_10726242 | Not Available | 509 | Open in IMG/M |
| 3300027907|Ga0207428_11245094 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 517 | Open in IMG/M |
| 3300028381|Ga0268264_11287739 | Not Available | 741 | Open in IMG/M |
| 3300031753|Ga0307477_10537378 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 792 | Open in IMG/M |
| 3300031754|Ga0307475_10041157 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 3423 | Open in IMG/M |
| 3300032180|Ga0307471_103661693 | Not Available | 544 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 17.65% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 7.84% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 5.88% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 5.88% |
| Corn Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere | 4.90% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 4.90% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 4.90% |
| Serpentine Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Serpentine Soil | 3.92% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 3.92% |
| Switchgrass Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere | 3.92% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 2.94% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 2.94% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 2.94% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 2.94% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 2.94% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 1.96% |
| Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 1.96% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 1.96% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Corn, Switchgrass And Miscanthus Rhizosphere | 1.96% |
| Soil | Environmental → Terrestrial → Soil → Loam → Grasslands → Soil | 1.96% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 1.96% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 1.96% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 0.98% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 0.98% |
| Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil | 0.98% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 0.98% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn, Switchgrass And Miscanthus Rhizosphere | 0.98% |
| Plant Roots | Host-Associated → Plants → Roots → Unclassified → Unclassified → Plant Roots | 0.98% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.98% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere | 0.98% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300000912 | Forest soil microbial communities from El Dorado National Forest, California, USA - Mediterranean Blodgett CA Ref_M3 | Environmental | Open in IMG/M |
| 3300002245 | Jack Pine, Ontario site 1_JW_OM2H0_M3 (Jack Pine, Ontario combined, ASSEMBLY_DATE=20131027) | Environmental | Open in IMG/M |
| 3300004153 | Grasslands soil microbial communities from Hopland, California, USA (version 2) | Environmental | Open in IMG/M |
| 3300004157 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - - Combined assembly of AARS Block 2 | Environmental | Open in IMG/M |
| 3300004479 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of All WPAs | Environmental | Open in IMG/M |
| 3300004643 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Combined assembly of AARS Block 3 | Environmental | Open in IMG/M |
| 3300005175 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_122 | Environmental | Open in IMG/M |
| 3300005176 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_128 | Environmental | Open in IMG/M |
| 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Environmental | Open in IMG/M |
| 3300005332 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Environmental | Open in IMG/M |
| 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Environmental | Open in IMG/M |
| 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Host-Associated | Open in IMG/M |
| 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Host-Associated | Open in IMG/M |
| 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Host-Associated | Open in IMG/M |
| 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Environmental | Open in IMG/M |
| 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Environmental | Open in IMG/M |
| 3300005451 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_130 | Environmental | Open in IMG/M |
| 3300005454 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_136 | Environmental | Open in IMG/M |
| 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Environmental | Open in IMG/M |
| 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Environmental | Open in IMG/M |
| 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Environmental | Open in IMG/M |
| 3300005542 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen04_05102014_R1 | Environmental | Open in IMG/M |
| 3300005556 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_156 | Environmental | Open in IMG/M |
| 3300005576 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_157 | Environmental | Open in IMG/M |
| 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Host-Associated | Open in IMG/M |
| 3300005764 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2) | Environmental | Open in IMG/M |
| 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Host-Associated | Open in IMG/M |
| 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Environmental | Open in IMG/M |
| 3300006031 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Angelo_100 | Environmental | Open in IMG/M |
| 3300006046 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_101 | Environmental | Open in IMG/M |
| 3300006176 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5 | Environmental | Open in IMG/M |
| 3300006794 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_107 | Environmental | Open in IMG/M |
| 3300006796 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_114 | Environmental | Open in IMG/M |
| 3300006797 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_108 | Environmental | Open in IMG/M |
| 3300006800 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_109 | Environmental | Open in IMG/M |
| 3300006804 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS200 | Environmental | Open in IMG/M |
| 3300007004 | Agricultural soil microbial communities from Utah to study Nitrogen management - NC Compost | Environmental | Open in IMG/M |
| 3300007076 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Host-Associated | Open in IMG/M |
| 3300007788 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 | Environmental | Open in IMG/M |
| 3300009012 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_159 | Environmental | Open in IMG/M |
| 3300009088 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H3.8 metaG | Environmental | Open in IMG/M |
| 3300009094 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) | Host-Associated | Open in IMG/M |
| 3300009137 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_158 | Environmental | Open in IMG/M |
| 3300009143 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_2 | Environmental | Open in IMG/M |
| 3300009156 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD1 (version 2) | Host-Associated | Open in IMG/M |
| 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Host-Associated | Open in IMG/M |
| 3300009789 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot28 | Environmental | Open in IMG/M |
| 3300010037 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot25 | Environmental | Open in IMG/M |
| 3300010038 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot106 | Environmental | Open in IMG/M |
| 3300010040 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot55 | Environmental | Open in IMG/M |
| 3300010335 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_5_09082015 | Environmental | Open in IMG/M |
| 3300012685 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz1.16 metaG | Environmental | Open in IMG/M |
| 3300012927 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012975 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_5_11112015 | Environmental | Open in IMG/M |
| 3300012986 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_217_MG | Environmental | Open in IMG/M |
| 3300014487 | Bulk soil microbial communities from Mexico - Magueyal (Ma) metaG | Environmental | Open in IMG/M |
| 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Host-Associated | Open in IMG/M |
| 3300015371 | Combined assembly of cpr5 and col0 rhizosphere and soil | Host-Associated | Open in IMG/M |
| 3300018422 | Populus adjacent soil microbial communities from riparian zone of Indian Creek, Utah, USA - 124 T | Environmental | Open in IMG/M |
| 3300020020 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L2a1 | Environmental | Open in IMG/M |
| 3300020582 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-4-O | Environmental | Open in IMG/M |
| 3300021388 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 | Host-Associated | Open in IMG/M |
| 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025930 | Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) | Environmental | Open in IMG/M |
| 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026329 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_131 (SPAdes) | Environmental | Open in IMG/M |
| 3300026523 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_157 (SPAdes) | Environmental | Open in IMG/M |
| 3300026548 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_155 (SPAdes) | Environmental | Open in IMG/M |
| 3300027842 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen04_05102014_R1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027862 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H3.8 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027907 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300031753 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM2C_515 | Environmental | Open in IMG/M |
| 3300031754 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_515 | Environmental | Open in IMG/M |
| 3300032180 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| JGI12032J12867_10150982 | 3300000912 | Forest Soil | MRETIDFLRKSAEDLRELALSAPDISDHLRRLADELDATATDLEQRGSATRR* |
| JGIcombinedJ26739_1008383742 | 3300002245 | Forest Soil | MRETIDFLRKSAEDLRELALSAPDISDHLRRLAEELDATASDLEQRGRATRR* |
| JGIcombinedJ26739_1009129112 | 3300002245 | Forest Soil | MRETIEFLRKXAEELRDLAATAPDISDHLRRLAEELDATADDLERPRRAS* |
| Ga0063455_1014361403 | 3300004153 | Soil | MRETIDFLRKSADELRELALSAPDISDHLRRLADELDATVA |
| Ga0062590_1015757642 | 3300004157 | Soil | MRDAIEFLRKSAEELRELASSAPDISEHLRRLADELDETAADLERGGGIPN* |
| Ga0062595_1001288292 | 3300004479 | Soil | MRETIDFLRRSAEELRDLADSAPDISDHLRRLADELDGTASDLEQRGNAPRG* |
| Ga0062595_1022532172 | 3300004479 | Soil | MRDAIEFLRNSAAELRELASSAPDISEHLRRLADELDETAADLERGGGIPN* |
| Ga0062591_1003715812 | 3300004643 | Soil | MRDAIEFLRSSAEELRELASSAPDISDHLRRLADELDATAADLERGKGIAD* |
| Ga0066673_104291621 | 3300005175 | Soil | MRETIDFLRKSAEELRDLAASAPDISDHLRRLADELDATAIDLERRGNAPRR* |
| Ga0066679_103590732 | 3300005176 | Soil | MLPVCIIIMRETIEFLRKSAEELRELAASAPDISDQLRRLAEELDATADDLERQGRRS* |
| Ga0070690_1007100632 | 3300005330 | Switchgrass Rhizosphere | LLRRSSVHKHTMRDAIDFLRNSAAELRELASSAPDISEHLRRLADELDETAADLERRGGVRN* |
| Ga0066388_1002712652 | 3300005332 | Tropical Forest Soil | MRETIDFLRRSAEELRDLADSAPDICDHLRRLADELDATASDLEGLSRAARR* |
| Ga0070691_107274241 | 3300005341 | Corn, Switchgrass And Miscanthus Rhizosphere | MRDAIDFLRNSAAELRELASSAPDISEHLRRLADELDETAADLERGGGIPN* |
| Ga0070687_1009037302 | 3300005343 | Switchgrass Rhizosphere | EFLRKSAEELRELASSAPDISEHLRRLADELDETAADLERGGGIPN* |
| Ga0070669_1010950062 | 3300005353 | Switchgrass Rhizosphere | MRDAIEFLRKSAEELRELASSAPDISGALRRLADELDSAAAEIERRGGVPN* |
| Ga0070671_1011351841 | 3300005355 | Switchgrass Rhizosphere | MRDAIDFLRNSAAELRELASSAPDISEHLRRLADELDETAADLERRGGVRN* |
| Ga0070674_1020188741 | 3300005356 | Miscanthus Rhizosphere | MRDAIEFLRNSAAELRELASSAPDISEHLRRLADELDETAADL |
| Ga0070709_106015972 | 3300005434 | Corn, Switchgrass And Miscanthus Rhizosphere | RRSAEELRDLADSAPDISDHLRRLADELDGTASDLEQRGNAPRR* |
| Ga0070713_1005154821 | 3300005436 | Corn, Switchgrass And Miscanthus Rhizosphere | ETIDFLRRSAEELRDLADSAPDISDHLRRLADELDGTASDLEQRGNAPRG* |
| Ga0066681_107105521 | 3300005451 | Soil | LRKTATELRELAAYGPDIADQLRRLADELDAAADELEDQAGKSA* |
| Ga0066687_101350642 | 3300005454 | Soil | MRETIDFLRKSAEELRELADSAPDISDHLRRLADELDATASDLEQRGNAARN* |
| Ga0066687_104876342 | 3300005454 | Soil | IEFLRKSAEELRELAASAPDISDQLRRLAEELDATADDLERQGRGS* |
| Ga0066687_109321992 | 3300005454 | Soil | MRETIDFLRKSADELRELAASAPDISDHLRRLADELDATATDLERRGNATRG* |
| Ga0070681_101949463 | 3300005458 | Corn Rhizosphere | MRDAIEFLRSSAEELRELASSAPDISEHLRRLADELDATAADLERGGGIRN* |
| Ga0070681_120408402 | 3300005458 | Corn Rhizosphere | MRDAIEFLRTSAEELRELASSAPDISDHLRRLADELDATAADLERGGGIPN* |
| Ga0070707_1013685751 | 3300005468 | Corn, Switchgrass And Miscanthus Rhizosphere | MRETIDFLRKSAEELRELAASAPDISDHLRRMAEELDATADDLERPRRSG*R |
| Ga0070684_1004758291 | 3300005535 | Corn Rhizosphere | IEFLRKSAEELRELASSATDISEHLRRLADELDETAADLERGGGIPN* |
| Ga0070732_103849863 | 3300005542 | Surface Soil | MNDAIKFLRRSAEELRELASSAPDISEQLRRLADELDEVAADLVRRGGVDG* |
| Ga0066707_104002092 | 3300005556 | Soil | MRETIEFLRKSAEELRELAASAPDISDHLRRLAEELDATADDLARQGRHS* |
| Ga0066708_100795443 | 3300005576 | Soil | MRETIDFLRKSAEELRDLAASAPDISDHLRRLADELDATAIDLERRGNAPR |
| Ga0068859_1023060122 | 3300005617 | Switchgrass Rhizosphere | SSVHTGIMRDAIEFLRTSAEELRELASSAPDISDHLRRLADELDATAADLERGGGIPN* |
| Ga0066903_1063941402 | 3300005764 | Tropical Forest Soil | MRDAIEFLRKSADELRELASSAPDISGHLHRLAEELDSTAAELERR |
| Ga0068863_1011192692 | 3300005841 | Switchgrass Rhizosphere | LLRRSSVHKHTMRDAIDFLRNSAAELRELASSAPDISEHLRRLADDLDETAADLERRGGVRN* |
| Ga0070717_112555912 | 3300006028 | Corn, Switchgrass And Miscanthus Rhizosphere | MRKSAEDLRELALSAPDISDHLRRLAEELDATATDLEHETALLAVS* |
| Ga0066651_102537422 | 3300006031 | Soil | VCIGTMRETIDFLRKSAEELRDLAASAPDISDHLRRLADELDATAIDLERRGNAPRR* |
| Ga0066651_105852962 | 3300006031 | Soil | MRETIDFLRKSADELRELALSAPDISDHLRRLAEELDATATDLERRGNATRG* |
| Ga0066652_1016566461 | 3300006046 | Soil | ETIDFLRKSAEELRDLAASAPDISDHLRRLADELDATAIDLERRGNAPRR* |
| Ga0070765_1013499192 | 3300006176 | Soil | MSETIDFLRRRAEELRELASSTPDIASQLGRLANELDAMAATLDQRRQGGP* |
| Ga0066658_107496962 | 3300006794 | Soil | MRETIEFLRKSAEELRELAASAPDISDHLRRLAEELDATADDLERPGRGSRR* |
| Ga0066665_102487633 | 3300006796 | Soil | MGETIEFLRKSAEELRELAACAPDISDHLRRLAEELDATADDLARQGRHS* |
| Ga0066665_110459182 | 3300006796 | Soil | MRETIEFLRKSAEELRELASSAPDISDHLRRLAEELDATADDLERRGRRS* |
| Ga0066659_109905641 | 3300006797 | Soil | MRETIEFLRKSAEELRELAASAPDISDHLRRLAEELDATADDLARQGRRS* |
| Ga0066660_116786121 | 3300006800 | Soil | MRETIEFLRKSAEELRELASSAPDISEQLRRLADELDAAAADLQRGTGRSP* |
| Ga0079221_117800211 | 3300006804 | Agricultural Soil | DFLRKSAEELRELAASAPDISDHLRRLADELDATAIDLERRGNAPRR* |
| Ga0079218_115350732 | 3300007004 | Agricultural Soil | MRDAIEFLRRSADELRELASSTPDISEHLRRLADELDATAADLERRGGVPN* |
| Ga0075435_1012944861 | 3300007076 | Populus Rhizosphere | SVHSGIMRDAIEFLRTSAEELRELASSAPDISDHLRRLADELDATAADLERGGGIPN* |
| Ga0099795_106355091 | 3300007788 | Vadose Zone Soil | RETIDFLRKSAEDLRELALSAPDISDHLRRLADELDATATDLEQRGSATRR* |
| Ga0066710_1006700382 | 3300009012 | Grasslands Soil | MMPVCIIIMRETIDFLRKSAEELRELASSAPDISEHLRRLAEELDGTADDLERRGRSS |
| Ga0066710_1039276141 | 3300009012 | Grasslands Soil | MRETIDFLRKSADELRELALSAPDISDHLRRLADELDATVADLERRGSGTRG |
| Ga0066710_1041141902 | 3300009012 | Grasslands Soil | MRKSAEELRDLASSAPDISDQLRRLADELDATASELERRPGRAP |
| Ga0099830_100491084 | 3300009088 | Vadose Zone Soil | MRETIEFLRKSAEELRELAASATDISDHLRRLAEELDATADDLERRGRGS* |
| Ga0111539_100946193 | 3300009094 | Populus Rhizosphere | MRDAIEFLRKSAEELRDLASSAPDISDHLRRLADELDTTAADLERGGGIPN* |
| Ga0066709_1006601272 | 3300009137 | Grasslands Soil | MRKSAEELRDLASSAPDISDQLRRLADELDATASELERRPGRAP* |
| Ga0066709_1021826333 | 3300009137 | Grasslands Soil | MRDAVEFLRRTAEELRELAANGPDIADQLRRLANELDAAADELEDQAGKTG* |
| Ga0066709_1039872141 | 3300009137 | Grasslands Soil | MRDAIEFLRKTATELRELAAYGPDIADQLRRLADELDAAADELEDQAGKSA* |
| Ga0066709_1046020171 | 3300009137 | Grasslands Soil | PVCISIMRETIEFLRKSAEELRELAASAPDISDHLRRLAEELDATADDLARQGRRS* |
| Ga0066709_1046371613 | 3300009137 | Grasslands Soil | MRETIDFLRKSADELRELALSAPDISDHLRRLADELDATVADLERRGSGTRG* |
| Ga0099792_105959543 | 3300009143 | Vadose Zone Soil | MRETIDFLRKSADELRELALSAPDISDHLRRLADELDATVADLEQRGSGTRG* |
| Ga0111538_100957273 | 3300009156 | Populus Rhizosphere | MRDAIEFLRSSAEELRELASSAPDISDHLRRLADELDTTAADLERGGGIPN* |
| Ga0111538_130924022 | 3300009156 | Populus Rhizosphere | MRDAIEFLRNSAEELRELASSAPDISDHLRRLADEL |
| Ga0105249_123839171 | 3300009553 | Switchgrass Rhizosphere | MRDAIDFLRNSAAELRELASSAPDISEHLRRLADDLDETAADLERRGGVRN* |
| Ga0126307_103113402 | 3300009789 | Serpentine Soil | MRDAIEFLRKSADELRELASSAPDISEHLRRLADELDATAADLERRGGVPN* |
| Ga0126304_102697942 | 3300010037 | Serpentine Soil | MRDAIEFLRKSADELRELASSAPDISEHLRRLAEELDATAADLERRGGVPN* |
| Ga0126315_107065921 | 3300010038 | Serpentine Soil | MRDAIEFLRKSAEELRELASSAPDISDNLRRLADELDATA |
| Ga0126308_102248572 | 3300010040 | Serpentine Soil | MRDAIEFLRKSADELRELASTAPDISEHLRRLAEELDATAADLERRGGVPN* |
| Ga0134063_105158502 | 3300010335 | Grasslands Soil | FLRRSAEELRDLAESAPDISDHLRRLADELDATASDLEQRGNAPRG* |
| Ga0137397_112697371 | 3300012685 | Vadose Zone Soil | MRETIDFLRRSAEELRDLAESAPDISDHLRRLADELDATASDLEQR |
| Ga0137416_114823781 | 3300012927 | Vadose Zone Soil | MRETIDFLRKSAEELRQLAASAPDISDHLRRLAEELDATADDLERPRRSS* |
| Ga0134110_105188771 | 3300012975 | Grasslands Soil | LRRSAEELRDLAESAPDISDHLRRLADELDATASDLEQRGNAPRG* |
| Ga0164304_104238722 | 3300012986 | Soil | MRETIDFLRRSAEELRDLAESAPDISDHLRRLADELDGTASDLEQRGNAPRR* |
| Ga0182000_105181362 | 3300014487 | Soil | DFLRRSAEELRDLADSAPDISDHLRRLADELDGTASDLEQRGNARRG* |
| Ga0157379_114476601 | 3300014968 | Switchgrass Rhizosphere | MRDAIEFLRNSAKELRELASSAPDISDHLRRLADELDATAADLERGGGIPN* |
| Ga0132258_115384213 | 3300015371 | Arabidopsis Rhizosphere | MRDAIEFLRKSADELRELASSAPDISAHLYRLAEELDSTAAELEHRGGVPN* |
| Ga0190265_106256112 | 3300018422 | Soil | MRDAIEFLRQSAEELRELASSAPDISDHLRRLADELDATAADLERGGGIPN |
| Ga0193738_11081711 | 3300020020 | Soil | MTDAIEFLRRSAEELRELASSAPDISDQLRQLADELDATAAELEQRGGVPI |
| Ga0210395_104683612 | 3300020582 | Soil | MSETIDFLRRRAEELRELASSTPDIASQLGRLANELDAMAATLDQRRQGGP |
| Ga0213875_101640602 | 3300021388 | Plant Roots | MRQAIDFLRQSADELRNMASSAPDISDQLRRLAEELDATASHIENGRGAVP |
| Ga0207710_100289042 | 3300025900 | Switchgrass Rhizosphere | MRDAIEFLRNSAAELRELASSAPDISEHLRRLADELDETAADLERGGGIPN |
| Ga0207688_109193652 | 3300025901 | Corn, Switchgrass And Miscanthus Rhizosphere | MRDAIEFLRTSAEELRELASSAPDISDHLRRLADELDATAADLERGGGIPN |
| Ga0207680_104611312 | 3300025903 | Switchgrass Rhizosphere | MRDAIEFLRTSAEELRELASSAPDISDHLRRLADELDATSADLERGGGIPN |
| Ga0207707_101118353 | 3300025912 | Corn Rhizosphere | MRDAIEFLRSSAEELRELASSAPDISEHLRRLADELDATAADLERGGGIRN |
| Ga0207693_109745641 | 3300025915 | Corn, Switchgrass And Miscanthus Rhizosphere | MRETIDFLRRSAEELRDLAESAPDISDHLRRLADELDATASDLEQRGNAPRG |
| Ga0207662_104589881 | 3300025918 | Switchgrass Rhizosphere | MRDAIEFLRKSAEELRELASSAPDISEHLRRLADELDETAADLERGGGIPN |
| Ga0207652_117709162 | 3300025921 | Corn Rhizosphere | MRDAIEFLRQSAEELRALASSAPDISEHLRRLADELDETAADLERGGGIPN |
| Ga0207681_118200931 | 3300025923 | Switchgrass Rhizosphere | MRDAIEFLRNSAAELRELASSAPDISEHLRRLADELDETAADLERRGGVRN |
| Ga0207701_101540782 | 3300025930 | Corn, Switchgrass And Miscanthus Rhizosphere | MRDAIEFLRSSAEELRELASSAPDISDHLRRLADELDATAADLERGKGIAD |
| Ga0207701_101945442 | 3300025930 | Corn, Switchgrass And Miscanthus Rhizosphere | MRDAIEFLRNSAAELRELASSAPDISEHLRRLADDLDETAADLERRGGVRN |
| Ga0207644_111392881 | 3300025931 | Switchgrass Rhizosphere | FLRNSAAELRELASSAPDISEHLRRLADELDETAADLERGGGVPN |
| Ga0207670_109715162 | 3300025936 | Switchgrass Rhizosphere | RLSSVHCGIMRDAIEFLRKSAEELRELASSAPDISGALRRLADELDSAAAEIERRGGVPN |
| Ga0207711_103601882 | 3300025941 | Switchgrass Rhizosphere | MRDAIEFLRNSAAELRELASSAPDISEHLRRLADELDETAADLERGGGVPN |
| Ga0207639_115995952 | 3300026041 | Corn Rhizosphere | MRDAIEFLRTSAEELRGLASSAPDISDHLRRLADELDATAADLERGGGIPN |
| Ga0207674_102264081 | 3300026116 | Corn Rhizosphere | MRETIDFLRRSAEELRDLADSAPDISDHLRRLADELDGTASDLEQRGNAPR |
| Ga0209375_10810343 | 3300026329 | Soil | MRETIDFLRRSAEELRDLAELAPDISDHLRRLADELDATASDLEQRGNAPRG |
| Ga0209808_11924742 | 3300026523 | Soil | MRETIDFLRKSAEELRDLAASAPDISDHLRRLADELDATAIDLERR |
| Ga0209161_104287422 | 3300026548 | Soil | MRETIEFLRKSAEELRELAASAPDISDHLRRLAEELDATADDLARQGRRS |
| Ga0209580_102485272 | 3300027842 | Surface Soil | MNDAIKFLRRSAEELRELASSAPDISEQLRRLADELDEVAADLVRRGGVDG |
| Ga0209701_107262421 | 3300027862 | Vadose Zone Soil | LRNSLSLLPVCIDTMRETIEFLRKSAEELRELAASATDISDHLRRLAEELDATADDLERRGRGS |
| Ga0207428_112450942 | 3300027907 | Populus Rhizosphere | MRDAIEFLRKSAEELRDLASSAPDISDHLRRLADELDTTAADLERGGGIPN |
| Ga0268264_112877392 | 3300028381 | Switchgrass Rhizosphere | MRDAIDFLRNSAAELRELASSAPDISEHLRRLADELDETAADLERRGGVRN |
| Ga0307477_105373782 | 3300031753 | Hardwood Forest Soil | MSDTIAFLRESAEELRDMASSTPDISDQLQRLADELDATAADLERRGGRVP |
| Ga0307475_100411574 | 3300031754 | Hardwood Forest Soil | MRETIDFLRKSAEELRDLAASAPDISSYLRQLADELDMTAADLERRGKPTRC |
| Ga0307471_1036616931 | 3300032180 | Hardwood Forest Soil | MRDAIEFLRKSADELRELASSAPDISGHLYRLAEELDSTAAELERRGGVPN |
| ⦗Top⦘ |