| Basic Information | |
|---|---|
| Family ID | F101489 |
| Family Type | Metagenome |
| Number of Sequences | 102 |
| Average Sequence Length | 41 residues |
| Representative Sequence | MLIVQKRLKTEPDAEWDFHELSTDKFPGGFQRESDWAVRYK |
| Number of Associated Samples | 85 |
| Number of Associated Scaffolds | 102 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | No |
| Most common taxonomic group | Unclassified |
| % of genes with valid RBS motifs | 100.00 % |
| % of genes near scaffold ends (potentially truncated) | 2.94 % |
| % of genes from short scaffolds (< 2000 bps) | 0.98 % |
| Associated GOLD sequencing projects | 74 |
| AlphaFold2 3D model prediction | No |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Unclassified (98.039 % of family members) |
| NCBI Taxonomy ID | N/A |
| Taxonomy | N/A |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine (24.510 % of family members) |
| Environment Ontology (ENVO) | Unclassified (84.314 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Saline → Water (saline) (80.392 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 0.00% β-sheet: 9.76% Coil/Unstructured: 90.24% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 102 Family Scaffolds |
|---|---|---|
| PF14236 | DUF4338 | 11.76 |
| PF13759 | 2OG-FeII_Oxy_5 | 3.92 |
| PF03104 | DNA_pol_B_exo1 | 0.98 |
| PF13640 | 2OG-FeII_Oxy_3 | 0.98 |
| COG ID | Name | Functional Category | % Frequency in 102 Family Scaffolds |
|---|---|---|---|
| COG0417 | DNA polymerase B elongation subunit | Replication, recombination and repair [L] | 0.98 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| Unclassified | root | N/A | 98.04 % |
| All Organisms | root | All Organisms | 1.96 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300009428|Ga0114915_1025456 | All Organisms → Viruses → Predicted Viral | 2070 | Open in IMG/M |
| 3300020396|Ga0211687_10037815 | Not Available | 2248 | Open in IMG/M |
| 3300025570|Ga0208660_1025881 | All Organisms → Viruses → Predicted Viral | 1668 | Open in IMG/M |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Marine | Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine | 24.51% |
| Marine | Environmental → Aquatic → Marine → Unclassified → Unclassified → Marine | 15.69% |
| Pelagic Marine | Environmental → Aquatic → Marine → Pelagic → Unclassified → Pelagic Marine | 14.71% |
| Marine | Environmental → Aquatic → Marine → Unclassified → Unclassified → Marine | 12.75% |
| Seawater | Environmental → Aquatic → Marine → Inlet → Unclassified → Seawater | 3.92% |
| Aqueous | Environmental → Aquatic → Marine → Coastal → Unclassified → Aqueous | 3.92% |
| Seawater | Environmental → Aquatic → Marine → Pelagic → Unclassified → Seawater | 3.92% |
| Estuarine Water | Environmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine Water | 2.94% |
| Pelagic Marine | Environmental → Aquatic → Marine → Neritic Zone → Unclassified → Pelagic Marine | 2.94% |
| Seawater | Environmental → Aquatic → Marine → Strait → Unclassified → Seawater | 2.94% |
| Seawater | Environmental → Aquatic → Marine → Coastal → Unclassified → Seawater | 1.96% |
| Sackhole Brine | Environmental → Aquatic → Marine → Coastal → Unclassified → Sackhole Brine | 1.96% |
| Estuarine | Environmental → Aquatic → Marine → Intertidal Zone → Estuary → Estuarine | 1.96% |
| Estuarine | Environmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine | 1.96% |
| Deep Ocean | Environmental → Aquatic → Marine → Oceanic → Unclassified → Deep Ocean | 0.98% |
| Marine | Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine | 0.98% |
| Estuary Water | Environmental → Aquatic → Marine → Coastal → Unclassified → Estuary Water | 0.98% |
| Marine | Environmental → Aquatic → Marine → Neritic Zone → Unclassified → Marine | 0.98% |
| Visualization |
|---|
| Powered by ApexCharts |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300000116 | Marine microbial communities from Delaware Coast, sample from Delaware MO Spring March 2010 | Environmental | Open in IMG/M |
| 3300001355 | Pelagic Microbial community sample from North Sea - COGITO 998_met_08 | Environmental | Open in IMG/M |
| 3300001450 | Marine viral communities from the Pacific Ocean - LP-53 | Environmental | Open in IMG/M |
| 3300001589 | Marine viral communities from the Pacific Ocean - LP-40 | Environmental | Open in IMG/M |
| 3300005427 | Marine microbial and viral communities from oxygen minimum zone, Eastern Pacific Ocean - ETNP201406SV65 | Environmental | Open in IMG/M |
| 3300006190 | Marine microbial communities from the West Antarctic Peninsula - Coastal water metaG058-DNA | Environmental | Open in IMG/M |
| 3300006193 | Marine microbial communities from the West Antarctic Peninsula - Coastal water metaG029-DNA | Environmental | Open in IMG/M |
| 3300006737 | Marine viral communities from the Subarctic Pacific Ocean - 5_ETSP_OMZ_AT15132 metaG | Environmental | Open in IMG/M |
| 3300006793 | Marine viral communities from the Subarctic Pacific Ocean - 17_ETSP_OMZ_AT15314 metaG | Environmental | Open in IMG/M |
| 3300006920 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_12 | Environmental | Open in IMG/M |
| 3300006924 | Marine viral communities from the Subarctic Pacific Ocean - 14B_ETSP_OMZ_AT15311_CsCl metaG | Environmental | Open in IMG/M |
| 3300006947 | Marine microbial communities from the West Antarctic Peninsula - Coastal water metaG017-DNA | Environmental | Open in IMG/M |
| 3300007956 | Coastal water column microbial communities from Columbia River Estuary, Oregon, USA - CMOP_DNA_1459A_0.2um | Environmental | Open in IMG/M |
| 3300009071 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_120405 | Environmental | Open in IMG/M |
| 3300009080 | Estuarine microbial communities from the Columbia River estuary - Ebb tide ETM metaG S.759 | Environmental | Open in IMG/M |
| 3300009193 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_110321 | Environmental | Open in IMG/M |
| 3300009409 | Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB2_150 | Environmental | Open in IMG/M |
| 3300009425 | Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB4_136 | Environmental | Open in IMG/M |
| 3300009428 | Marine viral communities from the Global Malaspina Expedition - Malaspina viral metaG Antarct_55 | Environmental | Open in IMG/M |
| 3300009440 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_110512 | Environmental | Open in IMG/M |
| 3300009441 | Marine eukaryotic phytoplankton communities from Arctic Ocean - Arctic Ocean ARC135M Metagenome | Environmental | Open in IMG/M |
| 3300009497 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_120503 | Environmental | Open in IMG/M |
| 3300009508 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_120412 | Environmental | Open in IMG/M |
| 3300009526 | Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB11_90 | Environmental | Open in IMG/M |
| 3300009544 | Marine eukaryotic phytoplankton communities from Arctic Ocean - Arctic Ocean- Svalbard ARC20M Metagenome | Environmental | Open in IMG/M |
| 3300009785 | Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB8_130 | Environmental | Open in IMG/M |
| 3300010883 | western Arctic Ocean co-assembly | Environmental | Open in IMG/M |
| 3300017714 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 35 SPOT_SRF_2012-08-15 | Environmental | Open in IMG/M |
| 3300017731 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 39 SPOT_SRF_2013-01-16 | Environmental | Open in IMG/M |
| 3300017772 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 53 SPOT_SRF_2014-04-10 | Environmental | Open in IMG/M |
| 3300020165 | Pelagic subsurface seawater microbial communities from Kabeltonne, Helgoland, North Sea - Helgoland_Spring_Bloom_20160331_1 | Environmental | Open in IMG/M |
| 3300020169 | Pelagic subsurface seawater microbial communities from Kabeltonne, Helgoland, North Sea - Helgoland_Spring_Bloom_20160419_1 | Environmental | Open in IMG/M |
| 3300020309 | Marine microbial communities from Tara Oceans - TARA_B100000795 (ERX556064-ERR599104) | Environmental | Open in IMG/M |
| 3300020358 | Marine microbial communities from Tara Oceans - TARA_B100000768 (ERX555925-ERR599009) | Environmental | Open in IMG/M |
| 3300020376 | Marine microbial communities from Tara Oceans - TARA_B100000795 (ERX555997-ERR599121) | Environmental | Open in IMG/M |
| 3300020382 | Marine microbial communities from Tara Oceans - TARA_B100000780 (ERX556058-ERR599059) | Environmental | Open in IMG/M |
| 3300020388 | Marine microbial communities from Tara Oceans - TARA_B100001063 (ERX555965-ERR599064) | Environmental | Open in IMG/M |
| 3300020396 | Marine microbial communities from Tara Oceans - TARA_B100000767 (ERX555915-ERR599122) | Environmental | Open in IMG/M |
| 3300020447 | Marine microbial communities from Tara Oceans - TARA_B100000745 (ERX556090-ERR599159) | Environmental | Open in IMG/M |
| 3300020475 | Marine microbial communities from Tara Oceans - TARA_B100002029 (ERX555951-ERR599001) | Environmental | Open in IMG/M |
| 3300020595 | Pelagic subsurface seawater microbial communities from Kabeltonne, Helgoland, North Sea - Helgoland_Spring_Bloom_20160412_1 | Environmental | Open in IMG/M |
| 3300021365 | Pelagic subsurface seawater microbial communities from Kabeltonne, Helgoland, North Sea - Helgoland_Spring_Bloom_20160316_1 | Environmental | Open in IMG/M |
| 3300021389 | Coastal seawater microbial communities near Pivers Island, North Carolina, United States - PICO127 | Environmental | Open in IMG/M |
| 3300021957 | Estuarine water microbial communities from San Francisco Bay, California, United States - C33_18D | Environmental | Open in IMG/M |
| 3300021960 | Estuarine water microbial communities from San Francisco Bay, California, United States - C33_9D | Environmental | Open in IMG/M |
| 3300022072 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_12 (v3) | Environmental | Open in IMG/M |
| 3300022920 (restricted) | Seawater microbial communities from Saanich Inlet, British Columbia, Canada - SI_118_April2016_10_MG | Environmental | Open in IMG/M |
| 3300024237 | Seawater microbial communities from Monterey Bay, California, United States - 65D | Environmental | Open in IMG/M |
| 3300024260 (restricted) | Seawater microbial communities from Saanich Inlet, British Columbia, Canada - SI_123_September2016_135_MG | Environmental | Open in IMG/M |
| 3300024264 (restricted) | Seawater microbial communities from Saanich Inlet, British Columbia, Canada - SI_124_October2016_10_MG | Environmental | Open in IMG/M |
| 3300024339 (restricted) | Seawater microbial communities from Saanich Inlet, British Columbia, Canada - SI_124_October2016_100_MG | Environmental | Open in IMG/M |
| 3300024346 | Whole water sample coassembly | Environmental | Open in IMG/M |
| 3300025085 | Marine viral communities from the Subarctic Pacific Ocean - 14_ETSP_OMZ_AT15311 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025138 | Marine viral communities from the Pacific Ocean - LP-40 (SPAdes) | Environmental | Open in IMG/M |
| 3300025168 | Marine viral communities from the Pacific Ocean - LP-53 (SPAdes) | Environmental | Open in IMG/M |
| 3300025570 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_30_>0.8_DNA (SPAdes) | Environmental | Open in IMG/M |
| 3300025626 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_120531 (SPAdes) | Environmental | Open in IMG/M |
| 3300025645 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_12 (SPAdes) | Environmental | Open in IMG/M |
| 3300025654 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_110509 (SPAdes) | Environmental | Open in IMG/M |
| 3300025685 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_110404 (SPAdes) | Environmental | Open in IMG/M |
| 3300025690 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_110331 (SPAdes) | Environmental | Open in IMG/M |
| 3300025699 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_120503 (SPAdes) | Environmental | Open in IMG/M |
| 3300025832 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_110530 (SPAdes) | Environmental | Open in IMG/M |
| 3300025881 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_120412 (SPAdes) | Environmental | Open in IMG/M |
| 3300025890 | Pelagic Microbial community sample from North Sea - COGITO 998_met_08 (SPAdes) | Environmental | Open in IMG/M |
| 3300025897 | Pelagic Microbial community sample from North Sea - COGITO 998_met_05 (SPAdes) | Environmental | Open in IMG/M |
| 3300027631 | Estuarine microbial communities from the Columbia River estuary, USA - metaG S.535 (SPAdes) | Environmental | Open in IMG/M |
| 3300027672 | Marine microbial communities from the West Antarctic Peninsula - Coastal water metaG029-DNA (SPAdes) | Environmental | Open in IMG/M |
| 3300027753 | Estuarine microbial communities from the Columbia River estuary - Flood tide ETM metaG S.741 (SPAdes) | Environmental | Open in IMG/M |
| 3300027779 | Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB4_136 (SPAdes) | Environmental | Open in IMG/M |
| 3300027813 | Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB2_152 (SPAdes) | Environmental | Open in IMG/M |
| 3300027827 | Marine microbial communities from the Southern Atlantic Ocean, analyzing organic carbon cycling - AAIW_A/KNORR_S2/LV (SPAdes) | Environmental | Open in IMG/M |
| 3300027847 | Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB8_126 (SPAdes) | Environmental | Open in IMG/M |
| 3300027883 | Marine eukaryotic phytoplankton communities from Arctic Ocean - Arctic Ocean- Svalbard ARC20M Metagenome (SPAdes) | Environmental | Open in IMG/M |
| 3300028194 | Marine microbial communities from Northeast Subartic Pacific Ocean, Canada - LP_J_2011_P26_10m | Environmental | Open in IMG/M |
| 3300031142 | Marine microbial communities from water near the shore, Antarctic Ocean - #353 | Environmental | Open in IMG/M |
| 3300031143 | Marine microbial communities from water near the shore, Antarctic Ocean - #422 | Environmental | Open in IMG/M |
| 3300031175 | Marine microbial communities from water near the shore, Antarctic Ocean - #349 | Environmental | Open in IMG/M |
| 3300031510 | Marine microbial communities from water near the shore, Antarctic Ocean - #129 | Environmental | Open in IMG/M |
| 3300031519 | Sea-ice brine microbial communities from Beaufort Sea near Barrow, Alaska, United States - SB 0.2 | Environmental | Open in IMG/M |
| 3300031598 | Marine microbial communities from water near the shore, Antarctic Ocean - #284 | Environmental | Open in IMG/M |
| 3300031630 | Marine microbial communities from water near the shore, Antarctic Ocean - #38 | Environmental | Open in IMG/M |
| 3300031638 | Marine microbial communities from Western Arctic Ocean, Canada - CB4_surface | Environmental | Open in IMG/M |
| 3300031659 | Marine microbial communities from Ellis Fjord, Antarctic Ocean - #82 | Environmental | Open in IMG/M |
| 3300031721 | Marine microbial communities from water near the shore, Antarctic Ocean - #181 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
Note: Some of these sequences are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| DelMOSpr2010_101075191 | 3300000116 | Marine | MLIIHRRLKTEPDAEWDFHELSTDKFPGGFARESDWA |
| JGI20158J14315_100691893 | 3300001355 | Pelagic Marine | MLIIHRRLKTEPDAEWDFHELSSDKFPGGFARESDWAVRYKRRND |
| JGI24006J15134_101132713 | 3300001450 | Marine | MLTVQTRLKSNPDSDWEFYEIMADWTKGGFQRESEWAVTYKRRNT |
| JGI24006J15134_101707323 | 3300001450 | Marine | MLTVQRRLKEXPDSEWEFHELSLDKFPGGFQRESNWAVT |
| JGI24005J15628_101526601 | 3300001589 | Marine | MLTVQRRLKEQPDSEWEFHELSLDKFPGGFQRESNWAVTYKRR |
| Ga0066851_102127682 | 3300005427 | Marine | MLIIHKRLKTEPDAEWDFHELSTDKFPGGFARESDWALRYKRR |
| Ga0075446_101666691 | 3300006190 | Marine | MLTVQTRLKLEPDSEWQFHELSLDKFPGGFQRESEWA |
| Ga0075446_101959661 | 3300006190 | Marine | MLTVQTRLKSNPDSEWEFHELSLDKFPGGFQRESEWAVKYKRRN |
| Ga0075445_102974242 | 3300006193 | Marine | MLTVQTRLKSEPDSEWEFHELSLDKFPGGFQRESEWAVK |
| Ga0098037_10778861 | 3300006737 | Marine | MLIVHRRLKTEPDAEWHFHEIMSDWFPGGFARETDWALRYKRRND |
| Ga0098055_10356265 | 3300006793 | Marine | MLIVHKRLKTEPDAEWDFHELSTDKFPGGFARETDWALRY |
| Ga0098055_10608463 | 3300006793 | Marine | MLIVHKRLKTEPDAEWHFHEIMSDWFPGGFQRETDWALRYKRRN |
| Ga0070748_12145182 | 3300006920 | Aqueous | MLIVHRRLKTEPDTEWEFHELSSDKFPGGFARESDWAVRYKRR |
| Ga0098051_10835893 | 3300006924 | Marine | MLIVHKRLKTEPDAEWRFHELSTDKFPGGFARESDWALRYKRR |
| Ga0075444_103589022 | 3300006947 | Marine | MLTVQTRLKSEPDSEWEFHELSLDKFPGGFQRESEWAVKY |
| Ga0105741_11395622 | 3300007956 | Estuary Water | MLTVQTRLKSEPDSEWEFHELSLDKFPGGFERESNWAVIYKRR |
| Ga0115566_101240394 | 3300009071 | Pelagic Marine | MLIVHKRLKTEPDAEWHFHEITSDKFPGGFQRETDWALRYKRRNDD |
| Ga0102815_108694242 | 3300009080 | Estuarine | MLTVQTRLKSEPDADWEFYEIMADWTKGGFQRESEWA |
| Ga0115551_10782461 | 3300009193 | Pelagic Marine | MLIVQKRLKTEPAAEWHFHEIMSDWFPGGFARETDWAL |
| Ga0114993_106137323 | 3300009409 | Marine | MLTVQTRLKSEPDADWNFYEIMADWTKGGFQRESEWAVTYKRRNTDPK |
| Ga0114997_101951012 | 3300009425 | Marine | MLTVQRRLKEHTNSEWEFHELSLDKFPGGFQRESEWAV |
| Ga0114915_10254565 | 3300009428 | Deep Ocean | MLTVQTRLKSEPDSEWQFHELSLDKFPGGFQRESEWAVKYKRRNTD |
| Ga0115561_11178172 | 3300009440 | Pelagic Marine | MLIVHKRLKTEPDAEWDFHELSSDKFPGGFARESDWAVRYKRRNDS |
| Ga0115561_11542262 | 3300009440 | Pelagic Marine | MLIIHRRLKTEPDAEWDFHELSSDKFPGGFARESDWAVRYKRRNDS |
| Ga0115007_101377541 | 3300009441 | Marine | MLTVQRRLKEQPDSEWEFHELSLDKFPGGFQRESNWAVT |
| Ga0115569_103428272 | 3300009497 | Pelagic Marine | MLIVHKRLKTEPNAEWDFHELSSDKFPGGFARESDWAVRYKRRNDS |
| Ga0115567_101540923 | 3300009508 | Pelagic Marine | MLIIHRRLKTEPDAEWDFHELSTDKFPGGFARESDWAVRYKRR |
| Ga0115567_107285511 | 3300009508 | Pelagic Marine | MLIVHRRLKTEPDTEWEFHELSSDKFPGGFARESDWAVRYKRRN |
| Ga0115004_105444422 | 3300009526 | Marine | MLTVQTRLKSEPDADWEFYEIMADWTKGGFQRESEWAVTYKRRN |
| Ga0115006_118079322 | 3300009544 | Marine | MLIVQKRLKTEPDAEWDFHELSTDKFPGGFQRESDWAVRYKRRNDNP |
| Ga0115001_107526722 | 3300009785 | Marine | MLTVQTRLKSEPDADWQFYEIMADWTKGGFQRESDWAVTYKRR |
| Ga0133547_116448251 | 3300010883 | Marine | MLTVQRRLKEHTNSEWEFHELSLDKFPGGFQRESNWAVT |
| Ga0181412_11223161 | 3300017714 | Seawater | MLIIHRRLKTEPDAEWDFHELSTDKFPGGFARESDWAVRYKRRNDS |
| Ga0181416_10142985 | 3300017731 | Seawater | MLIIHRRLKTEPDAEWDFHELSSDKFPGGFARESDWAVRYKRRNDSP |
| Ga0181430_10118865 | 3300017772 | Seawater | MLIIHRRLKTEPDAEWDFHELSTDKFPGGFQRESNWAVTYN |
| Ga0206125_101117973 | 3300020165 | Seawater | MLIIHRRLKTEPDAEWDFHELSTDKFPGGFQRESDW |
| Ga0206127_11252291 | 3300020169 | Seawater | MLIIHRRLKTEPDAEWDFHELSSDKFPGGFARESDWAVRYKRRN |
| Ga0211681_10103991 | 3300020309 | Marine | MLTVHTRLKSEPDADWEFYELSLDKFAGGFQRESEWAVKYKRRN |
| Ga0211689_10552081 | 3300020358 | Marine | MLTVQTRLKSEPDADWQFYEIMADWTKGGFQRESE |
| Ga0211682_102126263 | 3300020376 | Marine | MLTVHTRLKSESDSEWEFHELSLDKFPGGFQRESEWA |
| Ga0211686_103786191 | 3300020382 | Marine | MLTVQTRLKSEPDSEWEFHELSLDKFPGGFQRESEWAV |
| Ga0211678_100551701 | 3300020388 | Marine | MLIVQKRLKTEPDAEWHFHEIMSDWFPGGFARETDWALRYKR |
| Ga0211678_100724114 | 3300020388 | Marine | MLIVHKRLKTEPDAEWHFHELSSDKFPGGFARESDWAVRYK |
| Ga0211687_100378151 | 3300020396 | Marine | MLTVQTRLKSEPDADWQFYEIMADWTKGGFQRESEWAVTYKRR |
| Ga0211687_100680381 | 3300020396 | Marine | MLTVKTRLKDEPESDWEFYEIMADWTKGGFQRESEWAVT |
| Ga0211691_101956191 | 3300020447 | Marine | MLTVQTRLKSEPDADWEFYEIMADWTKGGFQRESEWAVTYKRRNT |
| Ga0211541_104780823 | 3300020475 | Marine | MLIVHKRLKTEPDAEWHFHELSSDWFPGGFERETD |
| Ga0206126_100504114 | 3300020595 | Seawater | MLIVHRRLKTEPDTEWEFHELSSDKFPGGFARESDW |
| Ga0206123_104728671 | 3300021365 | Seawater | MLIIHRRLKTEPDAEWDFHELSSDKFPGGFARESDWAVRYK |
| Ga0213868_101138501 | 3300021389 | Seawater | MLIVHKRLKTEPDAEWDFHELSTDKFPGGFARESNWAVRYKRR |
| Ga0222717_101247511 | 3300021957 | Estuarine Water | MLIIHRRLKTEPDAEWDFHELSSDKFPGGFARESD |
| Ga0222717_106001832 | 3300021957 | Estuarine Water | MLIVHRRLKTEPDAEWDFHELSSDKFPGGFARESDW |
| Ga0222715_101290723 | 3300021960 | Estuarine Water | MLIIHRRLKTEPDAEWDFHELSSDKFPGGFARESDWA |
| Ga0196889_10363281 | 3300022072 | Aqueous | MLIVHKRLKTEPDAEWDFHELSTDKFPGGFARESDWAVRYKRRN |
| (restricted) Ga0233426_101887111 | 3300022920 | Seawater | MLIVQKRLKTEPDAEWDFHELSCDKFPGGFQRESDWAVTYK |
| Ga0228653_10521783 | 3300024237 | Seawater | MLIIHRRLKTEPDAEWDFHELSSDKFPGGFARESDW |
| (restricted) Ga0233441_11484852 | 3300024260 | Seawater | MLIVQKRLKTEPDAEWDFHELSSDKFPGGFARESDWAVRYK |
| (restricted) Ga0233444_101250861 | 3300024264 | Seawater | MLIVQKRLKTEPDAEWDFHELSTDKFPGGFQRESDWAVRYKRR |
| (restricted) Ga0233445_11197041 | 3300024339 | Seawater | MLIVQKRLKTEPDAEWDFHELSSDKFPGGFARESDWAVRYKRRN |
| Ga0244775_113440121 | 3300024346 | Estuarine | MLIVQKRLKTEPDAEWDFHELSTDKFPGGFQRESDWAVRYK |
| Ga0208792_10936311 | 3300025085 | Marine | MLIVHKRLKTEPDAEWDFHELSTDKFPGGFARETDWALRYK |
| Ga0209634_10412751 | 3300025138 | Marine | MLTVQRRLKEHTNSEWEFHELSLDKFPGGFQRESNWAV |
| Ga0209634_12234301 | 3300025138 | Marine | MLTVQRRLKEQPDSEWEFHELSLDKFPGGFQRESNWAVTYKRRNS |
| Ga0209337_10167601 | 3300025168 | Marine | MLTVQTRLKSEPDADWEFYEIMADWTKGGFQRESEWAVT |
| Ga0208660_10258811 | 3300025570 | Aqueous | MLIVHKRLKTEPDAEWDFHELSTDKFPGGFARESNWAVRYKRRNDSPT |
| Ga0209716_11374251 | 3300025626 | Pelagic Marine | MLIVHKRLKTEPDAEWHFHELSSDWFPGGFARETD |
| Ga0208643_10527771 | 3300025645 | Aqueous | MLIVHKRLKTEPDAEWHFHELSSDKFPGGFARESDWAVRYKRR |
| Ga0209196_10986552 | 3300025654 | Pelagic Marine | MLIIHRRLKTEPDAEWDFHELSSDKFPGGFARESDWAVRYKRR |
| Ga0209095_11163501 | 3300025685 | Pelagic Marine | MLIVHKRLKTEPDAEWDFHELSSDKFPGGFARESDWAVRYKRRN |
| Ga0209505_10595773 | 3300025690 | Pelagic Marine | MLIIHKRLKTEPDAEWHFHEITSDWFPGGFQRETDWALRYKRRN |
| Ga0209715_10786491 | 3300025699 | Pelagic Marine | MLIVHKRLKTEPDAEWDFHELSSDKFPGGFARESDWAVR |
| Ga0209715_10807881 | 3300025699 | Pelagic Marine | MLIIHRRLKTEPDAEWDFHELSSDKFPGGFARESDWAVRYKR |
| Ga0209307_12192381 | 3300025832 | Pelagic Marine | MLIVHKRLKTEPDAEWDFHELSSDKFPGGFARESDWAVRYKR |
| Ga0209309_101820372 | 3300025881 | Pelagic Marine | MLIVHRRLKTEPDTEWEFHELSSDKFPGGFARESDWAVRYKR |
| Ga0209631_103005572 | 3300025890 | Pelagic Marine | MLIVHKRLKTEPDAEWHFHELSSDWFPGGFERETDWAL |
| Ga0209425_101900692 | 3300025897 | Pelagic Marine | MLIVHKRLKTEPDAEWDFHELSTDKFPGGFARESNWAVRYKR |
| Ga0208133_10976011 | 3300027631 | Estuarine | MLIVQKRLKTEPDAEWDFHELSTDKFPGGFARESDWAVRY |
| Ga0209383_10770172 | 3300027672 | Marine | MLTVQTRLKSEPDSEWQFHELSLDKFPGGFQRESE |
| Ga0209383_10853991 | 3300027672 | Marine | MLTVQTRLKSEPDSEWEFHELSLDKFPGGFQRESEWAVKMRI |
| Ga0208305_100749191 | 3300027753 | Estuarine | MLIIHRRLKTEPDAEWDFHELSSDKFPGGFARESNWAVRYKR |
| Ga0209709_102610221 | 3300027779 | Marine | MLTVQTRLKSEPDADWEFYEIMADWTKGGFQRESEWAVTYKRRNTD |
| Ga0209090_102461352 | 3300027813 | Marine | MLIVQKRLKTEPDAEWDFHELSTDKFPGGFQRESDWAV |
| Ga0209035_104275302 | 3300027827 | Marine | MLTVQTRLKSNPDADWEFYEIMADWTKGGFQRESEWAVTYK |
| Ga0209402_106921002 | 3300027847 | Marine | MLTVQRRLKEHQNSEWEFHEISLDKFPGGFQRESNWAVTYKRRNSDP |
| Ga0209713_109929002 | 3300027883 | Marine | MLTVQKRLKEQPDSEWEFHELSLDKFPGGFQRESNWAVTYKRRNSDP |
| Ga0257106_11636501 | 3300028194 | Marine | MLTVQRRLKEHTNSEWEFHELSLDKFPGGFQRESNW |
| Ga0308022_10321911 | 3300031142 | Marine | MLTVQTRLKSEPDSEWQFHELSLDKFPGGFQRESEWAVKYKRRNTDP |
| Ga0308022_11921151 | 3300031142 | Marine | MLTVQTRLKSNPDSEWEFHELSLDKFPGGFQRESEWAVKYKR |
| Ga0308025_11712492 | 3300031143 | Marine | MLTVQTRLKSNPDSEWEFHELSLDKFPGGFQRESEWA |
| Ga0308020_10135001 | 3300031175 | Marine | MLTVHTRLKSESDSEWEFHELSLDKFPGGFQRESEWAVKYK |
| Ga0308010_10303311 | 3300031510 | Marine | MLTVQTRLKSEPDSEWQFHELSLDKFPGGFQRESEWA |
| Ga0308010_12568262 | 3300031510 | Marine | MLTVQTRLKSNPDSEWEFHELSLDKFPGGFQRESEWAVKYKRRNTDP |
| Ga0307488_102164501 | 3300031519 | Sackhole Brine | MLTVQRKLKEHTNSEWEFHEISLDKFPGGFQRESN |
| Ga0307488_107730531 | 3300031519 | Sackhole Brine | MLTVQRKLKEQPDSEWEFHEISLDKFPGGFQRESNWAV |
| Ga0308019_100486241 | 3300031598 | Marine | MLTVQTRLKSEPDSEWQFHELSLDKFPGGFQRESEW |
| Ga0308019_101251903 | 3300031598 | Marine | MLTVQRRLKEHTNSEWEFHEISLDKFPGGFQRESNW |
| Ga0308019_101599971 | 3300031598 | Marine | MLTVQTRLKSNPDSEWEFHELSLDKFPGGFQRESEWAVK |
| Ga0308019_103825682 | 3300031598 | Marine | MLTVQTRLKSNPDSEWEFHELSLDKFPGGFQRESE |
| Ga0308004_101668742 | 3300031630 | Marine | MLTVQTRLKSEPDSEWEFHELSLDKFPGGFQRESEWAVKYKRRNT |
| Ga0302125_102420322 | 3300031638 | Marine | MLTVQRKLKEQPDSEWEFHEISLDKFPGGFQRESNW |
| Ga0307986_103701572 | 3300031659 | Marine | MLTVQTRLKSEPDSEWEFHELSLDKFPGGFQRESEWAVKYK |
| Ga0308013_102016031 | 3300031721 | Marine | MLTVQTRLKSEPDSEWQFHELSLDKFPGGFQRESDWAV |
| ⦗Top⦘ |