| Basic Information | |
|---|---|
| Family ID | F101533 |
| Family Type | Metagenome |
| Number of Sequences | 102 |
| Average Sequence Length | 45 residues |
| Representative Sequence | MKVRGTTAGTPFGAKLTALCWGALTLLAPVAVSACTSSSST |
| Number of Associated Samples | 98 |
| Number of Associated Scaffolds | 102 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | No |
| Most common taxonomic group | Unclassified |
| % of genes with valid RBS motifs | 100.00 % |
| % of genes near scaffold ends (potentially truncated) | 91.18 % |
| % of genes from short scaffolds (< 2000 bps) | 88.24 % |
| Associated GOLD sequencing projects | 94 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.38 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Unclassified (51.961 % of family members) |
| NCBI Taxonomy ID | N/A |
| Taxonomy | N/A |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil (32.353 % of family members) |
| Environment Ontology (ENVO) | Unclassified (26.471 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (41.176 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | Yes | Secondary Structure distribution: | α-helix: 40.58% β-sheet: 0.00% Coil/Unstructured: 59.42% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.38 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 102 Family Scaffolds |
|---|---|---|
| PF04203 | Sortase | 33.33 |
| PF03551 | PadR | 2.94 |
| PF01351 | RNase_HII | 2.94 |
| PF03450 | CO_deh_flav_C | 1.96 |
| PF01326 | PPDK_N | 0.98 |
| PF01678 | DAP_epimerase | 0.98 |
| PF14236 | DUF4338 | 0.98 |
| COG ID | Name | Functional Category | % Frequency in 102 Family Scaffolds |
|---|---|---|---|
| COG3764 | Sortase (surface protein transpeptidase) | Cell wall/membrane/envelope biogenesis [M] | 33.33 |
| COG0164 | Ribonuclease HII | Replication, recombination and repair [L] | 2.94 |
| COG1039 | Ribonuclease HIII | Replication, recombination and repair [L] | 2.94 |
| COG1695 | DNA-binding transcriptional regulator, PadR family | Transcription [K] | 2.94 |
| COG1733 | DNA-binding transcriptional regulator, HxlR family | Transcription [K] | 2.94 |
| COG1846 | DNA-binding transcriptional regulator, MarR family | Transcription [K] | 2.94 |
| COG0253 | Diaminopimelate epimerase | Amino acid transport and metabolism [E] | 0.98 |
| COG0574 | Phosphoenolpyruvate synthase/pyruvate phosphate dikinase | Carbohydrate transport and metabolism [G] | 0.98 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| Unclassified | root | N/A | 51.96 % |
| All Organisms | root | All Organisms | 48.04 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300005164|Ga0066815_10019990 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 927 | Open in IMG/M |
| 3300005175|Ga0066673_10525976 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 695 | Open in IMG/M |
| 3300005181|Ga0066678_10651839 | Not Available | 701 | Open in IMG/M |
| 3300005435|Ga0070714_101535299 | Not Available | 650 | Open in IMG/M |
| 3300005435|Ga0070714_102052305 | Not Available | 557 | Open in IMG/M |
| 3300005437|Ga0070710_10939426 | Not Available | 626 | Open in IMG/M |
| 3300005439|Ga0070711_100465564 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1037 | Open in IMG/M |
| 3300005467|Ga0070706_101409475 | Not Available | 638 | Open in IMG/M |
| 3300005557|Ga0066704_10906819 | Not Available | 545 | Open in IMG/M |
| 3300005564|Ga0070664_101729937 | Not Available | 593 | Open in IMG/M |
| 3300006050|Ga0075028_100737588 | Not Available | 596 | Open in IMG/M |
| 3300006059|Ga0075017_100563469 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 868 | Open in IMG/M |
| 3300006176|Ga0070765_101683934 | Not Available | 596 | Open in IMG/M |
| 3300006854|Ga0075425_100381026 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales | 1624 | Open in IMG/M |
| 3300006854|Ga0075425_101692047 | Not Available | 712 | Open in IMG/M |
| 3300007076|Ga0075435_101357542 | Not Available | 623 | Open in IMG/M |
| 3300007788|Ga0099795_10064699 | All Organisms → cellular organisms → Bacteria | 1366 | Open in IMG/M |
| 3300009093|Ga0105240_11020691 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 884 | Open in IMG/M |
| 3300009522|Ga0116218_1157822 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1029 | Open in IMG/M |
| 3300009672|Ga0116215_1495519 | Not Available | 528 | Open in IMG/M |
| 3300009698|Ga0116216_10906261 | Not Available | 527 | Open in IMG/M |
| 3300010048|Ga0126373_12439444 | Not Available | 582 | Open in IMG/M |
| 3300012189|Ga0137388_10173595 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1927 | Open in IMG/M |
| 3300012207|Ga0137381_10290499 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1423 | Open in IMG/M |
| 3300012209|Ga0137379_10208172 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1870 | Open in IMG/M |
| 3300012211|Ga0137377_10532770 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1112 | Open in IMG/M |
| 3300012350|Ga0137372_10306466 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1229 | Open in IMG/M |
| 3300012478|Ga0157328_1002669 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 877 | Open in IMG/M |
| 3300012497|Ga0157319_1006437 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 843 | Open in IMG/M |
| 3300012929|Ga0137404_10356608 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1281 | Open in IMG/M |
| 3300012960|Ga0164301_10527957 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 857 | Open in IMG/M |
| 3300012960|Ga0164301_10817758 | Not Available | 714 | Open in IMG/M |
| 3300014969|Ga0157376_11733070 | Not Available | 660 | Open in IMG/M |
| 3300015372|Ga0132256_103185461 | Not Available | 552 | Open in IMG/M |
| 3300016319|Ga0182033_11064271 | Not Available | 721 | Open in IMG/M |
| 3300016404|Ga0182037_11130444 | Not Available | 686 | Open in IMG/M |
| 3300017959|Ga0187779_10041126 | Not Available | 2681 | Open in IMG/M |
| 3300018058|Ga0187766_10139707 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1497 | Open in IMG/M |
| 3300018086|Ga0187769_11187534 | Not Available | 577 | Open in IMG/M |
| 3300019890|Ga0193728_1138007 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1086 | Open in IMG/M |
| 3300020582|Ga0210395_10796843 | Not Available | 704 | Open in IMG/M |
| 3300020583|Ga0210401_10270282 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1560 | Open in IMG/M |
| 3300021171|Ga0210405_10251644 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1398 | Open in IMG/M |
| 3300021181|Ga0210388_10243811 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1577 | Open in IMG/M |
| 3300021407|Ga0210383_11672804 | Not Available | 522 | Open in IMG/M |
| 3300021432|Ga0210384_11403179 | Not Available | 604 | Open in IMG/M |
| 3300021474|Ga0210390_11156543 | Not Available | 626 | Open in IMG/M |
| 3300021478|Ga0210402_10934892 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 794 | Open in IMG/M |
| 3300024222|Ga0247691_1025293 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 920 | Open in IMG/M |
| 3300024225|Ga0224572_1014777 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1492 | Open in IMG/M |
| 3300024245|Ga0247677_1003021 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 2141 | Open in IMG/M |
| 3300025921|Ga0207652_11730093 | Not Available | 530 | Open in IMG/M |
| 3300025928|Ga0207700_10133741 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2028 | Open in IMG/M |
| 3300025929|Ga0207664_11201912 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 676 | Open in IMG/M |
| 3300025934|Ga0207686_10052749 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2539 | Open in IMG/M |
| 3300025972|Ga0207668_11074416 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 721 | Open in IMG/M |
| 3300026557|Ga0179587_10211674 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1231 | Open in IMG/M |
| 3300027662|Ga0208565_1174503 | Not Available | 619 | Open in IMG/M |
| 3300027662|Ga0208565_1186751 | Not Available | 594 | Open in IMG/M |
| 3300027725|Ga0209178_1147030 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 812 | Open in IMG/M |
| 3300027812|Ga0209656_10145769 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1192 | Open in IMG/M |
| 3300027898|Ga0209067_10405070 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 764 | Open in IMG/M |
| 3300028072|Ga0247675_1002028 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2594 | Open in IMG/M |
| 3300028720|Ga0307317_10052598 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1307 | Open in IMG/M |
| 3300028906|Ga0308309_11025763 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 714 | Open in IMG/M |
| 3300030494|Ga0310037_10105179 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1306 | Open in IMG/M |
| 3300031545|Ga0318541_10770589 | Not Available | 537 | Open in IMG/M |
| 3300031572|Ga0318515_10098218 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1533 | Open in IMG/M |
| 3300031668|Ga0318542_10169655 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1091 | Open in IMG/M |
| 3300031680|Ga0318574_10732810 | Not Available | 579 | Open in IMG/M |
| 3300031681|Ga0318572_10813854 | Not Available | 555 | Open in IMG/M |
| 3300031718|Ga0307474_11216100 | Not Available | 596 | Open in IMG/M |
| 3300031719|Ga0306917_11213535 | Not Available | 585 | Open in IMG/M |
| 3300031720|Ga0307469_12123181 | Not Available | 546 | Open in IMG/M |
| 3300031751|Ga0318494_10811691 | Not Available | 548 | Open in IMG/M |
| 3300031765|Ga0318554_10704877 | Not Available | 566 | Open in IMG/M |
| 3300031770|Ga0318521_10160195 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1282 | Open in IMG/M |
| 3300031777|Ga0318543_10488488 | Not Available | 552 | Open in IMG/M |
| 3300031780|Ga0318508_1182845 | Not Available | 599 | Open in IMG/M |
| 3300031819|Ga0318568_10186415 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1277 | Open in IMG/M |
| 3300031835|Ga0318517_10187928 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 929 | Open in IMG/M |
| 3300031845|Ga0318511_10454083 | Not Available | 590 | Open in IMG/M |
| 3300031897|Ga0318520_10675984 | Not Available | 644 | Open in IMG/M |
| 3300031912|Ga0306921_10381856 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1646 | Open in IMG/M |
| 3300032008|Ga0318562_10464525 | Not Available | 734 | Open in IMG/M |
| 3300032009|Ga0318563_10466909 | Not Available | 682 | Open in IMG/M |
| 3300032063|Ga0318504_10425613 | Not Available | 634 | Open in IMG/M |
| 3300032064|Ga0318510_10417200 | Not Available | 573 | Open in IMG/M |
| 3300032065|Ga0318513_10474300 | Not Available | 612 | Open in IMG/M |
| 3300032094|Ga0318540_10204879 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 951 | Open in IMG/M |
| 3300032205|Ga0307472_100953008 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 799 | Open in IMG/M |
| 3300032770|Ga0335085_10639487 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1191 | Open in IMG/M |
| 3300032782|Ga0335082_10447297 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1155 | Open in IMG/M |
| 3300032898|Ga0335072_11712324 | Not Available | 524 | Open in IMG/M |
| 3300032955|Ga0335076_10854723 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 791 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 32.35% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 7.84% |
| Peatlands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil | 7.84% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 4.90% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 3.92% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 3.92% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 3.92% |
| Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 2.94% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 2.94% |
| Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 2.94% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Agricultural Soil | 2.94% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 2.94% |
| Bog Forest Soil | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil | 1.96% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 1.96% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 1.96% |
| Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil | 1.96% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Rhizosphere | 1.96% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 0.98% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 0.98% |
| Soil | Environmental → Terrestrial → Soil → Loam → Grasslands → Soil | 0.98% |
| Corn Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere | 0.98% |
| Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere | 0.98% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.98% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 0.98% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.98% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 0.98% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere | 0.98% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Arabidopsis Rhizosphere | 0.98% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300003219 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP12_OM3 | Environmental | Open in IMG/M |
| 3300005164 | Soil and rhizosphere microbial communities from Laval, Canada - mgLAC | Environmental | Open in IMG/M |
| 3300005175 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_122 | Environmental | Open in IMG/M |
| 3300005181 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_127 | Environmental | Open in IMG/M |
| 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Environmental | Open in IMG/M |
| 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Environmental | Open in IMG/M |
| 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Environmental | Open in IMG/M |
| 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Environmental | Open in IMG/M |
| 3300005557 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_153 | Environmental | Open in IMG/M |
| 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Host-Associated | Open in IMG/M |
| 3300006050 | Freshwater sediment microbial communities from Pennsylvania, USA - Little Laurel Run_MetaG_LLR_2014 | Environmental | Open in IMG/M |
| 3300006059 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Alex Branch Run_MetaG_ABR_2012 | Environmental | Open in IMG/M |
| 3300006176 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5 | Environmental | Open in IMG/M |
| 3300006854 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD4 | Host-Associated | Open in IMG/M |
| 3300007076 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Host-Associated | Open in IMG/M |
| 3300007788 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 | Environmental | Open in IMG/M |
| 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Host-Associated | Open in IMG/M |
| 3300009522 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_5_LS metaG | Environmental | Open in IMG/M |
| 3300009672 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_2_FS metaG | Environmental | Open in IMG/M |
| 3300009698 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_3_AS metaG | Environmental | Open in IMG/M |
| 3300009792 | Tropical forest soil microbial communities from Panama - MetaG Plot_12 | Environmental | Open in IMG/M |
| 3300010048 | Tropical forest soil microbial communities from Panama - MetaG Plot_11 | Environmental | Open in IMG/M |
| 3300012189 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4A metaG | Environmental | Open in IMG/M |
| 3300012207 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_115_16 metaG | Environmental | Open in IMG/M |
| 3300012209 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_80_16 metaG | Environmental | Open in IMG/M |
| 3300012211 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_40_16 metaG | Environmental | Open in IMG/M |
| 3300012350 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_60_16 metaG | Environmental | Open in IMG/M |
| 3300012478 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.9.old.080610 | Host-Associated | Open in IMG/M |
| 3300012497 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.2.old.240510 | Host-Associated | Open in IMG/M |
| 3300012929 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012960 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_231_MG | Environmental | Open in IMG/M |
| 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Host-Associated | Open in IMG/M |
| 3300015372 | Soil combined assembly | Host-Associated | Open in IMG/M |
| 3300016319 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.00H | Environmental | Open in IMG/M |
| 3300016404 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082 | Environmental | Open in IMG/M |
| 3300017959 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP10_10_MG | Environmental | Open in IMG/M |
| 3300018058 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_QUI02_MP05_20_MG | Environmental | Open in IMG/M |
| 3300018086 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP02_10_MG | Environmental | Open in IMG/M |
| 3300019890 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U1c1 | Environmental | Open in IMG/M |
| 3300020582 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-4-O | Environmental | Open in IMG/M |
| 3300020583 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-M | Environmental | Open in IMG/M |
| 3300021171 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-11-M | Environmental | Open in IMG/M |
| 3300021181 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-O | Environmental | Open in IMG/M |
| 3300021407 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-O | Environmental | Open in IMG/M |
| 3300021432 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-M | Environmental | Open in IMG/M |
| 3300021474 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-11-O | Environmental | Open in IMG/M |
| 3300021478 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-M | Environmental | Open in IMG/M |
| 3300024222 | Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK32 | Environmental | Open in IMG/M |
| 3300024225 | Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic ? CZU5 | Host-Associated | Open in IMG/M |
| 3300024245 | Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK18 | Environmental | Open in IMG/M |
| 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026557 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_08_16fungal | Environmental | Open in IMG/M |
| 3300027662 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_2_FS metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027696 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_b_LC metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027725 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS200 (SPAdes) | Environmental | Open in IMG/M |
| 3300027812 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP12_OM2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027898 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2013 (SPAdes) | Environmental | Open in IMG/M |
| 3300028072 | Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK16 | Environmental | Open in IMG/M |
| 3300028720 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_357 | Environmental | Open in IMG/M |
| 3300028906 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5 (v2) | Environmental | Open in IMG/M |
| 3300030494 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_3_AS metaG (v2) | Environmental | Open in IMG/M |
| 3300031545 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.166b4f26 | Environmental | Open in IMG/M |
| 3300031546 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.166b4f23 | Environmental | Open in IMG/M |
| 3300031572 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f19 | Environmental | Open in IMG/M |
| 3300031668 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.168b4f23 | Environmental | Open in IMG/M |
| 3300031680 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f22 | Environmental | Open in IMG/M |
| 3300031681 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f20 | Environmental | Open in IMG/M |
| 3300031718 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_05 | Environmental | Open in IMG/M |
| 3300031719 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.000 (v2) | Environmental | Open in IMG/M |
| 3300031720 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM2C_515 | Environmental | Open in IMG/M |
| 3300031751 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.108b1f24 | Environmental | Open in IMG/M |
| 3300031765 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f22 | Environmental | Open in IMG/M |
| 3300031770 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f17 | Environmental | Open in IMG/M |
| 3300031777 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.168b4f24 | Environmental | Open in IMG/M |
| 3300031780 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f21 | Environmental | Open in IMG/M |
| 3300031819 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f21 | Environmental | Open in IMG/M |
| 3300031835 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f21 | Environmental | Open in IMG/M |
| 3300031845 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.171b2f18 | Environmental | Open in IMG/M |
| 3300031880 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.168b4f25 | Environmental | Open in IMG/M |
| 3300031897 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f16 | Environmental | Open in IMG/M |
| 3300031912 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080 (v2) | Environmental | Open in IMG/M |
| 3300032008 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.066b5f18 | Environmental | Open in IMG/M |
| 3300032009 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.066b5f19 | Environmental | Open in IMG/M |
| 3300032063 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f17 | Environmental | Open in IMG/M |
| 3300032064 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.171b2f17 | Environmental | Open in IMG/M |
| 3300032065 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.171b2f20 | Environmental | Open in IMG/M |
| 3300032076 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111 (v2) | Environmental | Open in IMG/M |
| 3300032094 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.166b4f25 | Environmental | Open in IMG/M |
| 3300032160 | Sb_50d combined assembly (MetaSPAdes) | Environmental | Open in IMG/M |
| 3300032205 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_05 | Environmental | Open in IMG/M |
| 3300032770 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.5 | Environmental | Open in IMG/M |
| 3300032782 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.1 | Environmental | Open in IMG/M |
| 3300032898 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.1 | Environmental | Open in IMG/M |
| 3300032955 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.5 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| JGI26341J46601_100946311 | 3300003219 | Bog Forest Soil | MKVRTTTAGAARRARLTALSWGALTLLAPVAVSACSGSASTPNVPTFTPSVSISGTVTAPGS |
| Ga0066815_100199901 | 3300005164 | Soil | MKVRGATAGTPFGARLTALCWGALTLLAPVAVSACTSSTSTTTPTVIS |
| Ga0066673_105259761 | 3300005175 | Soil | MKVRGATTGTPFGARLTALCWGALTLLVPVAVSACTSSSST |
| Ga0066678_106518392 | 3300005181 | Soil | MKVRTTIAGTALSARLTAVCWGALTLLAPAAVSACTSSSSS |
| Ga0070714_1015352991 | 3300005435 | Agricultural Soil | MKVRGTTAGTPFGAKLAALCWGALTLLAPVAVSACTSSSSTSPT |
| Ga0070714_1020523052 | 3300005435 | Agricultural Soil | MKVRGTTAGTPFGAKLTALCWGALTLLAPVAVSACTSSSSTSPTI |
| Ga0070710_109394262 | 3300005437 | Corn, Switchgrass And Miscanthus Rhizosphere | MKVRGTTAGAPLGAKLTALCWGALTLLAPVAVSACTSGSSSSPTIISPT |
| Ga0070711_1004655641 | 3300005439 | Corn, Switchgrass And Miscanthus Rhizosphere | MKVRGAIAGRPLGARLTALCWGALILLAPVAVSACTSGSSTSTPTVPT |
| Ga0070706_1014094752 | 3300005467 | Corn, Switchgrass And Miscanthus Rhizosphere | MKVRGTTASTPFGAKLTAVCWGALTLLVPVAVSACTSGSSSSPTIIAPTV |
| Ga0066704_109068192 | 3300005557 | Soil | MKVRGMTAGTTFGAKLTVLGWGALTLLAPVAISACTSSSSSST |
| Ga0070664_1017299373 | 3300005564 | Corn Rhizosphere | MKVRGTTLGVKLTALCWGALALLAPVALAACSSSSP |
| Ga0075028_1007375881 | 3300006050 | Watersheds | MKVQTTVAGTALRARLSALCWGALIILAPVAVSACSGSSSTP |
| Ga0075017_1005634692 | 3300006059 | Watersheds | MKVRTTIAGTAFRARLTAVCWGALTLLAPVAVSACSGSTSTP |
| Ga0070765_1016839343 | 3300006176 | Soil | MKVRTTRAGTALGARLTAICWGALVLLALATVSAC |
| Ga0075425_1003810263 | 3300006854 | Populus Rhizosphere | MKVRGTTAGAPFGAKLTALCWGALTLLAPVTVSACTSGSSSSPTIIAP |
| Ga0075425_1016920471 | 3300006854 | Populus Rhizosphere | MKVRGTIAGTPLGATLTALCWGALALLAPVALSACTSSTSTTPPTVFS |
| Ga0075435_1013575422 | 3300007076 | Populus Rhizosphere | MKVRGTTVGTPFGAKLTALCWGALTLLAPVTVSACTSGSSSSPTIISPTVTSST |
| Ga0099795_100646993 | 3300007788 | Vadose Zone Soil | MKVRGTTAGTPFGTRLTALCWAALALLGPVAVSACTSSSSTPTIISPTL |
| Ga0105240_110206911 | 3300009093 | Corn Rhizosphere | MKVRGATTGTPFGARLTVLCWGALTLLAPVAVSACTSSSSTTTPTVFS |
| Ga0116218_11578221 | 3300009522 | Peatlands Soil | MKVCTTFAGTALRARLTALCWGALTLLAPVAVSACSGSSTSPTIPTFT |
| Ga0116215_14955192 | 3300009672 | Peatlands Soil | MKVCTTFAGTALRARLTALCWGALTLLAPVAVSACSGSST |
| Ga0116216_109062611 | 3300009698 | Peatlands Soil | MKVCTTFAGTALRARLTALCWGALTLLAPVAVSACSG |
| Ga0126374_102500921 | 3300009792 | Tropical Forest Soil | MKVRGATTGTPFGARLTALCWGALTLLVPVAVAACTSSPSTSTPTVFSPSVTSPGTG |
| Ga0126373_124394442 | 3300010048 | Tropical Forest Soil | MKVRGTTAGTPLSAKLIALCWGALTLLVPVAVSACTSSTTTTTP |
| Ga0137388_101735951 | 3300012189 | Vadose Zone Soil | MKVRRTTTATALGTRLTALCWGALTLIAPVAVSACTSG |
| Ga0137381_102904991 | 3300012207 | Vadose Zone Soil | MKGRGTTLGARLTALCWGALTLLAPVAVTACTSSS |
| Ga0137379_102081721 | 3300012209 | Vadose Zone Soil | MKVRRTTMAMALGTRLTALCWGALTLIAPVAVSACTSGSSTP |
| Ga0137377_105327702 | 3300012211 | Vadose Zone Soil | MKVRGTTAGTPFGAKLTALCWGALTLLAPVAISACT |
| Ga0137372_103064662 | 3300012350 | Vadose Zone Soil | MKVRGTIAGRPIGARLTALCWSALILLAPVAVSACTSSSSSTTPVFTPSVTTSA |
| Ga0157328_10026692 | 3300012478 | Arabidopsis Rhizosphere | MKVRGATTGTPFAARLTALCWGALTLLAPVAVSACTSSSSTTTPT |
| Ga0157319_10064371 | 3300012497 | Arabidopsis Rhizosphere | MKVRGTTLGVKLTALCWGALTLLAPVALAACTSSPSTTAPTVPTF |
| Ga0137404_103566081 | 3300012929 | Vadose Zone Soil | MKVRGTTAGTPFGARLTALCWGALTLLAPVAVSACTSSSSSTTRTIISPTVTN |
| Ga0164301_105279571 | 3300012960 | Soil | MKVRGATTGTPFAARLTALCWGALTLLAPVAISACTSSSST |
| Ga0164301_108177581 | 3300012960 | Soil | MKVRGTTAGTPFGAKLTALCWGALTLLAPVTVSACTSGSSSSPTII* |
| Ga0157376_117330701 | 3300014969 | Miscanthus Rhizosphere | MKVRGTTAGTPFGAKLTALCWGALTLLAPVAVSACTSGSSSSP |
| Ga0132256_1031854612 | 3300015372 | Arabidopsis Rhizosphere | MKVRGATAGTPFGARLTALCWGALTLLVPVAVSACTSSSS |
| Ga0182033_110642712 | 3300016319 | Soil | MKVRGTIAGTPLSAKLTVLCWGVLTLLVPLAVSACTSGT |
| Ga0182037_111304442 | 3300016404 | Soil | MKVRGTIAGTPLSAKLTVLCWGALTLLVPMAVSACTSG |
| Ga0187779_100411261 | 3300017959 | Tropical Peatland | MKVRTTTGGTPLGARLTVVCWGALTLLVPVTVSACSG |
| Ga0187766_101397073 | 3300018058 | Tropical Peatland | MKVRITIPGTALGARLTALCWGALTLVALVAVSACSGSSTSSPGVP |
| Ga0187769_111875342 | 3300018086 | Tropical Peatland | MKVRIAIPGTALGARLTALCWGALTLVALVAVSACSGSSSTPTVPTFSPSVTISGSGTATAP |
| Ga0193728_11380071 | 3300019890 | Soil | MKVRGATTSTPFGARLTALCWGALTLLAPVAVSAC |
| Ga0210395_107968432 | 3300020582 | Soil | MKVRTTIAGTAFRAKLTALCWGALTILAPVAVSACSGSTSTPTVPNLSPTLI |
| Ga0210401_102702823 | 3300020583 | Soil | MKVRGTTAGTPFGAKLTALCWGALTLLAPVAVSACTSGSSSSPTIISPTV |
| Ga0210405_102516441 | 3300021171 | Soil | MKLRGTTAGTPFGAKLTALCWAALTLFAPVALSACTSSSPTTPTIISPTLTNS |
| Ga0210388_102438111 | 3300021181 | Soil | MKVRTTRAGTALGARLTAICWGALVLLALATVSACSGGSSSTPNVPSPPTSVTSPG |
| Ga0210383_116728041 | 3300021407 | Soil | MKVRTTIAGTALRARLTALCWGALIILAPLAVSACSGSTSTPTVPSFS |
| Ga0210384_114031791 | 3300021432 | Soil | MKVRTTIAGAAFRAKLTAVCWGALTILAPVAVSACSGSTSTPTVPNLS |
| Ga0210390_111565432 | 3300021474 | Soil | MKVRTTRAGTALGARLTAICWGALVLLALATVSACSGSGSTAPNI |
| Ga0210402_109348922 | 3300021478 | Soil | MKVRTTRAGTALGARLTAICWGALALLALATVSACSGSAS |
| Ga0247691_10252932 | 3300024222 | Soil | MKVRGATTGTPFAARLTALCWGALTLLAPVAISACTSSS |
| Ga0224572_10147771 | 3300024225 | Rhizosphere | MKVRTTIAGTAFRAKLTAVCWGALTILAPVAVSAYDGST |
| Ga0247677_10030214 | 3300024245 | Soil | MKVRGATTGTPFAARLTALCWGALALLAPVAISACTSSSSTTTPTIISPTVT |
| Ga0207652_117300932 | 3300025921 | Corn Rhizosphere | MKVRGTTLGVKLTALCWGTLTLLAPVALAACSSSSPTAP |
| Ga0207700_101337413 | 3300025928 | Corn, Switchgrass And Miscanthus Rhizosphere | MKVRGTTAGTPFGAKLTALCWGALTLLVPVAVSVMACPSLPA |
| Ga0207664_112019121 | 3300025929 | Agricultural Soil | MKVRGTTAGTPFGAKLTALCWGALTLLAPVAVSACTSSSST |
| Ga0207686_100527491 | 3300025934 | Miscanthus Rhizosphere | MKVRGATTGTPFAARLTALCWGALALLAPVAISACTSSSST |
| Ga0207668_110744162 | 3300025972 | Switchgrass Rhizosphere | MKVRGATTGTPFGARLTVLCWGALTLLAPVAVSACTSSSSTTT |
| Ga0179587_102116741 | 3300026557 | Vadose Zone Soil | MKVRGTTAGTPFGTRLTALCWAALAMLGPVAVSACTSSSSTPTIISPTLTN |
| Ga0208565_11745031 | 3300027662 | Peatlands Soil | MKVCTTFAGTALRARLTALCWGALTLLAPVAVSACSGSSTSPTIPTFTPSV |
| Ga0208565_11867511 | 3300027662 | Peatlands Soil | MKVRTTIAGTALRARLTALCWGALTLLVLVAVSACSGSSTSPTIPTFTPSV |
| Ga0208696_11985321 | 3300027696 | Peatlands Soil | MKVRTTIAGTALRARVTALCWGALTLLAPVAVSACSGSSTSPTIPTFTPSVSISGTAT |
| Ga0209178_11470301 | 3300027725 | Agricultural Soil | MKVRGTTAGTPFGAKLTALCWGALTLLAPITVSACT |
| Ga0209656_101457694 | 3300027812 | Bog Forest Soil | MKVRTTIAGTALRARLTALCWGTLTLLAPVAVSACSGSSSSPTIPTF |
| Ga0209067_104050701 | 3300027898 | Watersheds | MKVQTTIAGTALRARLTALCWGALIILAPVAVSACSG |
| Ga0247675_10020285 | 3300028072 | Soil | MKVRGATTGTPFAARLTALCWGALALLAPVAISACTSSSSTTTPTIISP |
| Ga0307317_100525983 | 3300028720 | Soil | MKVRGATTGTPFGARLTALCWGALTLLAPVAVSACTSSSST |
| Ga0308309_110257632 | 3300028906 | Soil | MKVRTTIAGTAFRARLTALCWGALTMLAPVAVSACSGSSST |
| Ga0310037_101051792 | 3300030494 | Peatlands Soil | MKLRMAVARTTFAARLTALGWGALTLLVPVAVSACSGSSS |
| Ga0318541_107705891 | 3300031545 | Soil | MKVRGTIAGTPLSARLTALCWAALTLLVPVAVSACTSGTTST |
| Ga0318538_101141161 | 3300031546 | Soil | MKVRGKIAGTPLGARLTALCWGALTLLAPVAVSACSSSTSTPQVFSPSVTTGTATGTA |
| Ga0318515_100982181 | 3300031572 | Soil | MKVRGTIAGTPLSAKLTVLCWGALTLLVPMAVSACTSGTT |
| Ga0318542_101696552 | 3300031668 | Soil | MKVRGKIAGTPLGARLTALCWGALTLLAPVAVSACSSSTSTPQVFSPSVTTGTAT |
| Ga0318574_107328102 | 3300031680 | Soil | MKVRGTIASTPLSATLTALCWGALALLAPVALSACTSSTST |
| Ga0318572_108138542 | 3300031681 | Soil | MKVRITIPGTALGTRLTALCWGALTLVALVTVSACSSPSR |
| Ga0307474_112161001 | 3300031718 | Hardwood Forest Soil | MKVRGTTAGTPFGAKLTALCWGALTLLAPVAVSACTSSSSTSPT |
| Ga0306917_112135351 | 3300031719 | Soil | MKVRGTIASTPFSAKLTALCWGALTLLVPLAVSACT |
| Ga0307469_121231811 | 3300031720 | Hardwood Forest Soil | MKVRGTLTGRPLGARLTALGWAALILLAPVAVSACT |
| Ga0318494_108116911 | 3300031751 | Soil | MKVRRRTSGTPFRARLTALCWGALTLLAPAAVTACSGSGTTTPTISVSVTTP |
| Ga0318554_107048771 | 3300031765 | Soil | MKVRGTIAGTPLSARLTALCWAALTLLVPVAVSACTSGTTSTPPTSFSP |
| Ga0318521_101601953 | 3300031770 | Soil | MKVRGTIASTPLSATLTALCWGALALLAPVALSACTSSTSTTPPT |
| Ga0318543_104884882 | 3300031777 | Soil | MKVRGKIAGTPLGARLTALCWGALTLLAPVAVSACSSSTSTPQVFSPSVTT |
| Ga0318508_11828451 | 3300031780 | Soil | MKVRGKIAGTPLGARLTALCWGALTLLAPVAVSACSSSTSTPQVFSPSVTTG |
| Ga0318568_101864153 | 3300031819 | Soil | MKVRGTIAGTPLSAKLTVLCWGALTLLVPMAVSACTSGTTSSAPPVFSPTVT |
| Ga0318517_101879281 | 3300031835 | Soil | MKVRGKIAGTPLGARLTALCWGALTLLAPVAVSACSSSTSTPQVFSPSVTTGTA |
| Ga0318511_104540832 | 3300031845 | Soil | MKVRGKIAGTPLGARLTALCWGALTLLAPVAVSACSSSTST |
| Ga0318544_101459592 | 3300031880 | Soil | MKVRGTIAGTPLSAKLTVLCWGALTLLVPMAVSACTSGTTSSAPPVFSPTVTTGTAAT |
| Ga0318520_106759841 | 3300031897 | Soil | MKVRGTIASTPLSATLTALCWGALALLAPVALSACTSST |
| Ga0306921_103818564 | 3300031912 | Soil | MKVRVTIAGTALGARLTALCWSALTLIAPLAAVSACSGASSSTPTVPTFT |
| Ga0318562_104645251 | 3300032008 | Soil | MKVRGTIASTPLSATLTALCWGALALLAPVALSACTSSTS |
| Ga0318563_104669091 | 3300032009 | Soil | MKVRGTIAGTPFSAKLTALCWGALTLLVPLAVSACTSSTSTAPPTIISPTVT |
| Ga0318504_104256132 | 3300032063 | Soil | MKVRVTIAGTAISARMTVLCWGALTLLAPMTVSACSGSSSTPTVPTFSPSVNTT |
| Ga0318510_104172001 | 3300032064 | Soil | MKVRGKIAGTPLGARLTALCWGALTLLAPVAVSACSSSTSTPQVFS |
| Ga0318513_104743001 | 3300032065 | Soil | MKVRVTIAGTALGARLTALCWSALTLIAPLAAVSACSGGSSSSPTVPTFTATVTGSSPA |
| Ga0306924_114356732 | 3300032076 | Soil | MKVRVPIARTAFRARMTALCWGALIVLAPMAVSACSGSSSSPTVPTFSPSVNTSTPVPAS |
| Ga0318540_102048791 | 3300032094 | Soil | MKVRGTIAGTPLSAKLTVLCWGALTLLVPMAVSACTSGTTSSAPPVFS |
| Ga0311301_106779541 | 3300032160 | Peatlands Soil | MKVRTTLFAGTALRARLTALCWGALTLLVPVAVSACSGSSTSPTIPTFTPSVTISGTAAGSGTAP |
| Ga0307472_1009530081 | 3300032205 | Hardwood Forest Soil | MKVRGTIGGTPFSAKLTALCWGALTLFVPVAVSACTSSSSPTT |
| Ga0335085_106394871 | 3300032770 | Soil | MKVRGTIAGTPFGAKLTALGWAALTLLVPVAVSACTSSSSPTTPTVTFSP |
| Ga0335082_104472971 | 3300032782 | Soil | MKVRVTIAGTALGARLTALCWGALTLLVPLAVSACSGGSSSTP |
| Ga0335072_117123242 | 3300032898 | Soil | MKVRGTTLGVRLTALCWGALGLLAPVALAACTSSS |
| Ga0335076_108547231 | 3300032955 | Soil | MKLRSTTAGTVLGARLTAVCWGALTLLVPAAVAACSSNSTSTPTVPTF |
| ⦗Top⦘ |