Basic Information | |
---|---|
Family ID | F101468 |
Family Type | Metagenome |
Number of Sequences | 102 |
Average Sequence Length | 49 residues |
Representative Sequence | MLAKYILLTLAVVFLFAALTRGPRTIQGRTWLLIAAIFGIVSTWLFARG |
Number of Associated Samples | 82 |
Number of Associated Scaffolds | 102 |
Quality Assessment | |
---|---|
Transcriptomic Evidence | No |
Most common taxonomic group | Bacteria |
% of genes with valid RBS motifs | 41.18 % |
% of genes near scaffold ends (potentially truncated) | 32.35 % |
% of genes from short scaffolds (< 2000 bps) | 69.61 % |
Associated GOLD sequencing projects | 72 |
AlphaFold2 3D model prediction | Yes |
3D model pTM-score | 0.76 |
Hidden Markov Model |
---|
Powered by Skylign |
Most Common Taxonomy | |
---|---|
Group | Bacteria (84.314 % of family members) |
NCBI Taxonomy ID | 2 |
Taxonomy | All Organisms → cellular organisms → Bacteria |
Most Common Ecosystem | |
---|---|
GOLD Ecosystem | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere (9.804 % of family members) |
Environment Ontology (ENVO) | Unclassified (33.333 % of family members) |
Earth Microbiome Project Ontology (EMPO) | Host-associated → Plant → Plant rhizosphere (64.706 % of family members) |
⦗Top⦘ |
⦗Top⦘ |
Predicted Topology & Secondary Structure | |||||
---|---|---|---|---|---|
Classification: | Transmembrane (alpha-helical) | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 55.84% β-sheet: 0.00% Coil/Unstructured: 44.16% | Feature Viewer |
|
|||||
Powered by Feature Viewer |
Structure Viewer | |
---|---|
| |
Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.76 |
Powered by PDBe Molstar |
SCOP family | SCOP domain | Representative PDB | TM-score |
---|---|---|---|
a.25.1.2: Ribonucleotide reductase-like | d2uw1a_ | 2uw1 | 0.88058 |
f.63.1.1: Claudin | d3jbre_ | 3jbr | 0.87045 |
a.138.1.3: Di-heme elbow motif | d3bnja_ | 3bnj | 0.85898 |
a.25.1.2: Ribonucleotide reductase-like | d1za0a1 | 1za0 | 0.85112 |
a.25.1.0: automated matches | d2c2ua_ | 2c2u | 0.85023 |
⦗Top⦘ |
Pfam ID | Name | % Frequency in 102 Family Scaffolds |
---|---|---|
PF14568 | SUKH_6 | 7.84 |
PF15538 | Ntox46 | 6.86 |
PF09346 | SMI1_KNR4 | 5.88 |
PF13665 | Tox-PAAR-like | 2.94 |
PF05593 | RHS_repeat | 2.94 |
PF06715 | Gp5_C | 2.94 |
PF09937 | DUF2169 | 1.96 |
PF08924 | DUF1906 | 1.96 |
PF00535 | Glycos_transf_2 | 0.98 |
PF05493 | ATP_synt_H | 0.98 |
PF05488 | PAAR_motif | 0.98 |
PF06904 | Extensin-like_C | 0.98 |
PF16861 | Carbam_trans_C | 0.98 |
PF00459 | Inositol_P | 0.98 |
PF15635 | Tox-GHH2 | 0.98 |
PF11876 | DUF3396 | 0.98 |
COG ID | Name | Functional Category | % Frequency in 102 Family Scaffolds |
---|---|---|---|
COG3209 | Uncharacterized conserved protein RhaS, contains 28 RHS repeats | General function prediction only [R] | 2.94 |
COG3921 | Uncharacterized conserved protein, contains Extensin-like_C domain | Function unknown [S] | 0.98 |
COG4104 | Zn-binding Pro-Ala-Ala-Arg (PAAR) domain, involved in Type VI secretion | Intracellular trafficking, secretion, and vesicular transport [U] | 0.98 |
⦗Top⦘ |
Name | Rank | Taxonomy | Distribution |
All Organisms | root | All Organisms | 84.31 % |
Unclassified | root | N/A | 15.69 % |
Visualization |
---|
Powered by ApexCharts |
Scaffold | Taxonomy | Length | IMG/M Link |
---|---|---|---|
2140918013|NODE_10333_length_1032_cov_6.128876 | Not Available | 1064 | Open in IMG/M |
2162886012|MBSR1b_contig_4497275 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2173 | Open in IMG/M |
2162886013|SwBSRL2_contig_1950724 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1653 | Open in IMG/M |
3300000033|ICChiseqgaiiDRAFT_c0868188 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 1561 | Open in IMG/M |
3300000033|ICChiseqgaiiDRAFT_c0870008 | All Organisms → cellular organisms → Bacteria | 1102 | Open in IMG/M |
3300000956|JGI10216J12902_105493796 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 898 | Open in IMG/M |
3300002128|JGI24036J26619_10006364 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2088 | Open in IMG/M |
3300002568|C688J35102_119963948 | Not Available | 829 | Open in IMG/M |
3300003319|soilL2_10290022 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2051 | Open in IMG/M |
3300004058|Ga0055498_10062254 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales | 685 | Open in IMG/M |
3300004114|Ga0062593_100322468 | All Organisms → cellular organisms → Bacteria | 1331 | Open in IMG/M |
3300004114|Ga0062593_100480871 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1143 | Open in IMG/M |
3300004643|Ga0062591_100011379 | All Organisms → cellular organisms → Bacteria | 3854 | Open in IMG/M |
3300004643|Ga0062591_100332311 | All Organisms → cellular organisms → Bacteria | 1216 | Open in IMG/M |
3300005093|Ga0062594_101143358 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 765 | Open in IMG/M |
3300005093|Ga0062594_103275950 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 508 | Open in IMG/M |
3300005290|Ga0065712_10002350 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 7173 | Open in IMG/M |
3300005294|Ga0065705_10215052 | All Organisms → cellular organisms → Bacteria | 1348 | Open in IMG/M |
3300005328|Ga0070676_10017953 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 3917 | Open in IMG/M |
3300005329|Ga0070683_100158040 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2150 | Open in IMG/M |
3300005329|Ga0070683_100260234 | All Organisms → cellular organisms → Bacteria | 1650 | Open in IMG/M |
3300005331|Ga0070670_100054287 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 3440 | Open in IMG/M |
3300005354|Ga0070675_101090359 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 734 | Open in IMG/M |
3300005355|Ga0070671_100506761 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1038 | Open in IMG/M |
3300005356|Ga0070674_100024388 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 3925 | Open in IMG/M |
3300005356|Ga0070674_100061626 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2619 | Open in IMG/M |
3300005367|Ga0070667_100541557 | All Organisms → cellular organisms → Bacteria | 1069 | Open in IMG/M |
3300005543|Ga0070672_100586077 | Not Available | 970 | Open in IMG/M |
3300005548|Ga0070665_101329561 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 728 | Open in IMG/M |
3300005616|Ga0068852_101676189 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 658 | Open in IMG/M |
3300005617|Ga0068859_100315801 | All Organisms → cellular organisms → Bacteria | 1656 | Open in IMG/M |
3300005618|Ga0068864_100756579 | All Organisms → cellular organisms → Bacteria | 952 | Open in IMG/M |
3300005713|Ga0066905_102065904 | Not Available | 530 | Open in IMG/M |
3300005764|Ga0066903_100061238 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → Desulfobacteraceae → Desulfosarcina → Desulfosarcina variabilis | 4706 | Open in IMG/M |
3300005840|Ga0068870_10333948 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 967 | Open in IMG/M |
3300005844|Ga0068862_100036251 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 4181 | Open in IMG/M |
3300006196|Ga0075422_10041034 | All Organisms → cellular organisms → Bacteria | 1647 | Open in IMG/M |
3300006844|Ga0075428_100389744 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1493 | Open in IMG/M |
3300006852|Ga0075433_10232494 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1637 | Open in IMG/M |
3300006854|Ga0075425_100400759 | All Organisms → cellular organisms → Bacteria | 1581 | Open in IMG/M |
3300006854|Ga0075425_101151299 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Comamonadaceae → Variovorax → Variovorax paradoxus | 882 | Open in IMG/M |
3300006871|Ga0075434_100386206 | All Organisms → cellular organisms → Bacteria | 1421 | Open in IMG/M |
3300006904|Ga0075424_100028510 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 5765 | Open in IMG/M |
3300009147|Ga0114129_11952497 | All Organisms → cellular organisms → Bacteria | 711 | Open in IMG/M |
3300009553|Ga0105249_13032869 | Not Available | 539 | Open in IMG/M |
3300010046|Ga0126384_10045738 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 2990 | Open in IMG/M |
3300010047|Ga0126382_10156140 | All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium 5 | 1569 | Open in IMG/M |
3300010362|Ga0126377_11887596 | All Organisms → cellular organisms → Bacteria | 673 | Open in IMG/M |
3300010375|Ga0105239_13569786 | All Organisms → cellular organisms → Bacteria | 505 | Open in IMG/M |
3300010399|Ga0134127_11663433 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 713 | Open in IMG/M |
3300012212|Ga0150985_104934145 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1263 | Open in IMG/M |
3300012212|Ga0150985_105395284 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiaceae → Caballeronia | 3633 | Open in IMG/M |
3300012212|Ga0150985_112769762 | All Organisms → cellular organisms → Bacteria → Nitrospirae → Nitrospira → Nitrospirales → Nitrospiraceae → Nitrospira → Nitrospira defluvii | 8139 | Open in IMG/M |
3300012212|Ga0150985_121103492 | Not Available | 5226 | Open in IMG/M |
3300012469|Ga0150984_107074510 | All Organisms → cellular organisms → Bacteria | 1393 | Open in IMG/M |
3300012469|Ga0150984_119852737 | All Organisms → cellular organisms → Bacteria | 1571 | Open in IMG/M |
3300012899|Ga0157299_10027159 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales | 1137 | Open in IMG/M |
3300012944|Ga0137410_10061427 | All Organisms → cellular organisms → Bacteria | 2704 | Open in IMG/M |
3300012951|Ga0164300_10319960 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 820 | Open in IMG/M |
3300012961|Ga0164302_11359721 | All Organisms → cellular organisms → Bacteria | 577 | Open in IMG/M |
3300014254|Ga0075312_1077310 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 666 | Open in IMG/M |
3300014325|Ga0163163_10063195 | All Organisms → cellular organisms → Bacteria | 3670 | Open in IMG/M |
3300014326|Ga0157380_10255754 | All Organisms → cellular organisms → Bacteria | 1588 | Open in IMG/M |
3300015371|Ga0132258_10044204 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 10149 | Open in IMG/M |
3300015371|Ga0132258_10205576 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 4779 | Open in IMG/M |
3300015371|Ga0132258_10846127 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2308 | Open in IMG/M |
3300015371|Ga0132258_12075385 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1429 | Open in IMG/M |
3300015372|Ga0132256_100435691 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1416 | Open in IMG/M |
3300015373|Ga0132257_101664793 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Oceanospirillales → Alcanivoracaceae → Ketobacter → unclassified Ketobacter → Ketobacter sp. | 817 | Open in IMG/M |
3300015373|Ga0132257_103110018 | Not Available | 604 | Open in IMG/M |
3300015373|Ga0132257_103988681 | All Organisms → cellular organisms → Bacteria | 537 | Open in IMG/M |
3300015374|Ga0132255_100061912 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales | 4928 | Open in IMG/M |
3300015374|Ga0132255_100221392 | All Organisms → cellular organisms → Bacteria | 2689 | Open in IMG/M |
3300015374|Ga0132255_101534440 | Not Available | 1008 | Open in IMG/M |
3300018081|Ga0184625_10572678 | All Organisms → cellular organisms → Bacteria | 558 | Open in IMG/M |
3300018469|Ga0190270_13444826 | Not Available | 502 | Open in IMG/M |
3300018476|Ga0190274_11090498 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 877 | Open in IMG/M |
3300018481|Ga0190271_12785193 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 587 | Open in IMG/M |
3300021344|Ga0193719_10167788 | All Organisms → cellular organisms → Bacteria | 944 | Open in IMG/M |
3300022756|Ga0222622_11082843 | Not Available | 589 | Open in IMG/M |
3300025315|Ga0207697_10080812 | All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium 5 | 1369 | Open in IMG/M |
3300025925|Ga0207650_10161425 | All Organisms → cellular organisms → Bacteria | 1776 | Open in IMG/M |
3300025926|Ga0207659_10663769 | Not Available | 891 | Open in IMG/M |
3300025930|Ga0207701_10012498 | All Organisms → cellular organisms → Bacteria | 8306 | Open in IMG/M |
3300025931|Ga0207644_10878821 | All Organisms → cellular organisms → Bacteria | 751 | Open in IMG/M |
3300025936|Ga0207670_10297974 | All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium 5 | 1262 | Open in IMG/M |
3300025937|Ga0207669_10092521 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1973 | Open in IMG/M |
3300025944|Ga0207661_10226420 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiaceae → Caballeronia | 1654 | Open in IMG/M |
3300025945|Ga0207679_10146794 | All Organisms → cellular organisms → Bacteria | 1914 | Open in IMG/M |
3300025945|Ga0207679_10834089 | Not Available | 841 | Open in IMG/M |
3300026111|Ga0208291_1054223 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 718 | Open in IMG/M |
3300026142|Ga0207698_12183948 | All Organisms → cellular organisms → Bacteria | 566 | Open in IMG/M |
3300028380|Ga0268265_10040478 | All Organisms → cellular organisms → Bacteria | 3442 | Open in IMG/M |
3300030511|Ga0268241_10000713 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Comamonadaceae | 5735 | Open in IMG/M |
3300031538|Ga0310888_10000302 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 11428 | Open in IMG/M |
3300031938|Ga0308175_101658864 | Not Available | 715 | Open in IMG/M |
3300031938|Ga0308175_102270325 | Not Available | 608 | Open in IMG/M |
3300031943|Ga0310885_10000355 | All Organisms → cellular organisms → Bacteria | 10934 | Open in IMG/M |
3300031944|Ga0310884_10000674 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 9418 | Open in IMG/M |
3300031996|Ga0308176_11106321 | Not Available | 838 | Open in IMG/M |
3300032013|Ga0310906_10000047 | All Organisms → cellular organisms → Bacteria | 20793 | Open in IMG/M |
3300034417|Ga0364941_053040 | Not Available | 912 | Open in IMG/M |
⦗Top⦘ |
Habitat | Taxonomy | Distribution |
Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 9.80% |
Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 7.84% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 6.86% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 6.86% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere | 6.86% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 5.88% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 5.88% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 3.92% |
Avena Fatua Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Avena Fatua Rhizosphere | 3.92% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 3.92% |
Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 2.94% |
Corn Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere | 2.94% |
Switchgrass Rhizosphere | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Switchgrass Rhizosphere | 1.96% |
Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Corn, Switchgrass And Miscanthus Rhizosphere | 1.96% |
Natural And Restored Wetlands | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Natural And Restored Wetlands | 1.96% |
Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 1.96% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Miscanthus Rhizosphere | 1.96% |
Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 1.96% |
Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere | 1.96% |
Avena Fatua Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Avena Fatua Rhizosphere | 1.96% |
Natural And Restored Wetlands | Environmental → Aquatic → Marine → Wetlands → Unclassified → Natural And Restored Wetlands | 0.98% |
Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 0.98% |
Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 0.98% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 0.98% |
Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 0.98% |
Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 0.98% |
Sugarcane Root And Bulk Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Sugarcane Root And Bulk Soil | 0.98% |
Soil | Environmental → Terrestrial → Soil → Loam → Grasslands → Soil | 0.98% |
Switchgrass Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere | 0.98% |
Sediment | Environmental → Terrestrial → Floodplain → Sediment → Unclassified → Sediment | 0.98% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 0.98% |
Corn, Switchgrass And Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn, Switchgrass And Miscanthus Rhizosphere | 0.98% |
Switchgrass Rhizosphere | Host-Associated → Plants → Roots → Rhizosphere → Soil → Switchgrass Rhizosphere | 0.98% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.98% |
Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 0.98% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.98% |
Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Arabidopsis Rhizosphere | 0.98% |
Visualization |
---|
Powered by ApexCharts |
Taxon OID | Sample Name | Habitat Type | IMG/M Link |
---|---|---|---|
2140918013 | Soil microbial communities from Great Prairies - Iowa soil (MSU Assemblies) | Environmental | Open in IMG/M |
2162886012 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 | Host-Associated | Open in IMG/M |
2162886013 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 Bulk Soil | Environmental | Open in IMG/M |
3300000033 | Soil microbial communities from Great Prairies - Iowa, Continuous Corn soil | Environmental | Open in IMG/M |
3300000956 | Soil microbial communities from Great Prairies - Kansas, Native Prairie soil | Environmental | Open in IMG/M |
3300002128 | Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 | Environmental | Open in IMG/M |
3300002568 | Grasslands soil microbial communities from Hopland, California, USA - 2 | Environmental | Open in IMG/M |
3300003319 | Sugarcane bulk soil Sample L2 | Environmental | Open in IMG/M |
3300004058 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - Sandmound_ThreeSqB_D1 | Environmental | Open in IMG/M |
3300004114 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of AARS Block 5 | Environmental | Open in IMG/M |
3300004643 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Combined assembly of AARS Block 3 | Environmental | Open in IMG/M |
3300005093 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of KBS All Blocks | Environmental | Open in IMG/M |
3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 | Host-Associated | Open in IMG/M |
3300005294 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 Bulk Soil | Environmental | Open in IMG/M |
3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Host-Associated | Open in IMG/M |
3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Environmental | Open in IMG/M |
3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Host-Associated | Open in IMG/M |
3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Host-Associated | Open in IMG/M |
3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Host-Associated | Open in IMG/M |
3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Host-Associated | Open in IMG/M |
3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Host-Associated | Open in IMG/M |
3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Host-Associated | Open in IMG/M |
3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Host-Associated | Open in IMG/M |
3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Host-Associated | Open in IMG/M |
3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Host-Associated | Open in IMG/M |
3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Host-Associated | Open in IMG/M |
3300005713 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 36 (version 2) | Environmental | Open in IMG/M |
3300005764 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2) | Environmental | Open in IMG/M |
3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Host-Associated | Open in IMG/M |
3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Host-Associated | Open in IMG/M |
3300006196 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD1 | Host-Associated | Open in IMG/M |
3300006844 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Host-Associated | Open in IMG/M |
3300006852 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Host-Associated | Open in IMG/M |
3300006854 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD4 | Host-Associated | Open in IMG/M |
3300006871 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Host-Associated | Open in IMG/M |
3300006904 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD3 | Host-Associated | Open in IMG/M |
3300009147 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) | Host-Associated | Open in IMG/M |
3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Host-Associated | Open in IMG/M |
3300010046 | Tropical forest soil microbial communities from Panama - MetaG Plot_36 | Environmental | Open in IMG/M |
3300010047 | Tropical forest soil microbial communities from Panama - MetaG Plot_30 | Environmental | Open in IMG/M |
3300010362 | Tropical forest soil microbial communities from Panama - MetaG Plot_22 | Environmental | Open in IMG/M |
3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Host-Associated | Open in IMG/M |
3300010399 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-3 | Environmental | Open in IMG/M |
3300012212 | Combined assembly of Hopland grassland soil | Host-Associated | Open in IMG/M |
3300012469 | Combined assembly of Soil carbon rhizosphere | Host-Associated | Open in IMG/M |
3300012899 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S058-202B-2 | Environmental | Open in IMG/M |
3300012944 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
3300012951 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_226_MG | Environmental | Open in IMG/M |
3300012961 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_202_MG | Environmental | Open in IMG/M |
3300014254 | Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberryNE_CattailB_D2 | Environmental | Open in IMG/M |
3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Host-Associated | Open in IMG/M |
3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Host-Associated | Open in IMG/M |
3300015371 | Combined assembly of cpr5 and col0 rhizosphere and soil | Host-Associated | Open in IMG/M |
3300015372 | Soil combined assembly | Host-Associated | Open in IMG/M |
3300015373 | Combined assembly of cpr5 rhizosphere | Host-Associated | Open in IMG/M |
3300015374 | Col-0 rhizosphere combined assembly | Host-Associated | Open in IMG/M |
3300018081 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_30_b1 | Environmental | Open in IMG/M |
3300018469 | Populus adjacent soil microbial communities from riparian zone of Weber River, Utah, USA - 320 T | Environmental | Open in IMG/M |
3300018476 | Populus adjacent soil microbial communities from riparian zone of Yellowstone River, Montana, USA - 531 T | Environmental | Open in IMG/M |
3300018481 | Populus adjacent soil microbial communities from riparian zone of Weber River, Utah, USA - 356 T | Environmental | Open in IMG/M |
3300021344 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U2a2 | Environmental | Open in IMG/M |
3300022756 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM2_5_b1 | Environmental | Open in IMG/M |
3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) | Host-Associated | Open in IMG/M |
3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025930 | Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) | Environmental | Open in IMG/M |
3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) | Environmental | Open in IMG/M |
3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) | Environmental | Open in IMG/M |
3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300026111 | Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberrySE_CattailB_D1 (SPAdes) | Environmental | Open in IMG/M |
3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300030511 | Bulk soil microbial communities from Mexico - Amatitan (Am) metaG (v2) | Environmental | Open in IMG/M |
3300031538 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T20D1 | Environmental | Open in IMG/M |
3300031938 | Soil microbial communities from UC Gill Tract Community Farm, Albany, California, United States - DLSLS.C.R1 | Environmental | Open in IMG/M |
3300031943 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T60D2 | Environmental | Open in IMG/M |
3300031944 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T60D1 | Environmental | Open in IMG/M |
3300031996 | Soil microbial communities from UC Gill Tract Community Farm, Albany, California, United States - DLSLS.C.R2 | Environmental | Open in IMG/M |
3300032013 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C48D3 | Environmental | Open in IMG/M |
3300034417 | Sediment microbial communities from East River floodplain, Colorado, United States - 17_s17 | Environmental | Open in IMG/M |
Geographical Distribution | |
---|---|
Zoom: | Powered by OpenStreetMap |
⦗Top⦘ |
Protein ID | Sample Taxon ID | Habitat | Sequence |
Iowa-Corn-GraphCirc_00243460 | 2140918013 | Soil | MTAKYILATLAVIFLIAALTRGTRTSQGLTWLLIAAIFGIVSSWLFARG |
MBSR1b_0610.00007390 | 2162886012 | Miscanthus Rhizosphere | VLAKYILAALAVVFAIAALTRGPRSPQGRTWLRVAMIF |
SwBSRL2_0062.00003330 | 2162886013 | Switchgrass Rhizosphere | LTAKYILATLAIAFLLAALTRGPRTPQGRAWLLIAAIFGIVSAWLFARG |
ICChiseqgaiiDRAFT_08681882 | 3300000033 | Soil | MLAKYILLLLAVVFLFAAVIRGTRTPQGRTWLLIACLFGIVSSWLFARG* |
ICChiseqgaiiDRAFT_08700082 | 3300000033 | Soil | MTAKYILATLAVIFLIAALTRGTRTSQGLTWLLIAAIFGIVSSWLFARG* |
JGI10216J12902_1054937962 | 3300000956 | Soil | VAILAKYILAVLAVVFAIAAVTRGPDSPQGRTWLRVAMIFTAVSVWLFVQG* |
JGI24036J26619_100063643 | 3300002128 | Corn, Switchgrass And Miscanthus Rhizosphere | MLAKYILLTLSIVFLVAALTRGPRTPQGRAWLLIAAIFGIV |
C688J35102_1199639482 | 3300002568 | Soil | MIAKYILGGLAIVFLVAALTRGPGTPQGRIWLWIAIIFGIVSSWLFVKR* |
soilL2_102900222 | 3300003319 | Sugarcane Root And Bulk Soil | MLAKYILGGVAIAFLIAALTRGPRTPQGRTWLLIAAIFGIVSSWLFAKG* |
Ga0055498_100622541 | 3300004058 | Natural And Restored Wetlands | FGGLAFVFLAAALIRGPRSAQARTWLLIAAIFGIVSSWLFAYG* |
Ga0062593_1003224683 | 3300004114 | Soil | MLAKYILLSLAIAFLLAALTRGPRTIQGRTWLLIAAIFGIVSTWLFARG |
Ga0062593_1004808711 | 3300004114 | Soil | MLAKYILLTLAVIFLFAALTRGPRTIQGRTWLLIAAIFGIVSTWL |
Ga0062591_1000113792 | 3300004643 | Soil | LTAKYILATLAIAFLLAALTRGPRTPQGRAWLLIAAIFGIVSAWLFARG* |
Ga0062591_1003323113 | 3300004643 | Soil | LAKYILLTLAVIFLFAALTRGPRTIQGRTWLLIAAIFGIVSTWLFVKG* |
Ga0062594_1011433581 | 3300005093 | Soil | LTLAVIFLFAALTRGPRTIQGRTWLLIAAIFGIVSTWLFVKG* |
Ga0062594_1032759502 | 3300005093 | Soil | VLAKYILAALAVVFAIAALTRGPRSPQGRTWLRVAMIFTAVSIWLFVRG* |
Ga0065712_100023502 | 3300005290 | Miscanthus Rhizosphere | MLAKYILLILAVAFLLAALTRGPRTIQGRTWLLIAAIFGIVSTWLFVKG* |
Ga0065705_102150521 | 3300005294 | Switchgrass Rhizosphere | SHRGSICLTAKYILATLAIAFLLAALTRGPRTPQGRAWLLIAAIFGIVSAWLFARG* |
Ga0070676_100179535 | 3300005328 | Miscanthus Rhizosphere | LTAKYILATLAIAFVLAALTRGPRTPQGRAWLLIAAIFGIVSAWLFARG* |
Ga0070683_1001580404 | 3300005329 | Corn Rhizosphere | VAGRHLEYSMLAKYILLTLAVIFLFAALTRGPRTIQGRTWLLIAAIFGIVSTWLFVKG* |
Ga0070683_1002602342 | 3300005329 | Corn Rhizosphere | MLAKYILLILAVAFLLAALTRGPRTIQGRTWLLIAAIFGIVSTWLFARG* |
Ga0070670_1000542872 | 3300005331 | Switchgrass Rhizosphere | VAGRHLEYSMLAKYILLTLAVIFLFAALTRGPRTIHGRTWLLIAAIFGIVSTWLFVKG* |
Ga0070675_1010903591 | 3300005354 | Miscanthus Rhizosphere | MLAKYILLTLAVIFLFAALTRGPRTIQGRTWLLIAAIFGIVST |
Ga0070671_1005067612 | 3300005355 | Switchgrass Rhizosphere | MLAKYILLTLAVIFLFAALTRGPRTIQGRTWLLIAAIFGIVSTWLFARG* |
Ga0070674_1000243885 | 3300005356 | Miscanthus Rhizosphere | VLAKYILAALAVVFAIAAITRGPRSPQGRTWLRVAIIFTAVSIWLFVQG* |
Ga0070674_1000616265 | 3300005356 | Miscanthus Rhizosphere | GVLAKYILAALAVVFAIAAVIRGPRSPQGRTWLRVAMILTAVSIWLFVRG* |
Ga0070667_1005415573 | 3300005367 | Switchgrass Rhizosphere | LEYSMLAKYILLTLAVIFLFAALTRGPRTIQGRTWLLIAAIFGIVSTWLFVKG* |
Ga0070672_1005860773 | 3300005543 | Miscanthus Rhizosphere | LTAKYILATLAIAFLLAALTRGPRTPQGRAWLLIAA |
Ga0070665_1013295612 | 3300005548 | Switchgrass Rhizosphere | AVIFLFAALTRGPRTIQGRTWLLIAAIFGIVSTWLFVKG* |
Ga0068852_1016761891 | 3300005616 | Corn Rhizosphere | GLAFVFLIAALTRGPRTSQGRTWLLIAAIFGIVSSWLFARR* |
Ga0068859_1003158011 | 3300005617 | Switchgrass Rhizosphere | LTAKYILATLAIAFLLAALTPGPRTPQGRAWLLIAAIFGIVSAWLFARG* |
Ga0068864_1007565793 | 3300005618 | Switchgrass Rhizosphere | KYILLTLAVIFLFAALTRGPRTIQGRTWLLIAAIFGIVSTWLFARG* |
Ga0066905_1020659041 | 3300005713 | Tropical Forest Soil | MLARYILVVLGTAFLIAGAVRGPRHPQGRTWLLIAAIFGAVSIWLFT |
Ga0066903_1000612386 | 3300005764 | Tropical Forest Soil | MLAKYILAAVGAAFLIAGVVRGPGSLQGRIWLLIAAIFGAVSLWLFATA* |
Ga0068870_103339483 | 3300005840 | Miscanthus Rhizosphere | KYILATLAIAFLVAALTRGPRTPQGRAWLLIAAIFGIVSAWLFARG* |
Ga0068862_1000362513 | 3300005844 | Switchgrass Rhizosphere | MLAKYILLTLSIVFLVAALTRGPRTPQGRAWLLIAAIFGIVSSWLFARG* |
Ga0075422_100410342 | 3300006196 | Populus Rhizosphere | LTAKYILATLATAFLLAALTRGPRTPQGRAWLLIAAIFGIVSAWLFARG* |
Ga0075428_1003897442 | 3300006844 | Populus Rhizosphere | MLAKYILLLLAVVFLFAAVIRGTRTPQGRTWLLIACIFGIVSSWLFARG* |
Ga0075433_102324943 | 3300006852 | Populus Rhizosphere | MLAKYILLLLAVLFLFAALLRGTRTPQGRTWLLIACIFGIVSSWLLARG* |
Ga0075425_1004007592 | 3300006854 | Populus Rhizosphere | MLAKYILLALAVVFLIAAVIRGPRTPQGRTWLLIATIFGIVSSWLFARG* |
Ga0075425_1011512992 | 3300006854 | Populus Rhizosphere | MLAKYILLLLAVLFLFAALLRGTRTPQGRTWLLIACIFGIVSSWLLA |
Ga0075434_1003862063 | 3300006871 | Populus Rhizosphere | MLAKYILLALAVVFLLAAVIRGPRTPQGRTWLLIATIFGIVSSWLFVRG* |
Ga0075424_1000285104 | 3300006904 | Populus Rhizosphere | MLAKYILLTLAVIFLLAALTRGPRTPQGRIWLLIAAIFGIVSSWLFARS* |
Ga0114129_119524971 | 3300009147 | Populus Rhizosphere | KYILLLLAVVFLIAALTRGPGTPQGRTWLLIACIFGIVSSWLFARG* |
Ga0105249_130328691 | 3300009553 | Switchgrass Rhizosphere | MLAKYILLTLAVIFLFAALTRGPRTIQGRTWLLIAAIFGIVSTWLFVKG* |
Ga0126384_100457384 | 3300010046 | Tropical Forest Soil | MFAKYILAAVGAAFLIAGVVRGPGSLQGRIWLLIAAIFGAVSLWLFATA* |
Ga0126382_101561403 | 3300010047 | Tropical Forest Soil | MLARYILVVLGTAFLIAGAVRGPRHPQGRTWLLIAAIFGAVSIWLFTTA* |
Ga0126377_118875961 | 3300010362 | Tropical Forest Soil | CGSTMLARYILVVLGTAFLIAGAVRGPRHPQGRTWLLIAAIFGAVSIWLFTTA* |
Ga0105239_135697861 | 3300010375 | Corn Rhizosphere | IAQRPVAGRHLEYSMLAKYILLILAVAFLIAALTRGPRTIQGRTWLLIAAIFGIVSTWLFARG* |
Ga0134127_116634332 | 3300010399 | Terrestrial Soil | VLAKYILLLLAVLFLFAALLRGTRTPQGRTWLLIACIFGIVSSWLFARG* |
Ga0150985_1049341453 | 3300012212 | Avena Fatua Rhizosphere | MLAKYILLLLAVVFLCASVVRGPRTPQGRTWLLIAIIFGIVSSWLLVRGGNGTLIPAG* |
Ga0150985_1053952844 | 3300012212 | Avena Fatua Rhizosphere | MLAKYILLLLAVVFLFASLIRGTRTPQGRIWLLIAIIFGIVSSWLLVRG* |
Ga0150985_1127697621 | 3300012212 | Avena Fatua Rhizosphere | MIAKYILLLLAIVFLFASITRGPRTPQGRTWLLIAIIFGIVSSWLLVRG* |
Ga0150985_1211034924 | 3300012212 | Avena Fatua Rhizosphere | MTAKYILAALAVAFLLATFTRGPGTPQGRIWLWIAIIFGIVSSWLFVKR* |
Ga0150984_1070745102 | 3300012469 | Avena Fatua Rhizosphere | MLAKYILLLLAVVFLFGSVVRGPRTSQGRTWLLIAVIFGVVSGWLLARG* |
Ga0150984_1198527373 | 3300012469 | Avena Fatua Rhizosphere | FLFASVVRGTRTPQGRTWLLIAVIFGIVSGWLLGRG* |
Ga0157299_100271591 | 3300012899 | Soil | LTAKYILATLAIAFLVAALTRGPRTPQGRIWLLIAAIFGIVSAWLFAR |
Ga0137410_100614273 | 3300012944 | Vadose Zone Soil | MLAKYILAGLAFVFVIAALLRGPRTPQGRTWLLIAVIFGIVSSWLFAHG* |
Ga0164300_103199602 | 3300012951 | Soil | MLAKYILLTLAVIFLIAAITRGGRRSPQGRTWLLIAAIFGIVSSWLFVRV* |
Ga0164302_113597211 | 3300012961 | Soil | MLAKYILLTLAVIFLIAAITRGGRRSPQGRTWLLIAAIFGIVSSWLFVRG* |
Ga0075312_10773102 | 3300014254 | Natural And Restored Wetlands | MAKYILAVAACAFLIAALVRGSRSPQGRIWLRVAAIFAAVSVWLFSRG* |
Ga0163163_100631955 | 3300014325 | Switchgrass Rhizosphere | MLAKYILLTLAVIFLFAALTRGPRTIHGRTWLLIAAIFGIVSTWLFVKG* |
Ga0157380_102557544 | 3300014326 | Switchgrass Rhizosphere | ALAVVFAIAALTRGPRSPQGRTWLRVAMIFTAVSIWLFVRG* |
Ga0132258_1004420411 | 3300015371 | Arabidopsis Rhizosphere | MLAKYILLTLAVVFLFAALTRGPRTIQGRTWLLIAAIFGIVSTWLFARG* |
Ga0132258_102055767 | 3300015371 | Arabidopsis Rhizosphere | MLAKYILATLAIGFLIAGAARGARSSQGRTWLVIAAIFGAVSLWLFTRF* |
Ga0132258_108461273 | 3300015371 | Arabidopsis Rhizosphere | VLAKYILAALAVVFAIAAVIRGPRSPQGRTWLRVAMILTAVSIWLFVRG* |
Ga0132258_120753853 | 3300015371 | Arabidopsis Rhizosphere | MLAKYILITLAVIFLIAALTRGPRTIQGRTWLLIAAIFGIVSSWLLARG* |
Ga0132256_1004356912 | 3300015372 | Arabidopsis Rhizosphere | VLAKYILAALAVVFAIAAVIRGPRSPQGRTWLRVAMILTAVSIWLF |
Ga0132257_1016647932 | 3300015373 | Arabidopsis Rhizosphere | MLAKYILGGLALVFLIPAITRGPRSPQGRTWLLIAAIFGIVSSWLFARG* |
Ga0132257_1031100182 | 3300015373 | Arabidopsis Rhizosphere | MLAKYILLAVAIVFLIAAITRGPRSPQGRTWLLIAAIFGLVSAWLFVGR* |
Ga0132257_1039886811 | 3300015373 | Arabidopsis Rhizosphere | RRRRQTSFRLESHRGSICLTAKYILATLAIAFLLAALTRGPRTPQGRAWLLIAAIFGIVSAWLFARG* |
Ga0132255_1000619126 | 3300015374 | Arabidopsis Rhizosphere | MLAKYILGGLALVFLIAAITRGPRSPQGRTWLLIAAIFGIVSSWLFAGG* |
Ga0132255_1002213925 | 3300015374 | Arabidopsis Rhizosphere | MFAKYILLTLAVIFLIAALTRGPRTIQGRTWLLIAAIFGIVSSWLFARG* |
Ga0132255_1015344402 | 3300015374 | Arabidopsis Rhizosphere | MLAKYILLTLAVIFLIAAIPRGPRSPQGRTWLLIAAIFGLVSAWLFVGR* |
Ga0184625_105726781 | 3300018081 | Groundwater Sediment | VLAKYILAALAVVFAIAALTRGPRSPQGRTWLRVAMIFTAVSIWLFVRG |
Ga0190270_134448262 | 3300018469 | Soil | MLAKYILAALAVVFAIAAVTRGPRSPQGRTWLRVAIIFTAVSIWLFVRG |
Ga0190274_110904982 | 3300018476 | Soil | VLAKYILAALAVVFAIAALTRGPRSPQGRTWLKVAIIFTAVSIWLFVRG |
Ga0190271_127851932 | 3300018481 | Soil | VSTAALAKYILAALAVVFAVAAITRGPRGPQGRTWLRVAIIFAAVSIWLFVQG |
Ga0193719_101677882 | 3300021344 | Soil | MLAKYVLAALGAAFLIAGAIRGPRSIQGRTWLVIAAIFGAVSVWLFAKG |
Ga0222622_110828431 | 3300022756 | Groundwater Sediment | MLAKYILLLLAVVFLFASVVRGTRTPQGRTWLLIAVIFGIVSAWLLVRG |
Ga0207697_100808122 | 3300025315 | Corn, Switchgrass And Miscanthus Rhizosphere | MLAKYILLILAVAFLIAALTRGPRTIQGRTWLLIAAIFGIVSTWLFARG |
Ga0207650_101614254 | 3300025925 | Switchgrass Rhizosphere | SRMLAKYILLTLSIVFLVAALTRGPRTPQGRAWLLIAAIFGIVSSWLFARG |
Ga0207659_106637693 | 3300025926 | Miscanthus Rhizosphere | MLAKYILLILAVAFLLAALTRGPRTIQGRTWLLIAAIFGIVS |
Ga0207701_100124984 | 3300025930 | Corn, Switchgrass And Miscanthus Rhizosphere | VAGRHLEYSMLAKYILLTLAVIFLFAALTRGPRTIQGRTWLLIAAIFGIVSTWLFVKG |
Ga0207644_108788212 | 3300025931 | Switchgrass Rhizosphere | MLAKYILLTLAVIFLFAALTRGPRTIQGRTWLLIAAIFGIVSTWLFARG |
Ga0207670_102979743 | 3300025936 | Switchgrass Rhizosphere | RACRPASCDLTMLAKYILLILAVAFLLAALTRGPRTIQGRTWLLIAAIFGIVSTWLFVKG |
Ga0207669_100925213 | 3300025937 | Miscanthus Rhizosphere | VLAKYILAALAVVFAIAAVIRGPRSPQGRTWLRVAMILTAVSIWLFVRG |
Ga0207661_102264202 | 3300025944 | Corn Rhizosphere | MLAKYILLTLAVIFLFAALTRGPRTIQGRTWLLIAAIFGIVSTWLFVKG |
Ga0207679_101467941 | 3300025945 | Corn Rhizosphere | TLAVIFLFAALTRGPRTIQGRTWLLIAAIFGIVSTWLFVKG |
Ga0207679_108340892 | 3300025945 | Corn Rhizosphere | MLAKYILLILAVAFLIAALTRGPRTIQGRTWLLIAAIFGIVSTWLFVKG |
Ga0208291_10542232 | 3300026111 | Natural And Restored Wetlands | VSVMAKYILAVAACAFLIAALVRGSRSPQGRIWLRVAAIFAAVSVWLFSRG |
Ga0207698_121839482 | 3300026142 | Corn Rhizosphere | GLAFVFLIAALTRGPRTSQGRTWLLIAAIFGIVSSWLFARR |
Ga0268265_100404782 | 3300028380 | Switchgrass Rhizosphere | MLAKYILLTLSIVFLVAALTRGPRTPQGRAWLLIAAIFGIVSAWLFARG |
Ga0268241_100007131 | 3300030511 | Soil | VLAKYILAVLAVGFLVAGAWRGRRSSQGRTWLTIALIFGVVSVWLFAKG |
Ga0310888_100003022 | 3300031538 | Soil | LTAKCILATLAIAFLVAALTRGPRTPQGRAWLLIAAIFGIVSSWLFARG |
Ga0308175_1016588642 | 3300031938 | Soil | MLAKYILLLLAVAFLFASIVRGPRTPQGRTWLLIAIIFGIVSSWLLTRG |
Ga0308175_1022703251 | 3300031938 | Soil | MTAKYILAMLAIIFLLAALTSGTRTPQGRTWLLIACIFGIVSSWLLTRG |
Ga0310885_1000035510 | 3300031943 | Soil | MLAKYILLTLSIVFLVAALTRGPRTPQGRAWLLIAAIFGIVSSW |
Ga0310884_100006742 | 3300031944 | Soil | MLAKYILLTLSIVFLVAALTRGPRTPQGRAWLLIAAIFGIVSSWLFARG |
Ga0308176_111063211 | 3300031996 | Soil | MLAKYILLLLAVAFLFASIVRGPRTPQGRTWLLIAIIFGIVSSWLLVRG |
Ga0310906_1000004711 | 3300032013 | Soil | LTAKYILATLAIAFLLAALTRGPRTPQGRAWLLIAAIFGIDSAWLFARG |
Ga0364941_053040_33_185 | 3300034417 | Sediment | MMGAKYILAALAGLFLIAAAVRGRRSPQTRIWILIAAIFGTVSFWLFAAG |
⦗Top⦘ |