Metagenome / Metatranscriptome Family F101500

Overview

Basic Information

• Family ID: F101500
• Family Type: Metagenome / Metatranscriptome
• Number of Sequences: 102
• Average Sequence Length: 40 residues
• Representative Sequence: MIRQNVNRLSSEQMRGVCADMLTQKEALQVSDEAGSTGI
• Number of Associated Samples: 94
• Number of Associated Scaffolds: 102

Quality Assessment

• Transcriptomic Evidence: Yes
• Most common taxonomic group: Bacteria
• % of genes with valid RBS motifs: 70.59 %
• % of genes near scaffold ends (potentially truncated): 31.37 %
• % of genes from short scaffolds (< 2000 bps): 94.12 %
• Associated GOLD sequencing projects: 88
• AlphaFold2 3D model prediction: Yes
• 3D model pTM-score: 0.34

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.

Most Common Taxonomy

• Group: Bacteria (63.725 % of family members)
• NCBI Taxonomy ID: 2
• Taxonomy: All Organisms → cellular organisms → Bacteria

Most Common Ecosystem

• GOLD Ecosystem: Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil (17.647 % of family members)
• Environment Ontology (ENVO): Unclassified (39.216 % of family members)
• Earth Microbiome Project Ontology (EMPO): Host-associated → Plant → Plant rhizosphere (46.078 % of family members)

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure

• Classification: Globular
• Signal Peptide: No
• Secondary Structure distribution:
  α-helix: 52.24%
  β-sheet: 0.00%
  Coil/Unstructured: 47.76%

Predicted 3D Structure

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.

Gene Neighborhood

Neighboring Pfam domains

Pfam ID	Name	% Frequency in 102 Family Scaffolds
PF06742	DUF1214	46.08
PF00905	Transpeptidase	14.71
PF00912	Transgly	0.98
PF06863	DUF1254	0.98
PF02657	SufE	0.98
PF04610	TrbL	0.98
PF00126	HTH_1	0.98

Neighboring Clusters of Orthologous Genes (COGs)

COG ID	Name	Functional Category	% Frequency in 102 Family Scaffolds
COG5361	Uncharacterized conserved protein	Mobilome: prophages, transposons [X]	47.06
COG5402	Uncharacterized protein, contains DUF1214 domain	Function unknown [S]	46.08
COG0744	Penicillin-binding protein 1B/1F, peptidoglycan transglycosylase/transpeptidase	Cell wall/membrane/envelope biogenesis [M]	0.98
COG2166	Sulfur transfer protein SufE, Fe-S cluster assembly	Posttranslational modification, protein turnover, chaperones [O]	0.98
COG3704	Type IV secretory pathway, VirB6 component	Intracellular trafficking, secretion, and vesicular transport [U]	0.98
COG3846	Type IV secretory pathway, TrbL components	Intracellular trafficking, secretion, and vesicular transport [U]	0.98
COG4953	Membrane carboxypeptidase/penicillin-binding protein PbpC	Cell wall/membrane/envelope biogenesis [M]	0.98
COG5009	Membrane carboxypeptidase/penicillin-binding protein	Cell wall/membrane/envelope biogenesis [M]	0.98

Phylogeny

NCBI Taxonomy

Level 1

Name	Rank	Taxonomy	Distribution
All Organisms	root	All Organisms	63.73 %
Unclassified	root	N/A	36.27 %

Level 2

Name	Rank	Taxonomy	Distribution
cellular organisms	root	All Organisms → cellular organisms	63.73 %
Unclassified	root	N/A	36.27 %

Level 3

Name	Rank	Taxonomy	Distribution
Bacteria	superkingdom	All Organisms → cellular organisms → Bacteria	63.73 %
Unclassified	root	N/A	36.27 %

Level 4

Name	Rank	Taxonomy	Distribution
Proteobacteria	phylum	All Organisms → cellular organisms → Bacteria → Proteobacteria	60.78 %
Unclassified	root	N/A	36.27 %

Level 5

Name	Rank	Taxonomy	Distribution
Alphaproteobacteria	class	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	60.78 %
Unclassified	root	N/A	36.27 %

Level 6

Name	Rank	Taxonomy	Distribution
Hyphomicrobiales	order	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	59.80 %
Unclassified	root	N/A	36.27 %

Level 7

Name	Rank	Taxonomy	Distribution
Bradyrhizobiaceae	family	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae	59.80 %
Unclassified	root	N/A	36.27 %

Level 8

Name	Rank	Taxonomy	Distribution
Bradyrhizobium	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium	56.86 %
Unclassified	root	N/A	36.27 %
Afipia	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Afipia	2.94 %

Level 9

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	36.27 %
Bradyrhizobium elkanii	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium elkanii	14.71 %
Afipia felis	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Afipia → Afipia felis	2.94 %
Bradyrhizobium jicamae	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium jicamae	2.94 %
Bradyrhizobium paxllaeri	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium paxllaeri	0.98 %
Bradyrhizobium valentinum	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium valentinum	0.98 %

Associated Scaffolds

Scaffold	Taxonomy	Length
3300001305|C688J14111_10045188	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium elkanii	1327
3300002092|JGI24218J26658_1000006	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium	604817
3300005166|Ga0066674_10159807	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium	1066
3300005355|Ga0070671_101432709	Not Available	611
3300005444|Ga0070694_101904580	Not Available	508
3300005455|Ga0070663_100385468	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium elkanii	1142
3300005455|Ga0070663_100699182	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium	861
3300005466|Ga0070685_10442634	Not Available	909
3300005471|Ga0070698_100595786	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium	1045
3300005471|Ga0070698_101580895	Not Available	607
3300005543|Ga0070672_100487069	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium	1065
3300005548|Ga0070665_101160441	Not Available	783
3300005553|Ga0066695_10083197	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium	1946
3300005557|Ga0066704_10161584	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium	1505
3300005561|Ga0066699_10498430	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium	871
3300005564|Ga0070664_102182025	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium elkanii	526
3300005841|Ga0068863_102530239	Not Available	522
3300005844|Ga0068862_101477090	Not Available	685
3300006031|Ga0066651_10389188	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium	745
3300006032|Ga0066696_10250910	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium	1143
3300006042|Ga0075368_10484699	Not Available	551
3300006046|Ga0066652_101122623	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium	745
3300006058|Ga0075432_10502086	Not Available	541
3300006186|Ga0075369_10480418	Not Available	590
3300006353|Ga0075370_10534395	Not Available	709
3300006353|Ga0075370_10641083	Not Available	645
3300006603|Ga0074064_10008279	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium	864
3300006852|Ga0075433_11786367	Not Available	529
3300006871|Ga0075434_101078604	All Organisms → cellular organisms → Bacteria	816
3300006954|Ga0079219_11751641	Not Available	578
3300009092|Ga0105250_10331539	Not Available	663
3300009100|Ga0075418_12176209	Not Available	605
3300009148|Ga0105243_12781801	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium elkanii	530
3300009174|Ga0105241_10334582	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium	1310
3300009545|Ga0105237_11692410	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium elkanii	640
3300009802|Ga0105073_1010714	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium elkanii	828
3300010303|Ga0134082_10507753	Not Available	527
3300010400|Ga0134122_11336165	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium elkanii	727
3300011429|Ga0137455_1036898	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium	1360
3300012198|Ga0137364_10472769	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium elkanii	941
3300012360|Ga0137375_10186473	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium	1981
3300012501|Ga0157351_1045832	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium	560
3300012685|Ga0137397_10052734	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium elkanii	2922
3300012901|Ga0157288_10143364	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium elkanii	704
3300012924|Ga0137413_11337214	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium	576
3300012938|Ga0162651_100078526	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium	549
3300012951|Ga0164300_10092649	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium elkanii	1308
3300012985|Ga0164308_11845403	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium elkanii	563
3300012988|Ga0164306_10216217	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium elkanii	1354
3300012989|Ga0164305_10122148	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium	1717
3300014166|Ga0134079_10254132	Not Available	761
3300014317|Ga0075343_1163094	Not Available	558
3300014325|Ga0163163_12343668	Not Available	592
3300014745|Ga0157377_10309958	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium elkanii	1045
3300014969|Ga0157376_11328382	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium elkanii	749
3300015200|Ga0173480_10400308	Not Available	797
3300015264|Ga0137403_10695353	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium	877
3300017657|Ga0134074_1378190	Not Available	525
3300018027|Ga0184605_10143875	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium	1070
3300018028|Ga0184608_10207645	Not Available	858
3300018051|Ga0184620_10108001	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium	865
3300018052|Ga0184638_1245591	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium	618
3300018053|Ga0184626_10148783	Not Available	996
3300018072|Ga0184635_10156073	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium	911
3300018075|Ga0184632_10342668	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium	641
3300018431|Ga0066655_10505803	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium	801
3300018465|Ga0190269_10213670	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium valentinum	1056
3300018469|Ga0190270_10098865	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium	2228
3300018469|Ga0190270_11398384	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium jicamae	746
3300018469|Ga0190270_12689722	Not Available	560
3300019361|Ga0173482_10274284	Not Available	729
3300019377|Ga0190264_10916835	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium	687
3300019873|Ga0193700_1059189	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium jicamae	589
3300025899|Ga0207642_10365979	Not Available	854
3300025940|Ga0207691_11021734	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium	689
3300025945|Ga0207679_11119644	Not Available	722
3300025981|Ga0207640_11148656	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium	689
3300026067|Ga0207678_11280594	Not Available	649
3300026318|Ga0209471_1154990	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium	942
3300026334|Ga0209377_1156985	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Afipia → Afipia felis	851
3300026542|Ga0209805_1065302	Not Available	1782
3300027880|Ga0209481_10433196	Not Available	676
3300028379|Ga0268266_10266976	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	1587
3300028380|Ga0268265_11445053	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium jicamae	690
3300028786|Ga0307517_10393358	Not Available	736
3300028802|Ga0307503_10644166	Not Available	589
3300028803|Ga0307281_10033108	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium	1561
3300031094|Ga0308199_1103814	Not Available	629
3300031184|Ga0307499_10000402	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium	15511
3300031184|Ga0307499_10114251	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium	755
3300031548|Ga0307408_100278334	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium	1392
3300031548|Ga0307408_100587170	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Afipia → Afipia felis	988
3300031901|Ga0307406_11138642	Not Available	675
3300031908|Ga0310900_10244660	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium paxllaeri	1288
3300031943|Ga0310885_10897688	Not Available	508
3300032005|Ga0307411_10468892	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Afipia → Afipia felis	1058
3300032126|Ga0307415_100177603	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium	1667
3300033179|Ga0307507_10431434	Not Available	736
3300033180|Ga0307510_10068711	All Organisms → cellular organisms → Bacteria	3553
3300034127|Ga0370489_0011837	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium	2319
3300034127|Ga0370489_0034098	All Organisms → cellular organisms → Bacteria	1462
3300034417|Ga0364941_204996	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium	512

Environmental Properties

Associated Habitat Types

Ecosystem

Habitat	Taxonomy	Distribution
Environmental	Environmental	61.76%
Host-Associated	Host-Associated	38.24%

Class

Habitat	Taxonomy	Distribution
Terrestrial	Environmental → Terrestrial	52.94%
Plants	Host-Associated → Plants	38.24%
Aquatic	Environmental → Aquatic	8.82%

Category

Habitat	Taxonomy	Distribution
Soil	Environmental → Terrestrial → Soil	50.98%
Rhizosphere	Host-Associated → Plants → Rhizosphere	25.49%
Sediment	Environmental → Aquatic → Sediment	7.84%
Roots	Host-Associated → Plants → Roots	7.84%
Rhizoplane	Host-Associated → Plants → Rhizoplane	4.90%
Freshwater	Environmental → Aquatic → Freshwater	0.98%
Floodplain	Environmental → Terrestrial → Floodplain	0.98%
Agricultural Field	Environmental → Terrestrial → Agricultural Field	0.98%

Type

Habitat	Taxonomy	Distribution
Unclassified	Environmental → Terrestrial → Soil → Unclassified	42.16%
Unclassified	Host-Associated → Plants → Rhizosphere → Unclassified	15.69%
Soil	Host-Associated → Plants → Rhizosphere → Soil	9.80%
Unclassified	Environmental → Aquatic → Sediment → Unclassified	7.84%
Loam	Environmental → Terrestrial → Soil → Loam	4.90%
Epiphytes	Host-Associated → Plants → Rhizoplane → Epiphytes	4.90%
Bulk Soil	Host-Associated → Plants → Roots → Bulk Soil	3.92%
Wetlands	Environmental → Terrestrial → Soil → Wetlands	2.94%
Unclassified	Host-Associated → Plants → Roots → Unclassified	2.94%
Lentic	Environmental → Aquatic → Freshwater → Lentic	0.98%
Sand	Environmental → Terrestrial → Soil → Sand	0.98%
Sediment	Environmental → Terrestrial → Floodplain → Sediment	0.98%
Unclassified	Environmental → Terrestrial → Agricultural Field → Unclassified	0.98%
Rhizosphere	Host-Associated → Plants → Roots → Rhizosphere	0.98%

Subtype

Habitat	Taxonomy	Distribution
Unclassified	Environmental → Terrestrial → Soil → Unclassified → Unclassified	28.43%
Unclassified	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified	15.69%
Grasslands	Environmental → Terrestrial → Soil → Unclassified → Grasslands	10.78%
Unclassified	Host-Associated → Plants → Rhizosphere → Soil → Unclassified	9.80%
Unclassified	Environmental → Aquatic → Sediment → Unclassified → Unclassified	7.84%
Unclassified	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified	4.90%
Agricultural Soil	Environmental → Terrestrial → Soil → Loam → Agricultural Soil	3.92%
Unclassified	Host-Associated → Plants → Roots → Bulk Soil → Unclassified	3.92%
Unclassified	Environmental → Terrestrial → Soil → Wetlands → Unclassified	2.94%
Unclassified	Host-Associated → Plants → Roots → Unclassified → Unclassified	2.94%
Agricultural	Environmental → Terrestrial → Soil → Unclassified → Agricultural	1.96%
Unclassified	Environmental → Aquatic → Freshwater → Lentic → Unclassified	0.98%
Agricultural Land	Environmental → Terrestrial → Soil → Unclassified → Agricultural Land	0.98%
Grasslands	Environmental → Terrestrial → Soil → Loam → Grasslands	0.98%
Unclassified	Environmental → Terrestrial → Soil → Sand → Unclassified	0.98%
Unclassified	Environmental → Terrestrial → Floodplain → Sediment → Unclassified	0.98%
Unclassified	Environmental → Terrestrial → Agricultural Field → Unclassified → Unclassified	0.98%
Soil	Host-Associated → Plants → Roots → Rhizosphere → Soil	0.98%

Habitat

Habitat	Taxonomy	Distribution
Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil	17.65%
Soil	Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil	9.80%
Groundwater Sediment	Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment	6.86%
Vadose Zone Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil	4.90%
Populus Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere	4.90%
Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere	4.90%
Corn Rhizosphere	Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere	4.90%
Populus Endosphere	Host-Associated → Plants → Roots → Bulk Soil → Unclassified → Populus Endosphere	3.92%
Grasslands Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil	2.94%
Corn, Switchgrass And Miscanthus Rhizosphere	Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere	2.94%
Switchgrass Rhizosphere	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere	2.94%
Ectomycorrhiza	Host-Associated → Plants → Roots → Unclassified → Unclassified → Ectomycorrhiza	2.94%
Switchgrass Rhizosphere	Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere	2.94%
Soil	Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil	1.96%
Untreated Peat Soil	Environmental → Terrestrial → Soil → Wetlands → Unclassified → Untreated Peat Soil	1.96%
Corn Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere	1.96%
Miscanthus Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere	1.96%
Miscanthus Rhizosphere	Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere	1.96%
Lentic	Environmental → Aquatic → Freshwater → Lentic → Unclassified → Lentic	0.98%
Soil	Environmental → Aquatic → Sediment → Unclassified → Unclassified → Soil	0.98%
Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil	0.98%
Terrestrial Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil	0.98%
Unplanted Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Unplanted Soil	0.98%
Agricultural Soil	Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil	0.98%
Grasslands Soil	Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil	0.98%
Natural And Restored Wetlands	Environmental → Terrestrial → Soil → Wetlands → Unclassified → Natural And Restored Wetlands	0.98%
Soil	Environmental → Terrestrial → Soil → Loam → Grasslands → Soil	0.98%
Switchgrass Rhizosphere	Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere	0.98%
Groundwater Sand	Environmental → Terrestrial → Soil → Sand → Unclassified → Groundwater Sand	0.98%
Sediment	Environmental → Terrestrial → Floodplain → Sediment → Unclassified → Sediment	0.98%
Soil	Environmental → Terrestrial → Agricultural Field → Unclassified → Unclassified → Soil	0.98%
Corn Rhizosphere	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere	0.98%
Miscanthus Rhizosphere	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere	0.98%
Switchgrass Rhizosphere	Host-Associated → Plants → Roots → Rhizosphere → Soil → Switchgrass Rhizosphere	0.98%
Switchgrass Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere	0.98%
Miscanthus Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere	0.98%

Associated Samples

Taxon OID	Sample Name	Habitat Type
3300001305	Grasslands soil microbial communities from Hopland, California, USA	Environmental
3300002092	Lentic bog actinobacteria communities from Grosse Fuchskuhle, Germany - Sample acI-B2 co-culture F-B6 metagenome	Environmental
3300005166	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_123	Environmental
3300005355	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG	Host-Associated
3300005444	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG	Environmental
3300005455	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG	Host-Associated
3300005466	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG	Environmental
3300005471	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG	Environmental
3300005543	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG	Host-Associated
3300005548	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG	Host-Associated
3300005553	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_144	Environmental
3300005557	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_153	Environmental
3300005561	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_148	Environmental
3300005564	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG	Host-Associated
3300005841	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2	Host-Associated
3300005844	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2	Host-Associated
3300006031	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Angelo_100	Environmental
3300006032	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_145	Environmental
3300006042	Populus root and rhizosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3	Host-Associated
3300006046	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_101	Environmental
3300006058	Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1	Host-Associated
3300006186	Populus root and rhizosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4	Host-Associated
3300006353	Populus root and rhizosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5	Host-Associated
3300006603	Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtHMC (Metagenome Metatranscriptome)	Environmental
3300006852	Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2	Host-Associated
3300006871	Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3	Host-Associated
3300006954	Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Control	Environmental
3300009092	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG	Host-Associated
3300009100	Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD2	Host-Associated
3300009148	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG	Host-Associated
3300009174	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG	Host-Associated
3300009545	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG	Host-Associated
3300009802	Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW N3_50_60	Environmental
3300010303	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_5_09182015	Environmental
3300010400	Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-2	Environmental
3300011429	Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMGT600_2	Environmental
3300012198	Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_20_16 metaG	Environmental
3300012360	Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_113_16 metaG	Environmental
3300012501	Unplanted soil (control) microbial communities from North Carolina - M.Soil.4.yng.170610	Environmental
3300012685	Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz1.16 metaG	Environmental
3300012901	Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S119-311C-1	Environmental
3300012924	Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_16fungal (Illumina Assembly)	Environmental
3300012938	Agricultural soil microbial communities from Tamara ranch near Red Deer, Alberta, Canada - d1t2i015	Environmental
3300012951	Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_226_MG	Environmental
3300012985	Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_246_MG	Environmental
3300012988	Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_242_MG	Environmental
3300012989	Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_237_MG	Environmental
3300014166	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_2_09182015	Environmental
3300014317	Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - RushOxbow_ThreeSqB_D1	Environmental
3300014325	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG	Host-Associated
3300014745	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG	Host-Associated
3300014969	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG	Host-Associated
3300015200	Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S209-509C-1 (version 2)	Environmental
3300015264	Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Hybrid Assembly)	Environmental
3300017657	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_2_09212015	Environmental
3300018027	Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_30_coex	Environmental
3300018028	Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_30_coex	Environmental
3300018051	Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_5_b1	Environmental
3300018052	Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3-1_50_b2	Environmental
3300018053	Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_60_b1	Environmental
3300018072	Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_30_b2	Environmental
3300018075	Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3-1_50_b1	Environmental
3300018431	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_104	Environmental
3300018465	Populus adjacent soil microbial communities from riparian zone of Blue River, Arizona, USA - 249 IS	Environmental
3300018469	Populus adjacent soil microbial communities from riparian zone of Weber River, Utah, USA - 320 T	Environmental
3300019361	Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S133-311R-2 (version 2)	Environmental
3300019377	Populus adjacent soil microbial communities from riparian zone of Indian Creek, Utah, USA - 112 T	Environmental
3300019873	Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U3s1	Environmental
3300025899	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes)	Host-Associated
3300025940	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes)	Host-Associated
3300025945	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes)	Host-Associated
3300025981	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes)	Host-Associated
3300026067	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes)	Host-Associated
3300026318	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_128 (SPAdes)	Environmental
3300026334	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_141 (SPAdes)	Environmental
3300026542	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_148 (SPAdes)	Environmental
3300027880	Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD3 (SPAdes)	Host-Associated
3300028379	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes)	Host-Associated
3300028380	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes)	Host-Associated
3300028786	Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM	Host-Associated
3300028802	Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 17_S	Environmental
3300028803	Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_120	Environmental
3300031094	Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_203 (Metagenome Metatranscriptome)	Environmental
3300031184	Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 13_S	Environmental
3300031548	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3	Host-Associated
3300031901	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2	Host-Associated
3300031908	Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C24D1	Environmental
3300031943	Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T60D2	Environmental
3300032005	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1	Host-Associated
3300032126	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2	Host-Associated
3300033179	Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM	Host-Associated
3300033180	Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM	Host-Associated
3300034127	Peat soil microbial communities from wetlands in Alaska, United States - Frozen_pond_05D_16	Environmental
3300034417	Sediment microbial communities from East River floodplain, Colorado, United States - 17_s17	Environmental

Family Sequences

Protein ID	Sample Taxon ID	Habitat	Sequence
C688J14111_100451883	3300001305	Soil	MIRQNLDRLSSERMRGVDAGTRDQKKSLQVLDQAA*
JGI24218J26658_1000006564	3300002092	Lentic	MIRQNLDRLSPERMRGVDAGMPNQKEALQLSDEAGPTGI*
Ga0066674_101598073	3300005166	Soil	MIRQNVNRLSSEQMRGVCADMLTQKEALQVSDEAGSTGI*
Ga0070671_1014327091	3300005355	Switchgrass Rhizosphere	CTGAAEELKDMIRQNLDRLSSGRMRGVDAGTRDQKKSLQVLDQAV*
Ga0070694_1019045801	3300005444	Corn, Switchgrass And Miscanthus Rhizosphere	TGAAEELKGMIRQNVNRLSSERMRGVCADMLKQREALQVSDEAGSTGI*
Ga0070663_1003854682	3300005455	Corn Rhizosphere	MIRQNLDRLSSERMRGVDAGMPNQKEALQLSDEAGPAGI*
Ga0070663_1006991823	3300005455	Corn Rhizosphere	ELKGMIRQNVNRLSSERMRGVCADMLKPKEALQVSDEAGSTGI*
Ga0070685_104426342	3300005466	Switchgrass Rhizosphere	MIRQNLDRLSSERMRGVDAGMPNQKEALQLSDEAGPTGI*
Ga0070698_1005957862	3300005471	Corn, Switchgrass And Miscanthus Rhizosphere	MIRQNVNRLSSEQMRGVCTDMLNQKEALQVSDEAGSTGI*
Ga0070698_1015808952	3300005471	Corn, Switchgrass And Miscanthus Rhizosphere	GAAEELKGMIRQNVNRLSSERMRGVCADMLKQREALQVSDEAGSTGI*
Ga0070672_1004870693	3300005543	Miscanthus Rhizosphere	MIRQNLNRLSSERMRGVDAGMPNQKEVLQLSDEAGPTGI*
Ga0070665_1011604412	3300005548	Switchgrass Rhizosphere	MIRQNLDRLSSERMRGVDAGMRDQKKSLQVLDQAV*
Ga0066695_100831971	3300005553	Soil	IRQNVNRLSSEQMRGVCADMLTQKEALQVSDEAGSTGI*
Ga0066704_101615841	3300005557	Soil	IRQNVNRLSSEQMRGVCAVMLTQKEALQVSDEAGSNGI*
Ga0066699_104984301	3300005561	Soil	AEELKGMIRHNVNRLSSEQMRSVCTDMPKQKEALQVSDETGSTGI*
Ga0070664_1021820252	3300005564	Corn Rhizosphere	MIRQNLDRLSSERMRGVDAGMPNQKEALQLSDEPGPTGI*
Ga0068863_1025302392	3300005841	Switchgrass Rhizosphere	AAEELKGMIRQNVVRLSSERMRGVCAAMPKPKETLQVSDEAGSTGI*
Ga0068862_1014770901	3300005844	Switchgrass Rhizosphere	MIRQNVNRLSSEQMRGVRAGMLKPKEALLVSDEAGSTGI*
Ga0066651_103891882	3300006031	Soil	MIRQNVNLLSAEQMRGVCAGMLKHKEALQVSDEAGSTGI*
Ga0066696_102509103	3300006032	Soil	MIRQNVNRLFSEQMRGVCAGMLKPKDALQVSDEAGSSGI*
Ga0075368_104846991	3300006042	Populus Endosphere	MIRQNVNRLFSEQMRDVCPELFKPKEALHVSDEAGSTGI
Ga0066652_1011226232	3300006046	Soil	MIRQNVVRLSSERMRGICAGMLKAKALQVSDEAGSSGI*
Ga0075432_105020862	3300006058	Populus Rhizosphere	MIRQNVVRLSSEQMRGVCAGMPKPDEALQVSNEAGSSG
Ga0075369_104804182	3300006186	Populus Endosphere	AEELKGMIRQNVNRLSSERMRGVCADMLKQREALQVSDEAGSTGI*
Ga0075370_105343951	3300006353	Populus Endosphere	RQNVNRLFSEQMRDVCSELFKPKEALQVSDEAGSTGI*
Ga0075370_106410831	3300006353	Populus Endosphere	MIRQNVNRLFSEQMRDVCPELFKPNEALQVSDEAGSTGI*
Ga0074064_100082792	3300006603	Soil	MIRQNLDRLSSERMRGVDAGMPNQKEALQLSDEAGSTGI*
Ga0075433_117863672	3300006852	Populus Rhizosphere	GMIRQNVNRLSWERMRGVWPDMLEHKEALQVSDEAGSTGI*
Ga0075434_1010786042	3300006871	Populus Rhizosphere	MIRQNVNRLSWERMRGVWPDMLEHKEALQVSDEAGSTGI*
Ga0079219_117516411	3300006954	Agricultural Soil	KGMIRQNVVRLSSEQMRGVSAGTLPHREAFQVLDEAGSSGI*
Ga0105250_103315391	3300009092	Switchgrass Rhizosphere	NVNRLSSEQMRGVCVGMLTHKEALQVSDEAGSSGI*
Ga0075418_121762092	3300009100	Populus Rhizosphere	EELKGMIRQNVNRLSSERMRGVCADMLEHREALQVSDEAGSTGI*
Ga0105243_127818012	3300009148	Miscanthus Rhizosphere	MIRQNLNRLSSERMRGVDAGMPNQKEALQLSDEAGPAGI*
Ga0105241_103345823	3300009174	Corn Rhizosphere	MIRQNVVRLSSEQMRGVRADLLNQKEALQVSDEAGSTGI*
Ga0105237_116924102	3300009545	Corn Rhizosphere	MIRQNVNRLFSEQMRDVCPELFKPKEALQVSDEAGSTGI*
Ga0105073_10107141	3300009802	Groundwater Sand	NVNRLSSEQMRGVRAGMITQKEALQVSDEAGSTGI*
Ga0134082_105077532	3300010303	Grasslands Soil	GAAEELKGMIRQNVNRLSSEQMRGVCAGMLKQALQVSDEAGSTGI*
Ga0134122_113361652	3300010400	Terrestrial Soil	MIRQNVVRLSSEQMQGVRADLLKQKEALQVSDEAGSTGI*
Ga0137455_10368983	3300011429	Soil	KGMIRQNVNPLSSEQMRGVRADMPKQKEALQVSDEAGSTGI*
Ga0137364_104727692	3300012198	Vadose Zone Soil	MIRQNVNRLSSEEMRGVCAGMLKQALQVSDEAGSTGI*
Ga0137375_101864732	3300012360	Vadose Zone Soil	MIRQNVNRLSSEQMRGVRAGMLTQKEALQVSDEAGSTGI*
Ga0157351_10458322	3300012501	Unplanted Soil	MIRQNVNRLSSERMRGVCADMPKQKEAFQVSDEAGSTGI*
Ga0137397_100527342	3300012685	Vadose Zone Soil	MIRQNVNRLSSEEMRGVRAGMLTQKEALQVSDEAGSTGI*
Ga0157288_101433642	3300012901	Soil	MIRQNLDRLSSERMRGVDAGMPNQKEVLQLSDEAGPTGI*
Ga0137413_113372142	3300012924	Vadose Zone Soil	MIRQNVNLLSSEQMRGVCDGMLTHKEALQVSDEAGSSGI*
Ga0162651_1000785262	3300012938	Soil	MIRQNVNRLSSEQMRGVCADMPEQKEALQVSDEAGSTGI*
Ga0164300_100926492	3300012951	Soil	MIRQNLDRLSSERMRGVDAGMPNQKEALQLSDEAGSPGI*
Ga0164308_118454032	3300012985	Soil	MIRQNLNRLSSERLRGVDAGMPNQKEALQLSDEAGPAGI*
Ga0164306_102162172	3300012988	Soil	MIRQNLDRLSSERMRGVDAGMPNQKEALQLSDESGSTGI*
Ga0164305_101221482	3300012989	Soil	LKDMIRQNLERMRGVDAGMPNQKEALQLSDEAGSPGI*
Ga0134079_102541322	3300014166	Grasslands Soil	MIRQNVNRLSSEEMRGVCAGMLKPKEALQVSDEAGSSGI*
Ga0075343_11630942	3300014317	Natural And Restored Wetlands	GMIRQNVNRLSSEQMPAVCAGMLKQKEALQVSDEAGSTGI*
Ga0163163_123436682	3300014325	Switchgrass Rhizosphere	GAAEELKGMIRQNVTRLFSEQMRDVCPELFKPKEALQVSDEAGSTGI*
Ga0157377_103099582	3300014745	Miscanthus Rhizosphere	MIRQNLNRLSSERMRGVDAGMPNQKEALQLSDEAGPTGI*
Ga0157376_113283822	3300014969	Miscanthus Rhizosphere	MIRQNLNRLSSERLRGVDAGMPNQKEALQLSDEAGPTGI*
Ga0173480_104003082	3300015200	Soil	MIRQNLDRLSSERMRGVDAGMPNQKEALQLSDEAGPSGI*
Ga0137403_106953532	3300015264	Vadose Zone Soil	MNRQNVNLLSAEQMRGVCAGMLKPKEALQVSDEAGSTGI*
Ga0134074_13781902	3300017657	Grasslands Soil	GMIRQNVNRLSSEEMRGVCAGMLKPKEALQVSDEAGSTGI
Ga0184605_101438751	3300018027	Groundwater Sediment	GAAEELKGMIRQNVNRLSSEQMRGVCPGMLKPKEALQVSDEAGSSGI
Ga0184608_102076452	3300018028	Groundwater Sediment	MIRQNVNRLSSEQMQGVCADMPEQKEALQVSDEAGSTGI
Ga0184620_101080012	3300018051	Groundwater Sediment	MIRQNVNRLSSEQMRGVRADMLTQKEALQVSDEAGSTGI
Ga0184638_12455912	3300018052	Groundwater Sediment	MIRQNVNPLSLEQMRGVRADMLKQKEALQVSDEAGSTGI
Ga0184626_101487832	3300018053	Groundwater Sediment	MIRQNVNPLSSEQMRGVRADMLKQKEALQVSDEAGSTGI
Ga0184635_101560732	3300018072	Groundwater Sediment	MIRQNVNRLSSEQMRGVSADMLKRKEALQVSDEAGSTGI
Ga0184632_103426681	3300018075	Groundwater Sediment	AEELKDMIRQNVNPLSLEQMRGVRADMLKQKEALQVSDEAGSTGI
Ga0066655_105058032	3300018431	Grasslands Soil	MIRQNVNRLSSEQMRGVCADMLTQKEALQVSDEAGSTGI
Ga0190269_102136702	3300018465	Soil	MIRQNLDRLSSERMRGVDAGMPNQKEALQLSDEAGPTGI
Ga0190270_100988653	3300018469	Soil	MIRQNVNRLSSEQMRGVCADMPQQKEALQVSDEAGSTGI
Ga0190270_113983842	3300018469	Soil	MIRQNVNRLSSEQMRGVCAEMPKQKEALQVSDEAGSTGT
Ga0190270_126897221	3300018469	Soil	MIRQNLDRLSPERMRGVDAGMPNQKEALQLSDEAGPTGI
Ga0173482_102742841	3300019361	Soil	LKRMIRQNVNRLSSERMRGIGFDMLKPKQALQVSDEAGSTGI
Ga0190264_109168352	3300019377	Soil	MIRQNLDRLSSERMRGVDAGMPNQKEALQLSGEAGPTGI
Ga0193700_10591892	3300019873	Soil	MIRQNVNRLSSEEMRGVRADMLTQKEALQVSDEAGSTGI
Ga0207642_103659792	3300025899	Miscanthus Rhizosphere	MIRQNVNRLFSEQMRDVCSELFKPKEALQVSDEAGSTGI
Ga0207691_110217342	3300025940	Miscanthus Rhizosphere	MIRQNLNRLSSERMRGVDAGMPNQKEVLQLSDEAGPTGI
Ga0207679_111196442	3300025945	Corn Rhizosphere	MIRQNLDRLSSERMRGVDAGMRDQKKSLQVLDQAV
Ga0207640_111486562	3300025981	Corn Rhizosphere	MIRQNVNRLSSERMRGVCADMLKPKEALQVSDEAGSTGI
Ga0207678_112805942	3300026067	Corn Rhizosphere	MIRQNLDRLSSERMRGVDAGMPNQKEALQLSDEAGPAGI
Ga0209471_11549902	3300026318	Soil	MIRHNVNRLSSEQMRSVCTDMPKQKEALQISDEIGSTGI
Ga0209377_11569852	3300026334	Soil	MIRQNVNRLSSEQMRGVCADMLTQKEALQVSDEAGS
Ga0209805_10653021	3300026542	Soil	ELKGMIRHNVNRLSSEQMRSVCTDMPKQKEALQVSDETGSTGI
Ga0209481_104331962	3300027880	Populus Rhizosphere	IRQNVNRLSSERMRGVCADMLKQREALQVSDEAGSTGI
Ga0268266_102669761	3300028379	Switchgrass Rhizosphere	MIRQNVNRLFSEQMRDVCPELFKPKEALQVSDEAGSTGI
Ga0268265_114450532	3300028380	Switchgrass Rhizosphere	MIRQNVNRLSSEQMRGVRAGMLKPKEALLVSDEAGSTGI
Ga0307517_103933582	3300028786	Ectomycorrhiza	MIRQNLNRLSSERLRGVDAGMPNQKEALQLSDEAGPAGI
Ga0307503_106441661	3300028802	Soil	MIRQNLNRLSSERMRGVDAGMPNQKVALQLSDEAGPTGI
Ga0307281_100331083	3300028803	Soil	MIRQNVNPLSSEQMRGVRADMLRQKEALQVSDEAGSTGI
Ga0308199_11038141	3300031094	Soil	MIRQNVNRLSSEQMRGVRADLLKQKEALQVSDEAGSTGI
Ga0307499_100004022	3300031184	Soil	MIRQNLDRLSSERMRGADAGMPNQKEALQLSDEAGPTGI
Ga0307499_101142512	3300031184	Soil	MIRQNVNRLSSEQMRGVRADMLTQKEAIQVSDEAGSTGI
Ga0307408_1002783342	3300031548	Rhizosphere	MIRQNLDRLSSERMGGVDAGMPNQKEALQLSDEAGPTGI
Ga0307408_1005871701	3300031548	Rhizosphere	MIRQNVNRLSSEWMRGVCRDMLARNDALQVPDEAGSSGI
Ga0307406_111386421	3300031901	Rhizosphere	MIRQNVNRLSSEWMRGVCRDMLARNDALQVPDEAGS
Ga0310900_102446602	3300031908	Soil	MIRQNLDRLSSERMRGVDAGMPNQKEALQLSDEAGSTGI
Ga0310885_108976881	3300031943	Soil	TGAAEELKAMIRQNLDRLSSERMRGVDAGMPNQKEALQLSDEAGPTGI
Ga0307411_104688921	3300032005	Rhizosphere	MIRQNVNRLSSEWMRGVCRDMLARNDAVQVPDEAGS
Ga0307415_1001776033	3300032126	Rhizosphere	MIRQNLDRLSSERMRGADAGMLNQKEALQLSDEAGPTGI
Ga0307507_104314342	3300033179	Ectomycorrhiza	MIRQNVNRLSSEQMRGVRADMLTQKEAVQVSDEAGSTGI
Ga0307510_100687114	3300033180	Ectomycorrhiza	MIRQNVNLLSAEQMRGVCAGMLKHKQALQVSDEAGSTGI
Ga0370489_0011837_984_1103	3300034127	Untreated Peat Soil	MIRQNVDPLSSEQMRGARAGMLKQKEALQVSDEAGSTGI
Ga0370489_0034098_533_652	3300034127	Untreated Peat Soil	MIRQNLERLSSEPMRGVDAGMPDHQEALQVSDEAGSTGV
Ga0364941_204996_162_281	3300034417	Sediment	MIRQNVNRLSSEEMRGVCAGMLTHKEALQVSFEAGSTGI