| Basic Information | |
|---|---|
| Family ID | F101387 |
| Family Type | Metagenome |
| Number of Sequences | 102 |
| Average Sequence Length | 53 residues |
| Representative Sequence | MGSILNEQDRAAIDRRLRSLSLSSTRRWGSMDVVAMLQHLRLSARMTLGELSV |
| Number of Associated Samples | 83 |
| Number of Associated Scaffolds | 102 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | No |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 100.00 % |
| % of genes near scaffold ends (potentially truncated) | 97.06 % |
| % of genes from short scaffolds (< 2000 bps) | 97.06 % |
| Associated GOLD sequencing projects | 75 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.41 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (85.294 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere (10.784 % of family members) |
| Environment Ontology (ENVO) | Unclassified (48.039 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Host-associated → Plant → Plant rhizosphere (70.588 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 45.68% β-sheet: 0.00% Coil/Unstructured: 54.32% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.41 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 102 Family Scaffolds |
|---|---|---|
| PF00467 | KOW | 4.90 |
| PF08818 | DUF1801 | 3.92 |
| PF02687 | FtsX | 3.92 |
| PF11746 | DUF3303 | 2.94 |
| PF01694 | Rhomboid | 2.94 |
| PF12681 | Glyoxalase_2 | 1.96 |
| PF01120 | Alpha_L_fucos | 1.96 |
| PF01641 | SelR | 1.96 |
| PF00583 | Acetyltransf_1 | 1.96 |
| PF13474 | SnoaL_3 | 1.96 |
| PF04255 | DUF433 | 1.96 |
| PF08240 | ADH_N | 0.98 |
| PF08241 | Methyltransf_11 | 0.98 |
| PF01872 | RibD_C | 0.98 |
| PF02517 | Rce1-like | 0.98 |
| PF00464 | SHMT | 0.98 |
| PF02223 | Thymidylate_kin | 0.98 |
| PF09265 | Cytokin-bind | 0.98 |
| PF00144 | Beta-lactamase | 0.98 |
| PF08713 | DNA_alkylation | 0.98 |
| PF01909 | NTP_transf_2 | 0.98 |
| PF02954 | HTH_8 | 0.98 |
| PF01451 | LMWPc | 0.98 |
| PF01575 | MaoC_dehydratas | 0.98 |
| PF01738 | DLH | 0.98 |
| PF00578 | AhpC-TSA | 0.98 |
| PF14066 | DUF4256 | 0.98 |
| PF00155 | Aminotran_1_2 | 0.98 |
| PF07859 | Abhydrolase_3 | 0.98 |
| PF13561 | adh_short_C2 | 0.98 |
| PF00072 | Response_reg | 0.98 |
| COG ID | Name | Functional Category | % Frequency in 102 Family Scaffolds |
|---|---|---|---|
| COG5649 | Uncharacterized conserved protein, DUF1801 domain | Function unknown [S] | 3.92 |
| COG5646 | Iron-binding protein Fra/YdhG, frataxin family (Fe-S cluster biosynthesis) | Posttranslational modification, protein turnover, chaperones [O] | 3.92 |
| COG4430 | Uncharacterized conserved protein YdeI, YjbR/CyaY-like superfamily, DUF1801 family | Function unknown [S] | 3.92 |
| COG0705 | Membrane-associated serine protease, rhomboid family | Posttranslational modification, protein turnover, chaperones [O] | 2.94 |
| COG0229 | Peptide methionine sulfoxide reductase MsrB | Posttranslational modification, protein turnover, chaperones [O] | 1.96 |
| COG3669 | Alpha-L-fucosidase | Carbohydrate transport and metabolism [G] | 1.96 |
| COG2442 | Predicted antitoxin component of a toxin-antitoxin system, DUF433 family | Defense mechanisms [V] | 1.96 |
| COG1686 | D-alanyl-D-alanine carboxypeptidase | Cell wall/membrane/envelope biogenesis [M] | 0.98 |
| COG4912 | 3-methyladenine DNA glycosylase AlkD | Replication, recombination and repair [L] | 0.98 |
| COG4449 | Predicted protease, Abi (CAAX) family | General function prediction only [R] | 0.98 |
| COG2367 | Beta-lactamase class A | Defense mechanisms [V] | 0.98 |
| COG1985 | Pyrimidine reductase, riboflavin biosynthesis | Coenzyme transport and metabolism [H] | 0.98 |
| COG0112 | Glycine/serine hydroxymethyltransferase | Amino acid transport and metabolism [E] | 0.98 |
| COG1680 | CubicO group peptidase, beta-lactamase class C family | Defense mechanisms [V] | 0.98 |
| COG1266 | Membrane protease YdiL, CAAX protease family | Posttranslational modification, protein turnover, chaperones [O] | 0.98 |
| COG0657 | Acetyl esterase/lipase | Lipid transport and metabolism [I] | 0.98 |
| COG0277 | FAD/FMN-containing lactate dehydrogenase/glycolate oxidase | Energy production and conversion [C] | 0.98 |
| COG0262 | Dihydrofolate reductase | Coenzyme transport and metabolism [H] | 0.98 |
| COG0156 | 7-keto-8-aminopelargonate synthetase or related enzyme | Coenzyme transport and metabolism [H] | 0.98 |
| COG0125 | Thymidylate kinase | Nucleotide transport and metabolism [F] | 0.98 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 85.29 % |
| Unclassified | root | N/A | 14.71 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 2228664022|INPgaii200_c0522842 | All Organisms → cellular organisms → Bacteria | 734 | Open in IMG/M |
| 3300000033|ICChiseqgaiiDRAFT_c0469849 | All Organisms → cellular organisms → Bacteria | 888 | Open in IMG/M |
| 3300000363|ICChiseqgaiiFebDRAFT_11221240 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes | 1356 | Open in IMG/M |
| 3300003267|soilL1_10041201 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1675 | Open in IMG/M |
| 3300003324|soilH2_10145429 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1518 | Open in IMG/M |
| 3300004114|Ga0062593_103486692 | All Organisms → cellular organisms → Bacteria | 505 | Open in IMG/M |
| 3300004156|Ga0062589_101848254 | All Organisms → cellular organisms → Bacteria | 608 | Open in IMG/M |
| 3300004479|Ga0062595_101340320 | All Organisms → cellular organisms → Bacteria | 647 | Open in IMG/M |
| 3300004479|Ga0062595_101897923 | All Organisms → cellular organisms → Bacteria | 570 | Open in IMG/M |
| 3300004480|Ga0062592_101779362 | All Organisms → cellular organisms → Bacteria | 602 | Open in IMG/M |
| 3300005290|Ga0065712_10015427 | All Organisms → cellular organisms → Bacteria | 1823 | Open in IMG/M |
| 3300005290|Ga0065712_10295516 | All Organisms → cellular organisms → Bacteria | 869 | Open in IMG/M |
| 3300005338|Ga0068868_101254294 | All Organisms → cellular organisms → Bacteria | 687 | Open in IMG/M |
| 3300005343|Ga0070687_101472558 | All Organisms → cellular organisms → Bacteria | 511 | Open in IMG/M |
| 3300005356|Ga0070674_100194427 | All Organisms → cellular organisms → Bacteria | 1562 | Open in IMG/M |
| 3300005438|Ga0070701_10900743 | All Organisms → cellular organisms → Bacteria | 610 | Open in IMG/M |
| 3300005444|Ga0070694_101152288 | All Organisms → cellular organisms → Bacteria | 648 | Open in IMG/M |
| 3300005444|Ga0070694_101610796 | All Organisms → cellular organisms → Bacteria | 551 | Open in IMG/M |
| 3300005444|Ga0070694_101900994 | All Organisms → cellular organisms → Bacteria | 508 | Open in IMG/M |
| 3300005459|Ga0068867_101635723 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Sphingobacteriia → Sphingobacteriales → Sphingobacteriaceae → Pedobacter → Pedobacter agri | 602 | Open in IMG/M |
| 3300005530|Ga0070679_101671980 | All Organisms → cellular organisms → Bacteria | 584 | Open in IMG/M |
| 3300005544|Ga0070686_100770807 | All Organisms → cellular organisms → Bacteria | 773 | Open in IMG/M |
| 3300005545|Ga0070695_100866963 | All Organisms → cellular organisms → Bacteria | 727 | Open in IMG/M |
| 3300005545|Ga0070695_101096512 | All Organisms → cellular organisms → Bacteria | 651 | Open in IMG/M |
| 3300005545|Ga0070695_101647892 | All Organisms → cellular organisms → Bacteria | 536 | Open in IMG/M |
| 3300005546|Ga0070696_101076905 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 675 | Open in IMG/M |
| 3300005547|Ga0070693_100945543 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 649 | Open in IMG/M |
| 3300005564|Ga0070664_100875272 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 842 | Open in IMG/M |
| 3300005577|Ga0068857_101429128 | All Organisms → cellular organisms → Bacteria | 673 | Open in IMG/M |
| 3300005577|Ga0068857_101868117 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 588 | Open in IMG/M |
| 3300005616|Ga0068852_102622289 | All Organisms → cellular organisms → Bacteria | 524 | Open in IMG/M |
| 3300005841|Ga0068863_101056881 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes | 816 | Open in IMG/M |
| 3300005842|Ga0068858_100214979 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1820 | Open in IMG/M |
| 3300005842|Ga0068858_101948991 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes | 581 | Open in IMG/M |
| 3300006032|Ga0066696_10913204 | All Organisms → cellular organisms → Bacteria | 559 | Open in IMG/M |
| 3300006237|Ga0097621_100578306 | All Organisms → cellular organisms → Bacteria | 1025 | Open in IMG/M |
| 3300006844|Ga0075428_101283404 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 770 | Open in IMG/M |
| 3300006846|Ga0075430_101093936 | All Organisms → cellular organisms → Bacteria | 656 | Open in IMG/M |
| 3300006847|Ga0075431_100588606 | All Organisms → cellular organisms → Bacteria | 1097 | Open in IMG/M |
| 3300006854|Ga0075425_101767001 | All Organisms → cellular organisms → Bacteria | 695 | Open in IMG/M |
| 3300009011|Ga0105251_10128907 | All Organisms → cellular organisms → Bacteria | 1147 | Open in IMG/M |
| 3300009093|Ga0105240_12408258 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 545 | Open in IMG/M |
| 3300009098|Ga0105245_11260062 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 788 | Open in IMG/M |
| 3300009137|Ga0066709_102687314 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 664 | Open in IMG/M |
| 3300009147|Ga0114129_10631167 | Not Available | 1385 | Open in IMG/M |
| 3300009147|Ga0114129_11134232 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 977 | Open in IMG/M |
| 3300009148|Ga0105243_10781347 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 939 | Open in IMG/M |
| 3300009148|Ga0105243_12077309 | Not Available | 603 | Open in IMG/M |
| 3300009156|Ga0111538_10504004 | All Organisms → cellular organisms → Bacteria | 1534 | Open in IMG/M |
| 3300009162|Ga0075423_10032822 | All Organisms → cellular organisms → Bacteria | 5273 | Open in IMG/M |
| 3300009162|Ga0075423_11856804 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 650 | Open in IMG/M |
| 3300009162|Ga0075423_12453102 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 569 | Open in IMG/M |
| 3300009174|Ga0105241_12175958 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 550 | Open in IMG/M |
| 3300009176|Ga0105242_11140393 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 796 | Open in IMG/M |
| 3300009176|Ga0105242_12515394 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 563 | Open in IMG/M |
| 3300009553|Ga0105249_12457726 | Not Available | 593 | Open in IMG/M |
| 3300009553|Ga0105249_12691852 | Not Available | 569 | Open in IMG/M |
| 3300009789|Ga0126307_10992663 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 678 | Open in IMG/M |
| 3300010362|Ga0126377_12539769 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Acidimicrobiia → Acidimicrobiales → Acidimicrobiaceae → unclassified Acidimicrobiaceae → Acidimicrobiaceae bacterium | 588 | Open in IMG/M |
| 3300010375|Ga0105239_13422897 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Blastocatellales → Pyrinomonadaceae → unclassified Pyrinomonadaceae → Pyrinomonadaceae bacterium | 516 | Open in IMG/M |
| 3300010397|Ga0134124_11089751 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 815 | Open in IMG/M |
| 3300010397|Ga0134124_11590592 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 684 | Open in IMG/M |
| 3300010397|Ga0134124_11998062 | All Organisms → cellular organisms → Bacteria | 617 | Open in IMG/M |
| 3300010401|Ga0134121_11262385 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 742 | Open in IMG/M |
| 3300011003|Ga0138514_100074004 | All Organisms → cellular organisms → Bacteria | 716 | Open in IMG/M |
| 3300012469|Ga0150984_100612832 | Not Available | 605 | Open in IMG/M |
| 3300012958|Ga0164299_11148936 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 584 | Open in IMG/M |
| 3300013306|Ga0163162_10618212 | All Organisms → cellular organisms → Bacteria | 1209 | Open in IMG/M |
| 3300013306|Ga0163162_11720874 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 716 | Open in IMG/M |
| 3300013306|Ga0163162_12464433 | Not Available | 598 | Open in IMG/M |
| 3300013308|Ga0157375_10734318 | Not Available | 1139 | Open in IMG/M |
| 3300014325|Ga0163163_12028423 | All Organisms → cellular organisms → Bacteria | 635 | Open in IMG/M |
| 3300014325|Ga0163163_12251805 | Not Available | 604 | Open in IMG/M |
| 3300015357|Ga0134072_10483364 | All Organisms → cellular organisms → Bacteria | 506 | Open in IMG/M |
| 3300015374|Ga0132255_102645128 | All Organisms → cellular organisms → Bacteria | 767 | Open in IMG/M |
| 3300018466|Ga0190268_10434041 | Not Available | 861 | Open in IMG/M |
| 3300018476|Ga0190274_10486153 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1229 | Open in IMG/M |
| 3300018920|Ga0190273_11476118 | Not Available | 599 | Open in IMG/M |
| 3300025899|Ga0207642_10168032 | All Organisms → cellular organisms → Bacteria | 1184 | Open in IMG/M |
| 3300025901|Ga0207688_11051720 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 514 | Open in IMG/M |
| 3300025911|Ga0207654_10671563 | Not Available | 743 | Open in IMG/M |
| 3300025923|Ga0207681_10398250 | All Organisms → cellular organisms → Bacteria | 1111 | Open in IMG/M |
| 3300025927|Ga0207687_10712844 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 852 | Open in IMG/M |
| 3300025945|Ga0207679_12086395 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Bipolaricaulota → unclassified Candidatus Bipolaricaulota → Candidatus Acetothermia bacterium | 515 | Open in IMG/M |
| 3300025961|Ga0207712_12062029 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 510 | Open in IMG/M |
| 3300026023|Ga0207677_10156922 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1763 | Open in IMG/M |
| 3300026035|Ga0207703_10971934 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 814 | Open in IMG/M |
| 3300026075|Ga0207708_11708006 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 553 | Open in IMG/M |
| 3300026078|Ga0207702_10921121 | All Organisms → cellular organisms → Bacteria | 866 | Open in IMG/M |
| 3300026089|Ga0207648_11246951 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 698 | Open in IMG/M |
| 3300026095|Ga0207676_10825364 | Not Available | 906 | Open in IMG/M |
| 3300027909|Ga0209382_11932299 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium RIFCSPLOWO2_02_FULL_64_15 | 569 | Open in IMG/M |
| 3300031366|Ga0307506_10235360 | All Organisms → cellular organisms → Bacteria | 689 | Open in IMG/M |
| 3300031731|Ga0307405_11034695 | All Organisms → cellular organisms → Bacteria | 702 | Open in IMG/M |
| 3300031824|Ga0307413_10423041 | All Organisms → cellular organisms → Bacteria | 1050 | Open in IMG/M |
| 3300031911|Ga0307412_10093584 | All Organisms → cellular organisms → Bacteria | 2108 | Open in IMG/M |
| 3300031995|Ga0307409_100537263 | All Organisms → cellular organisms → Bacteria | 1145 | Open in IMG/M |
| 3300032000|Ga0310903_10258295 | Not Available | 841 | Open in IMG/M |
| 3300032075|Ga0310890_10515646 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium 13_1_40CM_2_68_5 | 911 | Open in IMG/M |
| 3300033412|Ga0310810_11406034 | Not Available | 532 | Open in IMG/M |
| 3300034690|Ga0364923_0157938 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 594 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 10.78% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 9.80% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 5.88% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 5.88% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 5.88% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 4.90% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 4.90% |
| Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 3.92% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 3.92% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 3.92% |
| Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere | 3.92% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 3.92% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 3.92% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 2.94% |
| Sugarcane Root And Bulk Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Sugarcane Root And Bulk Soil | 1.96% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 1.96% |
| Switchgrass Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere | 1.96% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Miscanthus Rhizosphere | 1.96% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Roots → Rhizosphere → Soil → Switchgrass Rhizosphere | 1.96% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere | 1.96% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 0.98% |
| Serpentine Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Serpentine Soil | 0.98% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 0.98% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 0.98% |
| Corn Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere | 0.98% |
| Sediment | Environmental → Terrestrial → Floodplain → Sediment → Unclassified → Sediment | 0.98% |
| Soil | Environmental → Terrestrial → Agricultural Field → Unclassified → Unclassified → Soil | 0.98% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 0.98% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn, Switchgrass And Miscanthus Rhizosphere | 0.98% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Roots → Rhizosphere → Soil → Miscanthus Rhizosphere | 0.98% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.98% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 0.98% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere | 0.98% |
| Avena Fatua Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Avena Fatua Rhizosphere | 0.98% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 2228664022 | Soil microbial communities from Great Prairies - Iowa, Native Prairie soil | Environmental | Open in IMG/M |
| 3300000033 | Soil microbial communities from Great Prairies - Iowa, Continuous Corn soil | Environmental | Open in IMG/M |
| 3300000363 | Soil microbial communities from Great Prairies - Iowa, Continuous Corn soil | Environmental | Open in IMG/M |
| 3300003267 | Sugarcane bulk soil Sample L1 | Environmental | Open in IMG/M |
| 3300003324 | Sugarcane bulk soil Sample H2 | Environmental | Open in IMG/M |
| 3300004114 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of AARS Block 5 | Environmental | Open in IMG/M |
| 3300004156 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Combined assembly of AARS Block 1 | Environmental | Open in IMG/M |
| 3300004479 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of All WPAs | Environmental | Open in IMG/M |
| 3300004480 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of AARS Block 4 | Environmental | Open in IMG/M |
| 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 | Host-Associated | Open in IMG/M |
| 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Host-Associated | Open in IMG/M |
| 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Environmental | Open in IMG/M |
| 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Host-Associated | Open in IMG/M |
| 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Environmental | Open in IMG/M |
| 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Environmental | Open in IMG/M |
| 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Host-Associated | Open in IMG/M |
| 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Environmental | Open in IMG/M |
| 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Environmental | Open in IMG/M |
| 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Environmental | Open in IMG/M |
| 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Environmental | Open in IMG/M |
| 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Environmental | Open in IMG/M |
| 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Host-Associated | Open in IMG/M |
| 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Host-Associated | Open in IMG/M |
| 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Host-Associated | Open in IMG/M |
| 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Host-Associated | Open in IMG/M |
| 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Host-Associated | Open in IMG/M |
| 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Host-Associated | Open in IMG/M |
| 3300006032 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_145 | Environmental | Open in IMG/M |
| 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) | Host-Associated | Open in IMG/M |
| 3300006844 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Host-Associated | Open in IMG/M |
| 3300006846 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Host-Associated | Open in IMG/M |
| 3300006847 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Host-Associated | Open in IMG/M |
| 3300006854 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD4 | Host-Associated | Open in IMG/M |
| 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Host-Associated | Open in IMG/M |
| 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Host-Associated | Open in IMG/M |
| 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Host-Associated | Open in IMG/M |
| 3300009137 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_158 | Environmental | Open in IMG/M |
| 3300009147 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) | Host-Associated | Open in IMG/M |
| 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Host-Associated | Open in IMG/M |
| 3300009156 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD1 (version 2) | Host-Associated | Open in IMG/M |
| 3300009162 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD2 | Host-Associated | Open in IMG/M |
| 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Host-Associated | Open in IMG/M |
| 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Host-Associated | Open in IMG/M |
| 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Host-Associated | Open in IMG/M |
| 3300009789 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot28 | Environmental | Open in IMG/M |
| 3300010362 | Tropical forest soil microbial communities from Panama - MetaG Plot_22 | Environmental | Open in IMG/M |
| 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Host-Associated | Open in IMG/M |
| 3300010397 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-4 | Environmental | Open in IMG/M |
| 3300010401 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-1 | Environmental | Open in IMG/M |
| 3300011003 | Agricultural soil microbial communities from Tamara ranch near Red Deer, Alberta, Canada - d1t9i015 | Environmental | Open in IMG/M |
| 3300012469 | Combined assembly of Soil carbon rhizosphere | Host-Associated | Open in IMG/M |
| 3300012958 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_221_MG | Environmental | Open in IMG/M |
| 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Host-Associated | Open in IMG/M |
| 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Host-Associated | Open in IMG/M |
| 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Host-Associated | Open in IMG/M |
| 3300015357 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_20cm_5_0_1 metaG | Environmental | Open in IMG/M |
| 3300015374 | Col-0 rhizosphere combined assembly | Host-Associated | Open in IMG/M |
| 3300018466 | Populus adjacent soil microbial communities from riparian zone of Blue River, Arizona, USA - 249 T | Environmental | Open in IMG/M |
| 3300018476 | Populus adjacent soil microbial communities from riparian zone of Yellowstone River, Montana, USA - 531 T | Environmental | Open in IMG/M |
| 3300018920 | Populus adjacent soil microbial communities from riparian zone of Shoshone River, Wyoming, USA - 504 IS | Environmental | Open in IMG/M |
| 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300027909 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD5 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300031366 | Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 25_S | Environmental | Open in IMG/M |
| 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Host-Associated | Open in IMG/M |
| 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Host-Associated | Open in IMG/M |
| 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Host-Associated | Open in IMG/M |
| 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Host-Associated | Open in IMG/M |
| 3300032000 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C0D3 | Environmental | Open in IMG/M |
| 3300032075 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T20D3 | Environmental | Open in IMG/M |
| 3300033412 | Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - NC | Environmental | Open in IMG/M |
| 3300034690 | Sediment microbial communities from East River floodplain, Colorado, United States - 60_j17 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| INPgaii200_05228422 | 2228664022 | Soil | MGSILNENDRVEICNRLRSLSVSSKGRWGSMDVIGMLQHLRLSARMALGE |
| ICChiseqgaiiDRAFT_04698493 | 3300000033 | Soil | MRSILHEXDRAEIATRMGSLSVSSTGRWGSLGVTEMLQHLCLSARMTLGDLSVPSANK |
| ICChiseqgaiiFebDRAFT_112212401 | 3300000363 | Soil | MGSILNESDRAEIDRRLRSLSASSTARWGRMDVVGMLQHLRLASRMTLG |
| soilL1_100412014 | 3300003267 | Sugarcane Root And Bulk Soil | MRSILKDEDRAAIVNRLRSLSASSTRRWGTMDVTSMLRHLRLSALMTVGELSVPS |
| soilH2_101454292 | 3300003324 | Sugarcane Root And Bulk Soil | MRSILKDEDRAAIVNRLRSLSASSTRRWGTMDVTSMLRHLRLSALMTVGELSVPSVNK |
| Ga0062593_1034866921 | 3300004114 | Soil | MGSILNETDRKAISDRLRSLSVSSNRRWGTMDVTGMLQHLRRSALMCVGELSVP |
| Ga0062589_1018482542 | 3300004156 | Soil | MRSILNEGDRAEITTRMRSLSVSSTGRWGSLGVTEMLQHLRLSARMTVGDLSVPSANKRA |
| Ga0062595_1013403201 | 3300004479 | Soil | MRSILNEEDHAEIIRRLNSLSISSTRQWGSLDVVGMLQHLRLSAQMTLGELQVPSKNK |
| Ga0062595_1018979232 | 3300004479 | Soil | MGSILNEDNRAEIVTRLRSLSEASTRRWGSMDLAGMLRHLRLSARMAL |
| Ga0062592_1017793622 | 3300004480 | Soil | MGSILNEVDRTELSNRLRSLSASSNRRWGSMDVVAMLQHLRLSADMALGELPV |
| Ga0065712_100154274 | 3300005290 | Miscanthus Rhizosphere | MRSIHNETDRAAIGNRLRSLSVSSTGRWGSMDVAAMLRHLHLAMSMTVGELPVPSANK |
| Ga0065712_102955161 | 3300005290 | Miscanthus Rhizosphere | MGSIHNESDRAAIVNRMRSLTTSSTRRWGTMDVTGMLKHLHLSALMTLG |
| Ga0068868_1012542941 | 3300005338 | Miscanthus Rhizosphere | MGNILDEGDRGVISSRLRSLSASSTRRWGTMDVVGMLEHLRLSALMTVGELSVPSVN |
| Ga0070687_1014725581 | 3300005343 | Switchgrass Rhizosphere | MGSILNESDRAAICNRMSSLSASSTARWGRMNVTEMLQHLRLSARMTVGEL |
| Ga0070674_1001944271 | 3300005356 | Miscanthus Rhizosphere | MGSILDTSDRAEICRRVRLLSDSSTGRWGTLSVAGMLQHLHLSAR |
| Ga0070701_109007431 | 3300005438 | Corn, Switchgrass And Miscanthus Rhizosphere | MGSILNENNRVEIVSRMQSLSASSTGRWGTLDVAGMLQHLRLSARMTLGELPTVSANKR |
| Ga0070694_1011522881 | 3300005444 | Corn, Switchgrass And Miscanthus Rhizosphere | MGSILKESDRTAIVNRMRSLSASSTGRWGSMDVTAMLKHLRLSALMTVGELEVPSVNKRA |
| Ga0070694_1016107961 | 3300005444 | Corn, Switchgrass And Miscanthus Rhizosphere | MRSILNESDRAAIFNRVRSLSASSTARWGRMSVTGMLQHLRLSAQMAV |
| Ga0070694_1019009941 | 3300005444 | Corn, Switchgrass And Miscanthus Rhizosphere | MGSILNESDRAEITSRMRSLSVSSTGRWGSLDLAGMLQHLRLSALMTL |
| Ga0068867_1016357231 | 3300005459 | Miscanthus Rhizosphere | MGSILNENDRAEITRRMKSLSEASSRQWGSMDVASMLKHLRLSAEMTLGDLPVTDSKKRAFQ |
| Ga0070679_1016719802 | 3300005530 | Corn Rhizosphere | MGSIHKDADRTAIVNRLQSLSTSSTARWGSMDVLAMLRHLNLSARMTVGEL |
| Ga0070686_1007708071 | 3300005544 | Switchgrass Rhizosphere | MHSILNENDRAEIILRVQSLSASSTRRWGTMDVVGMLQHLRLSARMTLG |
| Ga0070695_1008669632 | 3300005545 | Corn, Switchgrass And Miscanthus Rhizosphere | MGSILNEADRKAISDRFRSLSASSTGRWGSMDVTSMLQHLRRSALMCVGELPVPSANK |
| Ga0070695_1010965122 | 3300005545 | Corn, Switchgrass And Miscanthus Rhizosphere | MGSILNENDRAAICNRMRSLSTTSTARWGRMNVTEMLQHLRLSARMTVGELEVASS |
| Ga0070695_1016478921 | 3300005545 | Corn, Switchgrass And Miscanthus Rhizosphere | MGSILNEADRTELVNRLRSLSASSTRRWGSMDVVAMLQHLRLSAGMALGELPVSAKNKR |
| Ga0070696_1010769052 | 3300005546 | Corn, Switchgrass And Miscanthus Rhizosphere | MGTILNERERAEIDSRLRSLSLSSTRRWGAMDVVSMLQHLRLSARMALGEL |
| Ga0070693_1009455431 | 3300005547 | Corn, Switchgrass And Miscanthus Rhizosphere | MGSILNKSDRAAICNRMSSLPASSTARWGRMNVTEMLQHLRLSARM |
| Ga0070664_1008752722 | 3300005564 | Corn Rhizosphere | MGSILNDNDRAAIETRLRSLSVSSTRHWGTMDVAGMLQHLQLSARMTLG |
| Ga0068857_1014291282 | 3300005577 | Corn Rhizosphere | MGSILNEDDLAAIGSRVRSLSASSTGRWGTMDVAGMLRHLRLSAQMAVGELSV |
| Ga0068857_1018681172 | 3300005577 | Corn Rhizosphere | MGSILNEKDRRAIVARMQSLTASSTRRWGQLDITGMLQHLQLSARMTLGELEVPSVN |
| Ga0068852_1026222891 | 3300005616 | Corn Rhizosphere | MRSILNERDRGEISGRLQSLSVSSTARWGSMDVANMLKHLHLSARMTLGELPV |
| Ga0068863_1010568812 | 3300005841 | Switchgrass Rhizosphere | MGSILNEDDRAAILTRMRSLSASSTGRWGTLDVVGMLQHLGLSARMTLGELSVPSSNKRV |
| Ga0068858_1002149791 | 3300005842 | Switchgrass Rhizosphere | MGSILNETDRAAITSRVRSLSSSSTRRWGTLDVTGMLKHLHLSALMALGEMEVP |
| Ga0068858_1019489911 | 3300005842 | Switchgrass Rhizosphere | MGSILNEDDRAAILTRMRSLSASSTGRWGTLDVVGMLQHLGLSARMTLGELSV |
| Ga0068862_1007823661 | 3300005844 | Switchgrass Rhizosphere | MRSIHNESDRAAIGNRLRSLTASSTRQWGSMDVAAMLRHLHLTMSMTVGELPVPSANKR |
| Ga0066696_109132042 | 3300006032 | Soil | MRTILNEDDLNAILNRVRSLSVSSTRRWGSMDVTGMLQHLRLSGLMTVGE |
| Ga0097621_1005783063 | 3300006237 | Miscanthus Rhizosphere | MGSILNETDRKAISDRLRSLSVSSNRRWGTMDVTGMLQHLRRSALMCVGELSVPSA |
| Ga0075428_1012834043 | 3300006844 | Populus Rhizosphere | MRSILNEGDRAQIGGRVRSLSVSSTGKWGTLDVAGMLQHLRLSASMTLG |
| Ga0075430_1010939362 | 3300006846 | Populus Rhizosphere | MGSILNEQDRAAIDRRLRSLSLSSTRRWGSMDVVAMLQHLRLSARMTLGELSV |
| Ga0075431_1005886061 | 3300006847 | Populus Rhizosphere | MGSILNEQDRSAIDRRLRSLSVSSTRRWGSMDVVAMLQHLRLSARMTLGELSVPSVNKRP |
| Ga0075425_1017670011 | 3300006854 | Populus Rhizosphere | MRSILNEDDHAEIIRRLNSLSVSSTRRWGNLDVAGMVQHLRLSAQMT |
| Ga0105251_101289073 | 3300009011 | Switchgrass Rhizosphere | MGSILNETDRKAISDRFRSLSVSSNRRWGTMDVTGMLQHLRRSALMCVGEL |
| Ga0105240_124082581 | 3300009093 | Corn Rhizosphere | MRSILNEADRAEIVRRLRSLSVTSAGRWGSMDVTAMLRHLRLSARMALGEMPVPSANK |
| Ga0105245_112600621 | 3300009098 | Miscanthus Rhizosphere | MGSILNESDRNAITSRVRSLSVSSTRRWGSMDVTGMLQHLRRSALVCVGDLSVPSANKR |
| Ga0066709_1026873141 | 3300009137 | Grasslands Soil | MGSILNEGDRAKIVSRLESLSVSSTRRWGSLEVAGMLQHLRLSARMTLGEMPVASSNKR |
| Ga0114129_106311672 | 3300009147 | Populus Rhizosphere | MGSILNETDRATITSRLHALSTSSVRRWGTLDVVGMLQHLNLSTRMALGDMP |
| Ga0114129_111342321 | 3300009147 | Populus Rhizosphere | MRSILNEDDRAEIFSRVRSLSVSSIRRWGSLDVTGMLQHLHLSARMTVGELAV |
| Ga0105243_107813473 | 3300009148 | Miscanthus Rhizosphere | MRSILNEVDRKEICSRVRSLSTSSTARWGTMGVTDMLQHLRLAARMTLGELPVPSSNKR |
| Ga0105243_120773091 | 3300009148 | Miscanthus Rhizosphere | MRSILNEVDRKEITSRLLSLSATSTPRWGSMSVTDMLQHLRL |
| Ga0111538_105040041 | 3300009156 | Populus Rhizosphere | MGSILNEVDRTELANRLQSLSASSTRRWGSMDVVGMLQHLRLSADMAVGELPVSVKNKRA |
| Ga0075423_100328225 | 3300009162 | Populus Rhizosphere | MGSILNEGHRAEIVSRLQSLSASSTRRWGTLDVVGMLQHLRLSARMTV |
| Ga0075423_118568043 | 3300009162 | Populus Rhizosphere | MRSILNEGDRAEICRRLKSLSDSSTRKWGSMDITGMLQHLSLSARMALGE |
| Ga0075423_124531021 | 3300009162 | Populus Rhizosphere | MRSILNEDDRAEIFSRVRSLSVSSIRRWGSLDVTGMLQHLHLSARMTVG* |
| Ga0105241_121759582 | 3300009174 | Corn Rhizosphere | MRSILNERDRAEINSRLQSLSVSSSRRWGTMDVANMLKHLHLSARMTLGELPVV |
| Ga0105242_111403931 | 3300009176 | Miscanthus Rhizosphere | MGSILNEDDRREIVGRFQSLSASSTRRWGSMDVASMLQHLILSARMTLGELP |
| Ga0105242_125153941 | 3300009176 | Miscanthus Rhizosphere | MGSILNENDRSQIVRRLGSLSGSSNRRWGTLDVTGMLQHLRLSARMTL |
| Ga0105249_124577262 | 3300009553 | Switchgrass Rhizosphere | MRSILNEGDRAEITSRVRSLSVSSTRRWGSMGVADMLQHLSLSARMTLGELPVPSSN |
| Ga0105249_126918522 | 3300009553 | Switchgrass Rhizosphere | MGSILNESDRAAICTRLGTLSASSTARWGQMSVTGMLQRLRLSAQMAVGDLDVASANK |
| Ga0126307_109926632 | 3300009789 | Serpentine Soil | MSSILNEGDRTAIDRRVRSLSVSSTARWGSMDVTGMLQHLRLSARMTLGELSVPS |
| Ga0126377_125397692 | 3300010362 | Tropical Forest Soil | MIMGSILNENDRAAIISRMQSLSGSSTGRWGRMDVAGMLQHLRLSASMALGELS |
| Ga0105239_134228971 | 3300010375 | Corn Rhizosphere | MRTILNEADRAEIVRRLRSLSVTSAGQWGSMDVTAMLQHLRLSARMALGEMPVPSANKRVFQ |
| Ga0134124_110897511 | 3300010397 | Terrestrial Soil | MRSILNERDRAAICGRVRSLSVSSTGRWGGMSVTDMLQHLGLSARMALGELQVTSANLRAFQF |
| Ga0134124_115905922 | 3300010397 | Terrestrial Soil | MGSILNDNDRAAIETRLRSLSVSSTRQWGTMDVAGMLQHLQLSARMTLGELDVPSVN |
| Ga0134124_119980622 | 3300010397 | Terrestrial Soil | MGSILKESDRAEIVGRLRSLTAQSTRQWGTLDVTGMLQHLNLSARMTL |
| Ga0134121_112623852 | 3300010401 | Terrestrial Soil | MGSILKESDRTAICTRLRALSASSTARWGQMNVTGMLQHLRLSAQMAVG |
| Ga0138514_1000740042 | 3300011003 | Soil | MRSILNESDRGAICSRLRSLSATSTARWGKMNVTGMLEHLRLSAQM |
| Ga0150984_1006128322 | 3300012469 | Avena Fatua Rhizosphere | MGSILNEGDRAEIIRRFGSLSESSTGRWGSLDVVGMLQHLRLSASMTLGELTVPSS |
| Ga0164299_111489361 | 3300012958 | Soil | MRSILNEADRAEIGRRLSSLSVTSAGRWGSLDVTAMLLHLRLSARMALGEMPVPS |
| Ga0163162_106182122 | 3300013306 | Switchgrass Rhizosphere | MMGSILNEADRTELVNRLRSLSASSTRRWGSMDVVAMLQHLRLSAGMALGELPVSAK |
| Ga0163162_117208741 | 3300013306 | Switchgrass Rhizosphere | MGSILNERDRAEIGSRVRSLTESSTRRWGSMDVTSMLQHLHLSSLMALGELPVASANKR |
| Ga0163162_124644332 | 3300013306 | Switchgrass Rhizosphere | MRSILNEADRNAISSRVRSLSGSSTAKWGSMDVTAMLEHLRRSALMCLGEL |
| Ga0157375_107343183 | 3300013308 | Miscanthus Rhizosphere | MRSINNESDRAAIGNRLRSLSASSTRRWGSMDVAAMLRHLHLSMSMTVGELPV |
| Ga0163163_120284233 | 3300014325 | Switchgrass Rhizosphere | MGSILNESDRTAIFNRMRSLSESSTARWGRMNVTEMLQHLRLSARMT |
| Ga0163163_122518051 | 3300014325 | Switchgrass Rhizosphere | MGSILNDDDRQVILTRMQSLTASSTRRWGQLDITGMLHHLQLSARMTLGELEVP |
| Ga0134072_104833641 | 3300015357 | Grasslands Soil | MTRTILNENDLDTILNRLKSLSGSSTRRWGSMDVTGMLKHLRLSALMTVGELP |
| Ga0132255_1026451281 | 3300015374 | Arabidopsis Rhizosphere | MGSILNENDRAEICSRLGSLSVSSKRVWGSMDVVQMLQHLRLSARMAL |
| Ga0190268_104340411 | 3300018466 | Soil | MGSILNEIDRAEIDRRMRSLSASSPRRWGSLDVVGMLKHLSLSANMALG |
| Ga0190274_104861531 | 3300018476 | Soil | MGSILNESDRAAICNRMRSLSASSTARWGRMNVTEMLRHLRLSARMT |
| Ga0190273_114761181 | 3300018920 | Soil | MGSILNDANRAEIVRRMRSLSASSTARWGSMNVVSMLQHLALSARMTLGELPVPSANKR |
| Ga0207642_101680321 | 3300025899 | Miscanthus Rhizosphere | MGSILNEDNRTEIVNRMQSLSASSTGRWGTLDVAGMLQHLRLSARMTLGELPTVSANKRAFQV |
| Ga0207688_110517201 | 3300025901 | Corn, Switchgrass And Miscanthus Rhizosphere | MGSILNETDRAAIVSRLRSLSDSSTRRWGSLDVTGMLQHLNLSARMTVGDSFD |
| Ga0207654_106715631 | 3300025911 | Corn Rhizosphere | MGSILNESERAQIVSRLQSLSVSSAARWGSMNVESMLQHLSLSARMVLG |
| Ga0207681_103982504 | 3300025923 | Switchgrass Rhizosphere | MGSILNEDNRTEIVNRMQSLSASSTGRWGTLDVAGMLQHLRLSARMTLGELPTVSAN |
| Ga0207687_107128441 | 3300025927 | Miscanthus Rhizosphere | MGSILNESDRNAITSRVRSLSVSSTRRWGSMDVTGMLQHLRRSALVCVGDLSVP |
| Ga0207679_120863952 | 3300025945 | Corn Rhizosphere | MGSILNEDNRTEIVNRMRSLSISSTGRWGTLDVAGMLQHLRLSARMTLGELPTVSANKRAFQ |
| Ga0207712_120620291 | 3300025961 | Switchgrass Rhizosphere | MRSILNEVNRKEISSRLQSLSTSSTARWGSMGVTDMLQHLRLSARMTLGEL |
| Ga0207677_101569221 | 3300026023 | Miscanthus Rhizosphere | MGSILKESDRAEIAGRLRSLTALSTRQWGTLDVIGMLQHLNLSARMT |
| Ga0207703_109719342 | 3300026035 | Switchgrass Rhizosphere | MGSILNETDRAAITSRVRSLSSSSTRRWGTLDVTGMLKHLHLSALMALGEMEVPS |
| Ga0207708_117080062 | 3300026075 | Corn, Switchgrass And Miscanthus Rhizosphere | MHSILNENDRAEIILRVQSLSASSTRRWGTMDVVGMLQHLRLSARMTLGELE |
| Ga0207702_109211213 | 3300026078 | Corn Rhizosphere | MGSILDENDRAEICNRLRSLTVSSKRVWGSMDVVGMLQHLRLSARMALGELPVPSANKRI |
| Ga0207648_112469511 | 3300026089 | Miscanthus Rhizosphere | MGSILNEADRTAISNRLRSLSVSSDRRWGTLDVTGMLQHLRRSALMCVGEL |
| Ga0207676_108253641 | 3300026095 | Switchgrass Rhizosphere | MRSILNEVDRKEITSRLRSLSATSTPRWGSMSVTDMLQHLRLSARMTLG |
| Ga0209382_119322991 | 3300027909 | Populus Rhizosphere | MHSILNESDRAAICSRVRSLSDSSTARWGRMNVTGMLKHLRLSARMAVGELEV |
| Ga0307506_102353601 | 3300031366 | Soil | MGSILKEADRANIDNRLRSLTASSTGRWGTLDVVGMLQHLRLSARMTLG |
| Ga0307405_110346952 | 3300031731 | Rhizosphere | MGSILNERDRTEIVSRLQSLSVSSTARWGSMDVAKMLHHLRLSASLALGEL |
| Ga0307413_104230412 | 3300031824 | Rhizosphere | MGSILNERDRTEIVRRLQSLSVSSTARWGSMDVANMLHHLRLSASMALGELPVV |
| Ga0307412_100935844 | 3300031911 | Rhizosphere | MGSILNETDRAEIVRRMQSLSVSTNRRWGTMDVVGMLQHLRLAARMTV |
| Ga0307409_1005372633 | 3300031995 | Rhizosphere | MGSILNETDRAEIVRRMQSLSVSTNRRWGTMDVVGMLQHLRLAARMTVGDLA |
| Ga0310903_102582951 | 3300032000 | Soil | MRSILNEADRTELAKRLRSLSASSNRQWGSMDVVAMLQHLRLSAGMALGEL |
| Ga0310890_105156461 | 3300032075 | Soil | MGSILNEADRTELVNRLRSLSASSTRRWGSMDVVAMLQHLRLSAGMALGELPV |
| Ga0310810_114060342 | 3300033412 | Soil | MGSILNEQDRNAINNRLRSLSPSSTRRWGSLDVAGMLHHLQLSARMTLGELEV |
| Ga0364923_0157938_3_149 | 3300034690 | Sediment | MRSILNESDRATICSRVRSLSASSAARWGRMSVTGMLQHLRLSAQMTVG |
| ⦗Top⦘ |