| Basic Information | |
|---|---|
| Family ID | F101465 |
| Family Type | Metagenome |
| Number of Sequences | 102 |
| Average Sequence Length | 43 residues |
| Representative Sequence | VSAGQFAASLLLGLLSILLPLLAFISMVAACVYVARWWIDRKS |
| Number of Associated Samples | 81 |
| Number of Associated Scaffolds | 102 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | No |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 79.41 % |
| % of genes near scaffold ends (potentially truncated) | 27.45 % |
| % of genes from short scaffolds (< 2000 bps) | 86.27 % |
| Associated GOLD sequencing projects | 74 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.62 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (94.118 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil (23.529 % of family members) |
| Environment Ontology (ENVO) | Unclassified (25.490 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Host-associated → Plant → Plant rhizosphere (41.176 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Transmembrane (alpha-helical) | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 56.34% β-sheet: 0.00% Coil/Unstructured: 43.66% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.62 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 102 Family Scaffolds |
|---|---|---|
| PF00719 | Pyrophosphatase | 56.86 |
| PF13620 | CarboxypepD_reg | 14.71 |
| PF00004 | AAA | 4.90 |
| PF13360 | PQQ_2 | 4.90 |
| PF13548 | DUF4126 | 1.96 |
| PF13586 | DDE_Tnp_1_2 | 0.98 |
| PF02627 | CMD | 0.98 |
| PF00472 | RF-1 | 0.98 |
| PF13385 | Laminin_G_3 | 0.98 |
| PF09316 | Cmyb_C | 0.98 |
| PF09335 | SNARE_assoc | 0.98 |
| PF03597 | FixS | 0.98 |
| PF11028 | DUF2723 | 0.98 |
| COG ID | Name | Functional Category | % Frequency in 102 Family Scaffolds |
|---|---|---|---|
| COG0221 | Inorganic pyrophosphatase | Energy production and conversion [C] | 56.86 |
| COG0216 | Protein chain release factor RF1 | Translation, ribosomal structure and biogenesis [J] | 0.98 |
| COG0398 | Uncharacterized membrane protein YdjX, related to fungal oxalate transporter, TVP38/TMEM64 family | Function unknown [S] | 0.98 |
| COG0586 | Membrane integrity protein DedA, putative transporter, DedA/Tvp38 family | Cell wall/membrane/envelope biogenesis [M] | 0.98 |
| COG0599 | Uncharacterized conserved protein YurZ, alkylhydroperoxidase/carboxymuconolactone decarboxylase family | General function prediction only [R] | 0.98 |
| COG1186 | Protein chain release factor PrfB | Translation, ribosomal structure and biogenesis [J] | 0.98 |
| COG1238 | Uncharacterized membrane protein YqaA, VTT domain | Function unknown [S] | 0.98 |
| COG2128 | Alkylhydroperoxidase family enzyme, contains CxxC motif | Inorganic ion transport and metabolism [P] | 0.98 |
| COG3197 | Cytochrome oxidase maturation protein, CcoS/FixS family | Posttranslational modification, protein turnover, chaperones [O] | 0.98 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 94.12 % |
| Unclassified | root | N/A | 5.88 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 2170459019|G14TP7Y01DC0JN | All Organisms → cellular organisms → Bacteria | 617 | Open in IMG/M |
| 3300000956|JGI10216J12902_102113748 | All Organisms → cellular organisms → Bacteria | 1504 | Open in IMG/M |
| 3300000956|JGI10216J12902_103880175 | All Organisms → cellular organisms → Bacteria | 675 | Open in IMG/M |
| 3300000956|JGI10216J12902_120221258 | All Organisms → cellular organisms → Bacteria | 673 | Open in IMG/M |
| 3300003310|D1draft_1003964 | All Organisms → cellular organisms → Bacteria | 8859 | Open in IMG/M |
| 3300004156|Ga0062589_100341705 | All Organisms → cellular organisms → Bacteria | 1183 | Open in IMG/M |
| 3300004463|Ga0063356_102560654 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 783 | Open in IMG/M |
| 3300004480|Ga0062592_100966591 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 775 | Open in IMG/M |
| 3300005293|Ga0065715_10805428 | All Organisms → cellular organisms → Bacteria | 608 | Open in IMG/M |
| 3300005294|Ga0065705_10672538 | All Organisms → cellular organisms → Bacteria | 666 | Open in IMG/M |
| 3300005295|Ga0065707_10237234 | All Organisms → cellular organisms → Bacteria | 1134 | Open in IMG/M |
| 3300005295|Ga0065707_10540017 | All Organisms → cellular organisms → Bacteria | 728 | Open in IMG/M |
| 3300005333|Ga0070677_10250875 | All Organisms → cellular organisms → Bacteria | 878 | Open in IMG/M |
| 3300005354|Ga0070675_100151953 | All Organisms → cellular organisms → Bacteria | 1985 | Open in IMG/M |
| 3300005441|Ga0070700_100085829 | All Organisms → cellular organisms → Bacteria | 2043 | Open in IMG/M |
| 3300005471|Ga0070698_101074417 | All Organisms → cellular organisms → Bacteria | 753 | Open in IMG/M |
| 3300005549|Ga0070704_100179500 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1692 | Open in IMG/M |
| 3300005617|Ga0068859_102465850 | All Organisms → cellular organisms → Bacteria | 573 | Open in IMG/M |
| 3300006048|Ga0075363_100608273 | All Organisms → cellular organisms → Bacteria | 655 | Open in IMG/M |
| 3300006196|Ga0075422_10097596 | All Organisms → cellular organisms → Bacteria | 1124 | Open in IMG/M |
| 3300006844|Ga0075428_100000003 | All Organisms → cellular organisms → Bacteria | 365483 | Open in IMG/M |
| 3300006876|Ga0079217_10027131 | All Organisms → cellular organisms → Bacteria | 2090 | Open in IMG/M |
| 3300006876|Ga0079217_11560559 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 525 | Open in IMG/M |
| 3300006880|Ga0075429_100384881 | All Organisms → cellular organisms → Bacteria | 1228 | Open in IMG/M |
| 3300006894|Ga0079215_10281819 | All Organisms → cellular organisms → Bacteria | 904 | Open in IMG/M |
| 3300006894|Ga0079215_10593492 | Not Available | 720 | Open in IMG/M |
| 3300006894|Ga0079215_11151594 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 586 | Open in IMG/M |
| 3300007004|Ga0079218_10568517 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1025 | Open in IMG/M |
| 3300007004|Ga0079218_10572662 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1022 | Open in IMG/M |
| 3300007004|Ga0079218_10700434 | All Organisms → cellular organisms → Bacteria | 950 | Open in IMG/M |
| 3300007004|Ga0079218_12797091 | All Organisms → cellular organisms → Bacteria | 584 | Open in IMG/M |
| 3300007004|Ga0079218_13311907 | All Organisms → cellular organisms → Bacteria | 545 | Open in IMG/M |
| 3300009053|Ga0105095_10083742 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1725 | Open in IMG/M |
| 3300009082|Ga0105099_10492619 | All Organisms → cellular organisms → Bacteria | 742 | Open in IMG/M |
| 3300009087|Ga0105107_10005487 | All Organisms → cellular organisms → Bacteria | 8548 | Open in IMG/M |
| 3300009153|Ga0105094_10279415 | All Organisms → cellular organisms → Bacteria | 960 | Open in IMG/M |
| 3300009166|Ga0105100_11000890 | All Organisms → cellular organisms → Bacteria | 524 | Open in IMG/M |
| 3300009609|Ga0105347_1022330 | All Organisms → cellular organisms → Bacteria | 2180 | Open in IMG/M |
| 3300009610|Ga0105340_1104511 | Not Available | 1140 | Open in IMG/M |
| 3300009873|Ga0131077_11120990 | All Organisms → cellular organisms → Bacteria | 663 | Open in IMG/M |
| 3300010036|Ga0126305_10037193 | All Organisms → cellular organisms → Bacteria | 2694 | Open in IMG/M |
| 3300010038|Ga0126315_10544292 | All Organisms → cellular organisms → Bacteria | 744 | Open in IMG/M |
| 3300010045|Ga0126311_10953327 | All Organisms → cellular organisms → Bacteria | 699 | Open in IMG/M |
| 3300010399|Ga0134127_11171208 | All Organisms → cellular organisms → Bacteria | 835 | Open in IMG/M |
| 3300011400|Ga0137312_1006308 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1362 | Open in IMG/M |
| 3300011415|Ga0137325_1119466 | All Organisms → cellular organisms → Bacteria | 602 | Open in IMG/M |
| 3300011433|Ga0137443_1045385 | All Organisms → cellular organisms → Bacteria | 1189 | Open in IMG/M |
| 3300012173|Ga0137327_1055204 | All Organisms → cellular organisms → Bacteria | 874 | Open in IMG/M |
| 3300012907|Ga0157283_10012260 | All Organisms → cellular organisms → Bacteria | 1463 | Open in IMG/M |
| 3300012939|Ga0162650_100015925 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1035 | Open in IMG/M |
| 3300014267|Ga0075313_1077725 | All Organisms → cellular organisms → Bacteria | 801 | Open in IMG/M |
| 3300014326|Ga0157380_13283732 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 517 | Open in IMG/M |
| 3300015373|Ga0132257_102700026 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 647 | Open in IMG/M |
| 3300018067|Ga0184611_1041630 | All Organisms → cellular organisms → Bacteria | 1508 | Open in IMG/M |
| 3300018072|Ga0184635_10014899 | All Organisms → cellular organisms → Bacteria | 2781 | Open in IMG/M |
| 3300018072|Ga0184635_10104331 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1122 | Open in IMG/M |
| 3300018078|Ga0184612_10569746 | All Organisms → cellular organisms → Bacteria | 541 | Open in IMG/M |
| 3300018081|Ga0184625_10485438 | All Organisms → cellular organisms → Bacteria | 627 | Open in IMG/M |
| 3300018422|Ga0190265_10118819 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 2520 | Open in IMG/M |
| 3300018422|Ga0190265_10512464 | All Organisms → cellular organisms → Bacteria | 1313 | Open in IMG/M |
| 3300018422|Ga0190265_10955947 | All Organisms → cellular organisms → Bacteria | 979 | Open in IMG/M |
| 3300018422|Ga0190265_12278639 | All Organisms → cellular organisms → Bacteria | 643 | Open in IMG/M |
| 3300018429|Ga0190272_11381428 | Not Available | 707 | Open in IMG/M |
| 3300018429|Ga0190272_13217963 | All Organisms → cellular organisms → Bacteria | 509 | Open in IMG/M |
| 3300018432|Ga0190275_10415644 | All Organisms → cellular organisms → Bacteria | 1359 | Open in IMG/M |
| 3300018432|Ga0190275_11426779 | All Organisms → cellular organisms → Bacteria | 769 | Open in IMG/M |
| 3300018432|Ga0190275_12402306 | All Organisms → cellular organisms → Bacteria | 605 | Open in IMG/M |
| 3300018466|Ga0190268_10498168 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 826 | Open in IMG/M |
| 3300018469|Ga0190270_10054796 | All Organisms → cellular organisms → Bacteria | 2798 | Open in IMG/M |
| 3300018469|Ga0190270_11019447 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 855 | Open in IMG/M |
| 3300018469|Ga0190270_12077553 | Not Available | 627 | Open in IMG/M |
| 3300018469|Ga0190270_13224385 | All Organisms → cellular organisms → Bacteria | 517 | Open in IMG/M |
| 3300018476|Ga0190274_11829439 | All Organisms → cellular organisms → Bacteria | 702 | Open in IMG/M |
| 3300018481|Ga0190271_10524678 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1298 | Open in IMG/M |
| 3300019356|Ga0173481_10135143 | All Organisms → cellular organisms → Bacteria | 998 | Open in IMG/M |
| 3300019377|Ga0190264_11539993 | All Organisms → cellular organisms → Bacteria | 580 | Open in IMG/M |
| 3300019377|Ga0190264_11780848 | All Organisms → cellular organisms → Bacteria | 553 | Open in IMG/M |
| 3300021082|Ga0210380_10135931 | All Organisms → cellular organisms → Bacteria | 1099 | Open in IMG/M |
| 3300021339|Ga0193706_1134682 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 673 | Open in IMG/M |
| 3300025325|Ga0209341_10626452 | All Organisms → cellular organisms → Bacteria | 839 | Open in IMG/M |
| 3300025893|Ga0207682_10174886 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 978 | Open in IMG/M |
| 3300025923|Ga0207681_10530501 | All Organisms → cellular organisms → Bacteria | 967 | Open in IMG/M |
| 3300025926|Ga0207659_10190203 | All Organisms → cellular organisms → Bacteria | 1633 | Open in IMG/M |
| 3300026075|Ga0207708_10146400 | All Organisms → cellular organisms → Bacteria | 1857 | Open in IMG/M |
| 3300026118|Ga0207675_100058513 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 3596 | Open in IMG/M |
| 3300027533|Ga0208185_1094244 | All Organisms → cellular organisms → Bacteria | 704 | Open in IMG/M |
| 3300027731|Ga0209592_1103701 | All Organisms → cellular organisms → Bacteria | 1037 | Open in IMG/M |
| 3300027818|Ga0209706_10094644 | All Organisms → cellular organisms → Bacteria | 1489 | Open in IMG/M |
| 3300027876|Ga0209974_10313068 | All Organisms → cellular organisms → Bacteria | 603 | Open in IMG/M |
| 3300027886|Ga0209486_11173302 | Not Available | 525 | Open in IMG/M |
| 3300027907|Ga0207428_10000002 | All Organisms → cellular organisms → Bacteria | 854851 | Open in IMG/M |
| 3300028578|Ga0272482_10059106 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1027 | Open in IMG/M |
| 3300030606|Ga0299906_10276960 | All Organisms → cellular organisms → Bacteria | 1314 | Open in IMG/M |
| 3300031847|Ga0310907_10014996 | All Organisms → cellular organisms → Bacteria | 2503 | Open in IMG/M |
| 3300031943|Ga0310885_10519696 | All Organisms → cellular organisms → Bacteria | 651 | Open in IMG/M |
| 3300031965|Ga0326597_11073200 | All Organisms → cellular organisms → Bacteria | 806 | Open in IMG/M |
| 3300031995|Ga0307409_101674566 | All Organisms → cellular organisms → Bacteria | 665 | Open in IMG/M |
| 3300032013|Ga0310906_10720273 | All Organisms → cellular organisms → Bacteria | 698 | Open in IMG/M |
| 3300032144|Ga0315910_10746719 | All Organisms → cellular organisms → Bacteria | 761 | Open in IMG/M |
| 3300033407|Ga0214472_11059582 | All Organisms → cellular organisms → Bacteria | 714 | Open in IMG/M |
| 3300034128|Ga0370490_0007610 | All Organisms → cellular organisms → Bacteria | 3807 | Open in IMG/M |
| 3300034760|Ga0334948_071102 | Not Available | 714 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 23.53% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 10.78% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Freshwater Sediment | 6.86% |
| Soil | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Soil | 6.86% |
| Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 4.90% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 3.92% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 3.92% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere | 3.92% |
| Serpentine Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Serpentine Soil | 2.94% |
| Switchgrass Rhizosphere | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Switchgrass Rhizosphere | 2.94% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 2.94% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 2.94% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 1.96% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Uranium Contaminated → Soil | 1.96% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 1.96% |
| Arabidopsis Thaliana Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Thaliana Rhizosphere | 1.96% |
| Groundwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Groundwater Sediment | 0.98% |
| Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 0.98% |
| Sub-Biocrust Soil | Environmental → Terrestrial → Soil → Unclassified → Desert → Sub-Biocrust Soil | 0.98% |
| Untreated Peat Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Untreated Peat Soil | 0.98% |
| Natural And Restored Wetlands | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Natural And Restored Wetlands | 0.98% |
| Soil | Environmental → Terrestrial → Soil → Loam → Unclassified → Soil | 0.98% |
| Soil | Environmental → Terrestrial → Agricultural Field → Unclassified → Unclassified → Soil | 0.98% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 0.98% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.98% |
| Populus Endosphere | Host-Associated → Plants → Roots → Bulk Soil → Unclassified → Populus Endosphere | 0.98% |
| Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere | 0.98% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.98% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 0.98% |
| Switchgrass, Maize And Mischanthus Litter | Engineered → Solid Waste → Grass → Composting → Unclassified → Switchgrass, Maize And Mischanthus Litter | 0.98% |
| Wastewater | Engineered → Wastewater → Activated Sludge → Unclassified → Unclassified → Wastewater | 0.98% |
| Down-Flow Hanging Sponge Reactor | Engineered → Bioreactor → Unclassified → Unclassified → Unclassified → Down-Flow Hanging Sponge Reactor | 0.98% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 2170459019 | Litter degradation MG4 | Engineered | Open in IMG/M |
| 3300000956 | Soil microbial communities from Great Prairies - Kansas, Native Prairie soil | Environmental | Open in IMG/M |
| 3300003310 | Down-flow hanging sponge reactor microbial communities from the University of Illinois at Urbana-Champaign, USA - L1-648F-DHS | Engineered | Open in IMG/M |
| 3300004156 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Combined assembly of AARS Block 1 | Environmental | Open in IMG/M |
| 3300004463 | Combined assembly of Arabidopsis thaliana microbial communities | Host-Associated | Open in IMG/M |
| 3300004480 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of AARS Block 4 | Environmental | Open in IMG/M |
| 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 | Host-Associated | Open in IMG/M |
| 3300005294 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 Bulk Soil | Environmental | Open in IMG/M |
| 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 | Environmental | Open in IMG/M |
| 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Host-Associated | Open in IMG/M |
| 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Host-Associated | Open in IMG/M |
| 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Environmental | Open in IMG/M |
| 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Environmental | Open in IMG/M |
| 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Environmental | Open in IMG/M |
| 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Host-Associated | Open in IMG/M |
| 3300006048 | Populus root and rhizosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Host-Associated | Open in IMG/M |
| 3300006196 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD1 | Host-Associated | Open in IMG/M |
| 3300006844 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Host-Associated | Open in IMG/M |
| 3300006876 | Agricultural soil microbial communities from Utah to study Nitrogen management - NC AS200 | Environmental | Open in IMG/M |
| 3300006880 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Host-Associated | Open in IMG/M |
| 3300006894 | Agricultural soil microbial communities from Utah to study Nitrogen management - NC Control | Environmental | Open in IMG/M |
| 3300007004 | Agricultural soil microbial communities from Utah to study Nitrogen management - NC Compost | Environmental | Open in IMG/M |
| 3300009053 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P8 Core (3) Depth 19-21cm March2015 | Environmental | Open in IMG/M |
| 3300009082 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P8 Core (1) Depth 1-3cm May2015 | Environmental | Open in IMG/M |
| 3300009087 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P8 Core (1) Depth 19-21cm September2015 | Environmental | Open in IMG/M |
| 3300009153 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P8 Core (3) Depth 10-12cm March2015 | Environmental | Open in IMG/M |
| 3300009166 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P8 Core (1) Depth 10-12cm May2015 | Environmental | Open in IMG/M |
| 3300009609 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMLT890 | Environmental | Open in IMG/M |
| 3300009610 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMLT700 | Environmental | Open in IMG/M |
| 3300009873 | Activated sludge microbial diversity in wastewater treatment plant from Taiwan - Wenshan plant | Engineered | Open in IMG/M |
| 3300010036 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot26 | Environmental | Open in IMG/M |
| 3300010038 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot106 | Environmental | Open in IMG/M |
| 3300010045 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot61 | Environmental | Open in IMG/M |
| 3300010399 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-3 | Environmental | Open in IMG/M |
| 3300011400 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMZT133_2 | Environmental | Open in IMG/M |
| 3300011415 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMZT469_2 | Environmental | Open in IMG/M |
| 3300011433 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMGT300_2 | Environmental | Open in IMG/M |
| 3300012173 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMZT517_2 | Environmental | Open in IMG/M |
| 3300012907 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S044-104R-1 | Environmental | Open in IMG/M |
| 3300012939 | Agricultural soil microbial communities from Tamara ranch near Red Deer, Alberta, Canada - d1t1i015 | Environmental | Open in IMG/M |
| 3300014267 | Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberryNE_CattailC_D1 | Environmental | Open in IMG/M |
| 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Host-Associated | Open in IMG/M |
| 3300015373 | Combined assembly of cpr5 rhizosphere | Host-Associated | Open in IMG/M |
| 3300018067 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_5_coex | Environmental | Open in IMG/M |
| 3300018072 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_30_b2 | Environmental | Open in IMG/M |
| 3300018078 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_60_coex | Environmental | Open in IMG/M |
| 3300018081 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_30_b1 | Environmental | Open in IMG/M |
| 3300018422 | Populus adjacent soil microbial communities from riparian zone of Indian Creek, Utah, USA - 124 T | Environmental | Open in IMG/M |
| 3300018429 | Populus adjacent soil microbial communities from riparian zone of Shoshone River, Wyoming, USA - 504 T | Environmental | Open in IMG/M |
| 3300018432 | Populus adjacent soil microbial communities from riparian zone of Yellowstone River, Montana, USA - 550 T | Environmental | Open in IMG/M |
| 3300018466 | Populus adjacent soil microbial communities from riparian zone of Blue River, Arizona, USA - 249 T | Environmental | Open in IMG/M |
| 3300018469 | Populus adjacent soil microbial communities from riparian zone of Weber River, Utah, USA - 320 T | Environmental | Open in IMG/M |
| 3300018476 | Populus adjacent soil microbial communities from riparian zone of Yellowstone River, Montana, USA - 531 T | Environmental | Open in IMG/M |
| 3300018481 | Populus adjacent soil microbial communities from riparian zone of Weber River, Utah, USA - 356 T | Environmental | Open in IMG/M |
| 3300019356 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S073-202C-2 (version 2) | Environmental | Open in IMG/M |
| 3300019377 | Populus adjacent soil microbial communities from riparian zone of Indian Creek, Utah, USA - 112 T | Environmental | Open in IMG/M |
| 3300021082 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM4_5_coex redo | Environmental | Open in IMG/M |
| 3300021339 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U3c1 | Environmental | Open in IMG/M |
| 3300025325 | Soil microbial communities from Rifle, Colorado - Rifle CSP2_sed 13_2 (SPAdes) | Environmental | Open in IMG/M |
| 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300027533 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMLT700 (SPAdes) | Environmental | Open in IMG/M |
| 3300027731 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P8 Core (3) Depth 19-21cm March2015 (SPAdes) | Environmental | Open in IMG/M |
| 3300027818 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P8 Core (1) Depth 19-21cm September2015 (SPAdes) | Environmental | Open in IMG/M |
| 3300027876 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) | Host-Associated | Open in IMG/M |
| 3300027886 | Agricultural soil microbial communities from Utah to study Nitrogen management - NC Compost (SPAdes) | Environmental | Open in IMG/M |
| 3300027907 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300028578 | Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT160D0 | Environmental | Open in IMG/M |
| 3300030606 | Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT145D125 | Environmental | Open in IMG/M |
| 3300031847 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C48D4 | Environmental | Open in IMG/M |
| 3300031943 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T60D2 | Environmental | Open in IMG/M |
| 3300031965 | Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT100D185 | Environmental | Open in IMG/M |
| 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Host-Associated | Open in IMG/M |
| 3300032013 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C48D3 | Environmental | Open in IMG/M |
| 3300032144 | Garden soil microbial communities collected in Santa Monica, California, United States - Edamame soil | Environmental | Open in IMG/M |
| 3300033407 | Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT140D175 | Environmental | Open in IMG/M |
| 3300034128 | Peat soil microbial communities from wetlands in Alaska, United States - Frozen_pond_06D_16 | Environmental | Open in IMG/M |
| 3300034760 | Sub-biocrust soil microbial communities from Mojave Desert, California, United States - 44SMS | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| 4MG_00860150 | 2170459019 | Switchgrass, Maize And Mischanthus Litter | VSAAHFAASLLLGFLSILLPLLAFISMVAACVYVARWWIDRKS |
| JGI10216J12902_1021137482 | 3300000956 | Soil | VSLGEFAASLLLGIFSVLLPLVIFISMVAALVWVARRWSARGR* |
| JGI10216J12902_1038801752 | 3300000956 | Soil | VSLGQFAASLAMGLLSMLIPLAIFISMVALCVYVAR |
| JGI10216J12902_1202212582 | 3300000956 | Soil | VSLGQFAASLVFGFLSILLPLLIFISMVAGCVYVARWWNDRKN* |
| D1draft_10039643 | 3300003310 | Down-Flow Hanging Sponge Reactor | VSAGQFATSLLLGILSVLVPLMIFVALVATLVAVARWWIDRRKARP* |
| Ga0062589_1003417053 | 3300004156 | Soil | VSFGEFAASLFFGLISVLLPLAIFISMVAVCVIVARWWIARRS* |
| Ga0063356_1025606542 | 3300004463 | Arabidopsis Thaliana Rhizosphere | VSIGQFAASLVVGFLSILIPLLIFISMVAACVYVARWWIGRKS* |
| Ga0062592_1009665912 | 3300004480 | Soil | VSAAHFAASLLLGFLSILLPLLAFISMVAACVYVARWWIDRKS* |
| Ga0065715_108054282 | 3300005293 | Miscanthus Rhizosphere | VSAAHFAASLMLGFLSILLPLLAFISMVAACVYVARWWIDRKS* |
| Ga0065705_106725382 | 3300005294 | Switchgrass Rhizosphere | VSVAHFAASLLLGLLSILLPLLAFITMVAACVYVARWWIDRKS* |
| Ga0065707_102372343 | 3300005295 | Switchgrass Rhizosphere | VSAAHFAASLLLGLLSILLPLLAFITMVAACVYVARWWIDRKS* |
| Ga0065707_105400172 | 3300005295 | Switchgrass Rhizosphere | VSIGQFAASLVFGLLSILLPLLIFISMVAACVYVARWWNARKS* |
| Ga0070677_102508751 | 3300005333 | Miscanthus Rhizosphere | VTIEQFAASLAFGILSILLPLALFISMVAACVYIARWWIGRKS* |
| Ga0070675_1001519531 | 3300005354 | Miscanthus Rhizosphere | VSAAHFAASLLFGLLSILLPLLAFISMVAACVYVARWWIDRKS* |
| Ga0070700_1000858292 | 3300005441 | Corn, Switchgrass And Miscanthus Rhizosphere | VTFDEFAASLFFGLISVLLPLAIFISMVAVCVIVARWWIARRS* |
| Ga0070698_1010744172 | 3300005471 | Corn, Switchgrass And Miscanthus Rhizosphere | VSIGQFAASLVVGFLSILLPLLIFISMVAACVYVARWWIGRKS* |
| Ga0070704_1001795002 | 3300005549 | Corn, Switchgrass And Miscanthus Rhizosphere | VSSGEFAASLFFGLISVLLPLAIFISMVAVCVIVARWWIARRS* |
| Ga0068859_1024658501 | 3300005617 | Switchgrass Rhizosphere | EARVSSGEFAASLFFGLISVLLPLAIFISMVAVCVIVARWWIARRS* |
| Ga0075363_1006082732 | 3300006048 | Populus Endosphere | VSAGQFAASLVFGLLSILLPLAVFIAMVAACVYVARRWLDRKS* |
| Ga0075422_100975963 | 3300006196 | Populus Rhizosphere | VSAAHFAASLLFGFLSILLPLLAFISMVAACVYVARWWI |
| Ga0075428_100000003330 | 3300006844 | Populus Rhizosphere | VSAAHFAASLLFGFLSILLPLLAFISMVAACVYVARWWIDRKS* |
| Ga0079217_100271312 | 3300006876 | Agricultural Soil | VSIGQFAVSLLLGILSVLLPVLIFISVVAVCVFIARKWIDRKS* |
| Ga0079217_115605591 | 3300006876 | Agricultural Soil | WRTEARVTFGQFAASLVFGVLSILLPLLIFISMVAGCVYVARWWIDRKG* |
| Ga0075429_1003848813 | 3300006880 | Populus Rhizosphere | VSAAHFAASLLFGFLSILLPLLAFISMVAACVYVARWWID |
| Ga0079215_102818191 | 3300006894 | Agricultural Soil | VTFGQFAASLVFGALSILLPLLIVISTVAACVYVARWWIDRKS* |
| Ga0079215_105934922 | 3300006894 | Agricultural Soil | VSIGQFAASLVLGLLSILLPLVIFISMVAACVYVARWWMDRKS* |
| Ga0079215_111515942 | 3300006894 | Agricultural Soil | AWRTEARVTFGQFAASLVFGALSVLLPLLIIISMVAGCVYVARWWIDRKS* |
| Ga0079218_105685172 | 3300007004 | Agricultural Soil | VTFGQFAASLVLGALSILLPLLIFISMVAACVYVARWWIDRKS* |
| Ga0079218_105726622 | 3300007004 | Agricultural Soil | VTAGQFAASLFFGFLSIVLPLAIVISIVAACVYVARWWIDRKPDR* |
| Ga0079218_107004342 | 3300007004 | Agricultural Soil | VSVGQFAASLVLGFLSILLPLLIFISMVAACVYIARWWIDRKDGG* |
| Ga0079218_127970912 | 3300007004 | Agricultural Soil | VSIGQFAASLVLGFLSILLPLLIFISMVAAGVYVARWWNERKAKDP* |
| Ga0079218_133119071 | 3300007004 | Agricultural Soil | VSVGQFAASLLLGFLSILLPLLIVISMVAACVYVARWWIGPNADR* |
| Ga0105095_100837422 | 3300009053 | Freshwater Sediment | VSFGEFAASLVFGLVSVLLPLVIFICMVAVCVYVARWWIERKN* |
| Ga0105099_104926192 | 3300009082 | Freshwater Sediment | VSFGEFAASLVFGLVSVLLPLVIFICMVAVCVYVARWWLERKN* |
| Ga0105107_100054874 | 3300009087 | Freshwater Sediment | VSIGEFAASLVFGLLSVLLPLVIFISMVAIGVYVARWWIDRKS* |
| Ga0105094_102794153 | 3300009153 | Freshwater Sediment | VSFGKFAASLVFGLVSVLLPLVIFICMVAVCVYVARWWIERKN* |
| Ga0105100_110008902 | 3300009166 | Freshwater Sediment | VSIGEFAASLVFGLLSVLLPLVIFISVVAVAVYIKHWWIDRKS* |
| Ga0105347_10223303 | 3300009609 | Soil | VSAGQFAASLLFGLLSIVLPLAVFIAMVATCVYIARRWMDRKG* |
| Ga0105340_11045112 | 3300009610 | Soil | MSLGQFAASLLQGLLAVLLPLLLFIAAVAALVYIARWWTDQSNSSR* |
| Ga0131077_111209902 | 3300009873 | Wastewater | VSPGEFAASLLFGLLSVLLPLVFFVLMVAACVSAARWWIDRNG* |
| Ga0126305_100371931 | 3300010036 | Serpentine Soil | VSIGQFAASLAFGILSIVLPLALFISMVAGCVYIARWWIGRKS* |
| Ga0126315_105442922 | 3300010038 | Serpentine Soil | VSFQEFAASILFGILSIVLPLVMFISTVATCVYIARKWIDRKS* |
| Ga0126311_109533271 | 3300010045 | Serpentine Soil | VSIGQFAASLAFGILSIVLPLALFISMVAACVYIARWWIARKS* |
| Ga0134127_111712082 | 3300010399 | Terrestrial Soil | VTFDEFAASLFFGLISVLLPLAIFISMVAVCVIVARWWIARKS* |
| Ga0137312_10063082 | 3300011400 | Soil | VSAAHFAASLLFGLLSILLPLLAFISMVAACVYVARWWIARKS* |
| Ga0137325_11194662 | 3300011415 | Soil | VSIGQFAASLVFGFLSILLPLLAFISMVAACVYVARWWIDRKS* |
| Ga0137443_10453852 | 3300011433 | Soil | VSVGQFAASLFIGLLSVLLPLALFIAMVAACVSVARWWIARRS* |
| Ga0137327_10552041 | 3300012173 | Soil | VSVGQFAASLFIGLLSVLLPLALFIAMVAACVSVARWW |
| Ga0157283_100122601 | 3300012907 | Soil | LFFGLISVLLPLAIFISMVAVCVIVARWWIARRS* |
| Ga0162650_1000159252 | 3300012939 | Soil | VSFGDFAVSLLLGILSVILPLVMFISAVAACVYIARWWLDRGA* |
| Ga0075313_10777251 | 3300014267 | Natural And Restored Wetlands | VSVGEFAASLAFGLLSVVLPLVIFISMVAIGVYIARWWIDRKS |
| Ga0157380_132837322 | 3300014326 | Switchgrass Rhizosphere | RAEARVSAAHFAASLLLGLLSILLPLLAFISMVAACVYVARWWIGRKS* |
| Ga0132257_1027000262 | 3300015373 | Arabidopsis Rhizosphere | VSAAHFAASLLLGLLSILLPLLAFISMVAACVYAARWWIDRKS* |
| Ga0184611_10416302 | 3300018067 | Groundwater Sediment | VSATHFAASLLLGLLSILLPLLAFILMVAACVYVARWWIARKS |
| Ga0184635_100148991 | 3300018072 | Groundwater Sediment | VSAAHFAASLLFGLLSILLPLLAFISMVAACVYVARWWID |
| Ga0184635_101043312 | 3300018072 | Groundwater Sediment | ASLLLGLLSILLPLLAFILMVAACVYVARWWIARKS |
| Ga0184612_105697462 | 3300018078 | Groundwater Sediment | VSATHFAASLLLGLLSILLPLLAFILMVAACVYVARWWIARK |
| Ga0184625_104854381 | 3300018081 | Groundwater Sediment | VSIGQFAASLVFGLLSILLPLLAFILMVAACVYVARWW |
| Ga0190265_101188191 | 3300018422 | Soil | SIGQFAASLVLGFLSILLPLVIFISMVAACVYVARW |
| Ga0190265_105124643 | 3300018422 | Soil | VSVGQFAASLALGFLSILLPLVIFISMVAACVYVARWWIDRKS |
| Ga0190265_109559473 | 3300018422 | Soil | VSFGEFAVSLLLGILSVMLPLVIFISMVAACVYIARWWIDRKS |
| Ga0190265_122786392 | 3300018422 | Soil | VSPAEFAASLLLGLLSVLFPLLLFIAMVAVLVSVARWWIDRPKT |
| Ga0190272_113814281 | 3300018429 | Soil | ARVSVGQFAASLLLGLLSILIPLVIFISMVAACVCVARWWIDRKS |
| Ga0190272_132179631 | 3300018429 | Soil | VSLGQFAASLVFGFLSILLPLLIFISMVAACVYVARWWNDRKS |
| Ga0190275_104156441 | 3300018432 | Soil | VSAGQFAASLFLGFLSILLPLLIFISMVAACVYVANWWIDRRS |
| Ga0190275_114267792 | 3300018432 | Soil | VSVGQFATALLLGFLSILLPLLIVISMVAACVYVARWWLGRNADR |
| Ga0190275_124023062 | 3300018432 | Soil | VSAGQFAASLLLGLLSILLPLLIFISMVAACVYVARWWNDRKS |
| Ga0190268_104981681 | 3300018466 | Soil | VTAGQFAASLLLGFLSILLPLLIFISMAAACVYIARWWIDRKN |
| Ga0190270_100547965 | 3300018469 | Soil | VSFGDFAVSLLLGILSVILPLVMFISAVAACVYIARWWLDRGA |
| Ga0190270_110194471 | 3300018469 | Soil | LSTIIIEARVSIGQFAASLVLGFLSILLPLVIFIAMVATCVYIARWWTDRKS |
| Ga0190270_120775531 | 3300018469 | Soil | GQFAASLLLGFLSILLPLVIFIAMVATCVYIARWWTDRKS |
| Ga0190270_132243852 | 3300018469 | Soil | VSIGQFAASLVFGFLSILLPLLIFISMVAACVYVARWWNHKS |
| Ga0190274_118294392 | 3300018476 | Soil | VSVGQFAASLVLGLLSILLPLAIFISMVAACVYVARWWCDRKS |
| Ga0190271_105246782 | 3300018481 | Soil | VSAAHFAASLLLGLLSILLPLLAFISMVAACVYIARWWIDRKS |
| Ga0173481_101351432 | 3300019356 | Soil | VSFGEFAASLFFGLISVLLPLAIFISMVAVCVIVARWWIARRS |
| Ga0190264_115399932 | 3300019377 | Soil | VSVGQFAASLLLGIVSVLLPLALFIGVVAALVWVARWWIDRPRT |
| Ga0190264_117808481 | 3300019377 | Soil | VSVGQVAASLLLGFLSILLPLVIFIAMVATCVYIARWWTDRKS |
| Ga0210380_101359313 | 3300021082 | Groundwater Sediment | VSAGQFAASLLFGLLSIVLPLAVFIAMVATCVYIARRWMDRKG |
| Ga0193706_11346822 | 3300021339 | Soil | SVGQFAASLVRGLLSILLPLAIFISMVAACVYVARWWFDRKS |
| Ga0209341_106264521 | 3300025325 | Soil | VSVGEFAASLLLGFLSILLPLLIFISMVAACVYVARWWIGRRN |
| Ga0207682_101748861 | 3300025893 | Miscanthus Rhizosphere | ASLLLGLLSILLPLLVFISMVAACVYVARWWIGRKS |
| Ga0207681_105305011 | 3300025923 | Switchgrass Rhizosphere | VSFGEFAASLFFGLISVLLPLAIFISMVAVCVIVARW |
| Ga0207659_101902033 | 3300025926 | Miscanthus Rhizosphere | VSAAHFAASLLFGLLSILLPLLAFISMVAACVYVARWWIDRKS |
| Ga0207708_101464003 | 3300026075 | Corn, Switchgrass And Miscanthus Rhizosphere | VTFDEFAASLFFGLISVLLPLAIFISMVAVCVIVARWWIARRS |
| Ga0207675_1000585132 | 3300026118 | Switchgrass Rhizosphere | VSSGEFAASLFFGLISVLLPLAIFISMVAVCVIVARWWIARRS |
| Ga0208185_10942442 | 3300027533 | Soil | MSLGQFAASLLQGLLAVLLPLLLFIAAVAALVYIARWWTDQSNSSR |
| Ga0209592_11037012 | 3300027731 | Freshwater Sediment | VSFGEFAASLVFGLVSVLLPLVIFICMVAVCVYVARWWIERKN |
| Ga0209706_100946442 | 3300027818 | Freshwater Sediment | VSIGEFAASLVFGLLSVLLPLVIFISMVAIGVYVARWWIDRKS |
| Ga0209974_103130682 | 3300027876 | Arabidopsis Thaliana Rhizosphere | VSVQQFAASILFGILSILLPLVGFISSVAACVYVARKWIDR |
| Ga0209486_111733022 | 3300027886 | Agricultural Soil | VTAGQFAASLFFGFLSIVLPLAIVISIVAACVYVARWWIDRKPDR |
| Ga0207428_10000002598 | 3300027907 | Populus Rhizosphere | VSAAHFAASLLFGFLSILLPLLAFISMVAACVYVARWWIDRKS |
| Ga0272482_100591062 | 3300028578 | Soil | MTVGQVAASLALGILSILLPVLIFISTAATCVYVARWWIDRKG |
| Ga0299906_102769602 | 3300030606 | Soil | VTIGQFAASLVFGFLSILLPLVIFISMVAACVYVARWWLDRKS |
| Ga0310907_100149963 | 3300031847 | Soil | VSFGEFAASLFFGLISVLLPLAIFISMVAVCVIVARWWIARSS |
| Ga0310885_105196962 | 3300031943 | Soil | VSAGQFAASLLLGLLSILLPLLAFISMVAACVYVARWWIDRKS |
| Ga0326597_110732001 | 3300031965 | Soil | VTLAQFAASLLFGILSVLLPLILFIAAVAVLVYIARWWMDRRGGGN |
| Ga0307409_1016745662 | 3300031995 | Rhizosphere | VSFGQFAASILLGLLSILLPLLIFVSMVAACVWVARRWIDR |
| Ga0310906_107202732 | 3300032013 | Soil | VSFQQFAASILFGILSILLPLALFISAVAACVYVARKWIDRRSP |
| Ga0315910_107467191 | 3300032144 | Soil | VSFGEFAASLFFGLFSVLLPLAMFISMVAVCVMVARWWIA |
| Ga0214472_110595822 | 3300033407 | Soil | VTVGQFAASLVLGFLSILLPLLIFISMVAACVYVARWWIDRRS |
| Ga0370490_0007610_2629_2760 | 3300034128 | Untreated Peat Soil | VSVGEFAVSLVLGILSVLLPLLIFISMVAACVYVARWWIDRKS |
| Ga0334948_071102_442_579 | 3300034760 | Sub-Biocrust Soil | VSLGQFAASLLLGFVSILLPLLIFISMVAACVYVARWWNGRNADR |
| ⦗Top⦘ |