NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F101376

Metagenome / Metatranscriptome Family F101376

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F101376
Family Type Metagenome / Metatranscriptome
Number of Sequences 102
Average Sequence Length 45 residues
Representative Sequence HPDVFARLVEDQRREQDSAKRMKNDDVTLMRLRMLAGQPAYLLACR
Number of Associated Samples 93
Number of Associated Scaffolds 102

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 0.00 %
% of genes near scaffold ends (potentially truncated) 99.02 %
% of genes from short scaffolds (< 2000 bps) 89.22 %
Associated GOLD sequencing projects 90
AlphaFold2 3D model prediction No

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (69.608 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Environmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa
(11.765 % of family members)
Environment Ontology (ENVO) Unclassified
(23.529 % of family members)
Earth Microbiome Project Ontology (EMPO) Free-living → Non-saline → Soil (non-saline)
(51.961 % of family members)



 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      


 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 76.09%    β-sheet: 0.00%    Coil/Unstructured: 23.91%
Feature Viewer
Powered by Feature Viewer


 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 102 Family Scaffolds
PF01636APH 7.84
PF00069Pkinase 7.84
PF08241Methyltransf_11 0.98
PF05448AXE1 0.98
PF01979Amidohydro_1 0.98
PF01633Choline_kinase 0.98
PF01035DNA_binding_1 0.98
PF12323HTH_OrfB_IS605 0.98

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 102 Family Scaffolds
COG0515Serine/threonine protein kinaseSignal transduction mechanisms [T] 31.37
COG0350DNA repair enzyme Ada (O6-methylguanine-DNA--protein-cysteine methyltransferase)Replication, recombination and repair [L] 0.98
COG1506Dipeptidyl aminopeptidase/acylaminoacyl peptidaseAmino acid transport and metabolism [E] 0.98
COG3458Cephalosporin-C deacetylase or related acetyl esteraseSecondary metabolites biosynthesis, transport and catabolism [Q] 0.98
COG3695Alkylated DNA nucleotide flippase Atl1, participates in nucleotide excision repair, Ada-like DNA-binding domainTranscription [K] 0.98


 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms69.61 %
UnclassifiedrootN/A30.39 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
2189573002|GZIGXIF01BOZ9ZNot Available509Open in IMG/M
3300000955|JGI1027J12803_100898862All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Frankiales → Frankiaceae → Frankia725Open in IMG/M
3300001867|JGI12627J18819_10148185All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Frankiales → Frankiaceae → Frankia956Open in IMG/M
3300002245|JGIcombinedJ26739_101012436All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Frankiales → Frankiaceae → Frankia716Open in IMG/M
3300003505|JGIcombinedJ51221_10263263All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Frankiales → Frankiaceae → Frankia → unclassified Frankia → Frankia sp. EAN1pec701Open in IMG/M
3300004082|Ga0062384_100682207All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia705Open in IMG/M
3300005147|Ga0066821_1004450All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia848Open in IMG/M
3300005164|Ga0066815_10074905All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Frankiales → Frankiaceae → Frankia600Open in IMG/M
3300005338|Ga0068868_101144346All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Frankiales → Frankiaceae → Frankia717Open in IMG/M
3300005458|Ga0070681_10363947All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Frankiales → Frankiaceae → Frankia → unclassified Frankia → Frankia sp. EUN1f1356Open in IMG/M
3300005458|Ga0070681_11028699All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia744Open in IMG/M
3300005518|Ga0070699_100867251All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia826Open in IMG/M
3300005529|Ga0070741_10085864All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia3425Open in IMG/M
3300005575|Ga0066702_10316793All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia951Open in IMG/M
3300005587|Ga0066654_10366119All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Frankiales → Frankiaceae → Frankia784Open in IMG/M
3300006031|Ga0066651_10665330All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Frankiales → Frankiaceae → Frankia557Open in IMG/M
3300006237|Ga0097621_101630191All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia614Open in IMG/M
3300006573|Ga0074055_11764947All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia521Open in IMG/M
3300006580|Ga0074049_10005958All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Frankiales → Frankiaceae → Frankia589Open in IMG/M
3300006791|Ga0066653_10399040All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Frankiales → Frankiaceae → Frankia703Open in IMG/M
3300006854|Ga0075425_102237731All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Frankiales → Frankiaceae → Frankia → unclassified Frankia → Frankia sp. EUN1f608Open in IMG/M
3300009137|Ga0066709_104327125Not Available518Open in IMG/M
3300009520|Ga0116214_1362360Not Available562Open in IMG/M
3300009521|Ga0116222_1049936All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia1824Open in IMG/M
3300009525|Ga0116220_10401611Not Available613Open in IMG/M
3300009628|Ga0116125_1062028All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia964Open in IMG/M
3300009700|Ga0116217_10307659All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia1018Open in IMG/M
3300010341|Ga0074045_10973930Not Available534Open in IMG/M
3300010379|Ga0136449_100409689All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia2400Open in IMG/M
3300010379|Ga0136449_102702996Not Available704Open in IMG/M
3300010379|Ga0136449_102703174All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia704Open in IMG/M
3300011120|Ga0150983_12972948All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia996Open in IMG/M
3300012189|Ga0137388_12033912Not Available502Open in IMG/M
3300012205|Ga0137362_10814986All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia799Open in IMG/M
3300012211|Ga0137377_10899581All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia817Open in IMG/M
3300012491|Ga0157329_1042199Not Available515Open in IMG/M
3300012503|Ga0157313_1037121Not Available582Open in IMG/M
3300012515|Ga0157338_1077837Not Available531Open in IMG/M
3300012519|Ga0157352_1029167All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia721Open in IMG/M
3300012917|Ga0137395_10374469All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia1017Open in IMG/M
3300012929|Ga0137404_10523259All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia1060Open in IMG/M
3300012984|Ga0164309_10109013All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia1765Open in IMG/M
3300012985|Ga0164308_10077049All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia2264Open in IMG/M
3300014501|Ga0182024_12424858Not Available568Open in IMG/M
3300015264|Ga0137403_11304469Not Available572Open in IMG/M
3300016422|Ga0182039_11198432All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria686Open in IMG/M
3300018037|Ga0187883_10243174All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia921Open in IMG/M
3300018040|Ga0187862_10877992Not Available514Open in IMG/M
3300018062|Ga0187784_11204908Not Available601Open in IMG/M
3300019362|Ga0173479_10792798Not Available523Open in IMG/M
3300021171|Ga0210405_10351835All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia1162Open in IMG/M
3300021405|Ga0210387_10556269All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia1020Open in IMG/M
3300021432|Ga0210384_10319773All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia1397Open in IMG/M
3300021477|Ga0210398_10036648All Organisms → cellular organisms → Bacteria4080Open in IMG/M
3300021478|Ga0210402_11632415Not Available571Open in IMG/M
3300021479|Ga0210410_10258731All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia1561Open in IMG/M
3300024222|Ga0247691_1042086All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia693Open in IMG/M
3300025899|Ga0207642_10168232All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia1183Open in IMG/M
3300025910|Ga0207684_10099901All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia2479Open in IMG/M
3300025913|Ga0207695_11300025Not Available608Open in IMG/M
3300025916|Ga0207663_11124114All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia632Open in IMG/M
3300025928|Ga0207700_10362990All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia1263Open in IMG/M
3300025929|Ga0207664_11097998All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia711Open in IMG/M
3300025929|Ga0207664_11426839Not Available613Open in IMG/M
3300025938|Ga0207704_10129322All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia1745Open in IMG/M
3300025945|Ga0207679_11941756Not Available536Open in IMG/M
3300026075|Ga0207708_10591013Not Available939Open in IMG/M
3300026285|Ga0209438_1069938All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia1146Open in IMG/M
3300026557|Ga0179587_10235600All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia1168Open in IMG/M
3300027031|Ga0208986_1032382Not Available562Open in IMG/M
3300027166|Ga0208729_102231All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia995Open in IMG/M
3300027692|Ga0209530_1086614All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia896Open in IMG/M
3300027884|Ga0209275_10028174All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia2573Open in IMG/M
3300027884|Ga0209275_10892979Not Available512Open in IMG/M
3300027915|Ga0209069_10450999All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia715Open in IMG/M
3300028742|Ga0302220_10387089Not Available503Open in IMG/M
3300028775|Ga0302231_10486996Not Available521Open in IMG/M
3300028789|Ga0302232_10133149All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia1259Open in IMG/M
3300028879|Ga0302229_10059388All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia1879Open in IMG/M
3300029943|Ga0311340_10446647All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia1172Open in IMG/M
3300029943|Ga0311340_10615863All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia946Open in IMG/M
3300030013|Ga0302178_10005591All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales8881Open in IMG/M
3300030013|Ga0302178_10397922Not Available615Open in IMG/M
3300030494|Ga0310037_10076518All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia1569Open in IMG/M
3300030524|Ga0311357_10120330All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia2617Open in IMG/M
3300031234|Ga0302325_10161415All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria3974Open in IMG/M
3300031236|Ga0302324_100279912All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Frankiales → Frankiaceae → Frankia2576Open in IMG/M
3300031525|Ga0302326_11299460All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia991Open in IMG/M
3300031572|Ga0318515_10180488All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia1129Open in IMG/M
3300031708|Ga0310686_109208381Not Available542Open in IMG/M
3300031821|Ga0318567_10390284All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia788Open in IMG/M
3300031860|Ga0318495_10260269All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia775Open in IMG/M
3300031912|Ga0306921_11884963Not Available640Open in IMG/M
3300032067|Ga0318524_10568922All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia596Open in IMG/M
3300032067|Ga0318524_10649330Not Available556Open in IMG/M
3300032160|Ga0311301_11560459All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia807Open in IMG/M
3300032180|Ga0307471_103123311Not Available587Open in IMG/M
3300032770|Ga0335085_10130888All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria3183Open in IMG/M
3300032770|Ga0335085_12016104Not Available585Open in IMG/M
3300032895|Ga0335074_10378496All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia1552Open in IMG/M
3300033158|Ga0335077_10298033All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia1766Open in IMG/M
3300034819|Ga0373958_0113329Not Available648Open in IMG/M



 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil11.76%
PalsaEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa11.76%
Peatlands SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil8.82%
Vadose Zone SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil6.86%
Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil6.86%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Soil4.90%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere4.90%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil3.92%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil3.92%
SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Soil3.92%
Miscanthus RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere2.94%
Arabidopsis RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Rhizosphere2.94%
PeatlandEnvironmental → Aquatic → Freshwater → Wetlands → Bog → Peatland1.96%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil1.96%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil1.96%
SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Soil1.96%
Corn RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere1.96%
Agricultural SoilEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Agricultural Soil1.96%
Bog Forest SoilEnvironmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil0.98%
PeatlandEnvironmental → Aquatic → Freshwater → Wetlands → Unclassified → Peatland0.98%
WatershedsEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds0.98%
Grass SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Grass Soil0.98%
Surface SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil0.98%
Unplanted SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Unplanted Soil0.98%
Hardwood Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil0.98%
Tropical PeatlandEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland0.98%
Bog Forest SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Bog Forest Soil0.98%
PermafrostEnvironmental → Terrestrial → Soil → Wetlands → Permafrost → Permafrost0.98%
Miscanthus RhizosphereHost-Associated → Plants → Roots → Rhizosphere → Soil → Miscanthus Rhizosphere0.98%
Populus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere0.98%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere0.98%
Rhizosphere SoilHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Rhizosphere Soil0.98%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere0.98%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
2189573002Grass soil microbial communities from Rothamsted Park, UK - FE1 (NaCl 30g/L 5ml)EnvironmentalOpen in IMG/M
3300000955Soil microbial communities from Great Prairies - Iowa, Native Prairie soilEnvironmentalOpen in IMG/M
3300001867Texas A ecozone_OM1H0_M2 (Combined assembly for Texas A ecozone Site metagenome samples, ASSEMBLY_DATE=20130705)EnvironmentalOpen in IMG/M
3300002245Jack Pine, Ontario site 1_JW_OM2H0_M3 (Jack Pine, Ontario combined, ASSEMBLY_DATE=20131027)EnvironmentalOpen in IMG/M
3300003505Forest soil microbial communities from Harvard Forest LTER, USA - Combined assembly of forest soil metaG samples (ASSEMBLY_DATE=20140924)EnvironmentalOpen in IMG/M
3300004082Coassembly of ECP03_0M1, ECP03_OM2, ECP03_OM3EnvironmentalOpen in IMG/M
3300005147Soil and rhizosphere microbial communities from Laval, Canada - mgLMCEnvironmentalOpen in IMG/M
3300005164Soil and rhizosphere microbial communities from Laval, Canada - mgLACEnvironmentalOpen in IMG/M
3300005338Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2Host-AssociatedOpen in IMG/M
3300005458Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaGEnvironmentalOpen in IMG/M
3300005518Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaGEnvironmentalOpen in IMG/M
3300005529Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen16_06102014_R1EnvironmentalOpen in IMG/M
3300005575Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_151EnvironmentalOpen in IMG/M
3300005587Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_103EnvironmentalOpen in IMG/M
3300006031Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Angelo_100EnvironmentalOpen in IMG/M
3300006237Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2)Host-AssociatedOpen in IMG/M
3300006573Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtLAC (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300006580Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtLPC (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300006791Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_102EnvironmentalOpen in IMG/M
3300006854Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD4Host-AssociatedOpen in IMG/M
3300009137Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_158EnvironmentalOpen in IMG/M
3300009520Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_1_NS metaGEnvironmentalOpen in IMG/M
3300009521Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_9_AC metaGEnvironmentalOpen in IMG/M
3300009525Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_7_NC metaGEnvironmentalOpen in IMG/M
3300009628Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_16_10EnvironmentalOpen in IMG/M
3300009700Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_4_PS metaGEnvironmentalOpen in IMG/M
3300010341Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - Bog Forest MetaG ECP23OM2EnvironmentalOpen in IMG/M
3300010379Sb_50d combined assemblyEnvironmentalOpen in IMG/M
3300011120Combined assembly of Microbial Forest Soil metaTEnvironmentalOpen in IMG/M
3300012189Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4A metaGEnvironmentalOpen in IMG/M
3300012205Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_100_16 metaGEnvironmentalOpen in IMG/M
3300012211Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_40_16 metaGEnvironmentalOpen in IMG/M
3300012491Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.8.old.040610Host-AssociatedOpen in IMG/M
3300012503Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.5.old.080610_RHost-AssociatedOpen in IMG/M
3300012515Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.7.yng.070610Host-AssociatedOpen in IMG/M
3300012519Unplanted soil (control) microbial communities from North Carolina - M.Soil.7.yng.070610EnvironmentalOpen in IMG/M
3300012917Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czobulk2.16 metaGEnvironmentalOpen in IMG/M
3300012929Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Illumina Assembly)EnvironmentalOpen in IMG/M
3300012984Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_247_MGEnvironmentalOpen in IMG/M
3300012985Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_246_MGEnvironmentalOpen in IMG/M
3300014501Permafrost microbial communities from Stordalen Mire, Sweden - P3-2 metaG (Illumina Assembly)EnvironmentalOpen in IMG/M
3300015264Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Hybrid Assembly)EnvironmentalOpen in IMG/M
3300016422Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111EnvironmentalOpen in IMG/M
3300018037Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_20_10EnvironmentalOpen in IMG/M
3300018040Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_10_150EnvironmentalOpen in IMG/M
3300018062Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_SJ02_MP15_20_MGEnvironmentalOpen in IMG/M
3300019362Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S104-311B-1 (version 2)EnvironmentalOpen in IMG/M
3300021171Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-11-MEnvironmentalOpen in IMG/M
3300021405Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-OEnvironmentalOpen in IMG/M
3300021432Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-MEnvironmentalOpen in IMG/M
3300021477Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-4-OEnvironmentalOpen in IMG/M
3300021478Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-MEnvironmentalOpen in IMG/M
3300021479Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-4-MEnvironmentalOpen in IMG/M
3300024222Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK32EnvironmentalOpen in IMG/M
3300025899Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300025910Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025913Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025916Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025928Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025929Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025938Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300025945Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300026075Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300026285Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_20cm (SPAdes)EnvironmentalOpen in IMG/M
3300026557Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_08_16fungalEnvironmentalOpen in IMG/M
3300027031Forest soil microbial communities from El Dorado National Forest, California, USA - Mediterranean Blodgett CA OM1_O2 (SPAdes)EnvironmentalOpen in IMG/M
3300027166Forest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaG HF033 (SPAdes)EnvironmentalOpen in IMG/M
3300027692Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_Ref_O1 (SPAdes)EnvironmentalOpen in IMG/M
3300027884Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF2 (SPAdes)EnvironmentalOpen in IMG/M
3300027915Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Straight Creek_MetaG_SC_2013 (SPAdes)EnvironmentalOpen in IMG/M
3300028742Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_E1_3EnvironmentalOpen in IMG/M
3300028775Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_N2_2EnvironmentalOpen in IMG/M
3300028789Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_N2_3EnvironmentalOpen in IMG/M
3300028879Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_N1_3EnvironmentalOpen in IMG/M
3300029943I_Palsa_N3 coassemblyEnvironmentalOpen in IMG/M
3300030013Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Palsa_E1_3EnvironmentalOpen in IMG/M
3300030494Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_3_AS metaG (v2)EnvironmentalOpen in IMG/M
3300030524II_Palsa_N3 coassemblyEnvironmentalOpen in IMG/M
3300031234Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Palsa_T0_2EnvironmentalOpen in IMG/M
3300031236Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Palsa_T0_1EnvironmentalOpen in IMG/M
3300031525Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Palsa_T0_3EnvironmentalOpen in IMG/M
3300031572Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f19EnvironmentalOpen in IMG/M
3300031708FICUS49499 Metagenome Czech Republic combined assemblyEnvironmentalOpen in IMG/M
3300031821Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f20EnvironmentalOpen in IMG/M
3300031860Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.108b1f25EnvironmentalOpen in IMG/M
3300031912Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080 (v2)EnvironmentalOpen in IMG/M
3300032067Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f22EnvironmentalOpen in IMG/M
3300032160Sb_50d combined assembly (MetaSPAdes)EnvironmentalOpen in IMG/M
3300032180Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515EnvironmentalOpen in IMG/M
3300032770Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.5EnvironmentalOpen in IMG/M
3300032895Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.3EnvironmentalOpen in IMG/M
3300033158Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.1EnvironmentalOpen in IMG/M
3300034819Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1Host-AssociatedOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap



 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
FE1_046146002189573002Grass SoilEDQRREQDSAKRMKNDDVTLMRLRMLAGYPAYLLACR
JGI1027J12803_10089886213300000955SoilDQRREQDSSKRMKNDDVTLMRLRMLAGQPAYLLACR*
JGI12627J18819_1014818523300001867Forest SoilTTLAHPDVFARLIADQRREQDSAKRMKNDDVTLMRLRMLAGQPAYLLACR*
JGIcombinedJ26739_10101243623300002245Forest SoilSDHRKEQDDAKRMKNDDVTLMRLRLLADQPSFVLACR*
JGIcombinedJ51221_1026326313300003505Forest SoilAGLVHPDVFARLVSDQRKEQDAAKRMKNDDVTLMRLRMLADQPSFVLACR*
Ga0062384_10068220723300004082Bog Forest SoilVLGGLAHPAIFSRFVDDQRREIDSAKRMKNDDITLMRLRVLADPPWQAQHNV*
Ga0066821_100445023300005147SoilLVQDQRREQNSAKRMKNDDVTLMRLRMLAGQPAFLLAAR*
Ga0066815_1007490523300005164SoilAHPDVFARLIEDQRREQDSAKRMKNDDVTLMRLRILAGQPAYLLACR*
Ga0068868_10114434623300005338Miscanthus RhizosphereLTTLAHPDVFARLIEDQRREQDSAKRMKNDDVTLMRLRMLAGQPAYLLACR*
Ga0070681_1036394723300005458Corn RhizosphereVFARLIEDQRREQDSAKRMKNDDVTLMRLRMLAGQPAYLLACR*
Ga0070681_1102869913300005458Corn RhizosphereGEAKVWDTLTTLAHPDVFAQLVADQRREQDGSRRLKNDDVTLMRLRMLDGQPAYLLACR*
Ga0070699_10086725113300005518Corn, Switchgrass And Miscanthus RhizosphereLAHPDVFARLVGDQRREQDGVKRMKNDDVTLMRLRMLAGQPAFLLACR*
Ga0070741_1008586413300005529Surface SoilLTTLAHPDVFARLVADQRREQDSAKRLKNDDVTLMRLRMLDSQPAYLLACR*
Ga0066702_1031679313300005575SoilHPDVFARLVEDQRREQDSAKRMKNDDVTLMRLRMLAGQPAYLLACR*
Ga0066654_1036611923300005587SoilKVWDTLTTLAHPDVFAQLIADQRKEQDGSRRLKNDDVTLMRLRMLASQPAYLLACR*
Ga0066651_1066533023300006031SoilFAQLIADQRKEQDGSRRLKNDDVTLMRLRMLDSQPAYLLACR*
Ga0097621_10163019123300006237Miscanthus RhizosphereRREQDGSRRLKNDDVTLMRLRMLDSQPAYLLACR*
Ga0074055_1176494723300006573SoilVWDALTTLAHPDVFARLVQDQRREQNSAKRMKNDDVTLMRLRMLAGQPAFLLAAR*
Ga0074049_1000595813300006580SoilEDQRREQDSAKRMKNDDVTLMRLRMLVGQPAYLLACR*
Ga0066653_1039904023300006791SoilRLIEDHRREQDSASRMKNDDVTLMRLRMLAGQPAYLLVCR*
Ga0075425_10223773113300006854Populus RhizosphereQRREQDSAKRMKNDDVTLMRLRMLAGQPAYLLACR*
Ga0066709_10432712513300009137Grasslands SoilAKVWDTLTTLAHPDVFAQLIADQRKEQDGSRRLKNDDVTLMRLRMLDSQPAYLLACR*
Ga0116214_136236023300009520Peatlands SoilARLIEDQRREQNSAKRMKNDDVTLMRLRMLAGQPAYLLACR*
Ga0116222_104993613300009521Peatlands SoilTLTTLAHPDVFARLVEDQRREQNSTKRMKNDDVTLMRLRMLAGQPAFLLACR*
Ga0116220_1040161113300009525Peatlands SoilARLVEDQRREQNSAKRMKNDDVTLMRLRMLAGQPAYLLACR*
Ga0116125_106202813300009628PeatlandRKEQDAAKRMKNDDVTLMRLRMLADQPSFVLACR*
Ga0116217_1030765913300009700Peatlands SoilTLAHPDVFARLVEDQRREQNSTKRMKNDDVTLMRLRMLAGQPAFLLACR*
Ga0074045_1097393013300010341Bog Forest SoilQRREQNSAKRMKNDDVTLMRLRMLASPPAFLLACR*
Ga0136449_10040968933300010379Peatlands SoilLATLAHPDVFARLIEDQRREQNSAKRMKNDDVTLMRLRMLASQPAFLLACR*
Ga0136449_10270299623300010379Peatlands SoilVFARLVEDQRREQNSAKRMKNDDVTLMRLRMLAGQPAYLLACR*
Ga0136449_10270317413300010379Peatlands SoilTTLAHPDVFARLVEDQRREQNSAKRMKNDDVTLMRLRMLASQPAFLLACR*
Ga0150983_1297294823300011120Forest SoilSDQRKEIDIAKRLKNDDVTLMRLRIAADQPSFLLACR*
Ga0137388_1203391213300012189Vadose Zone SoilPDVFARLVEDQRREQNSAKRMKNDDVTLMRLRMLTGQPAFLLACR*
Ga0137362_1081498613300012205Vadose Zone SoilQRREQNSAKRMKNDDVTLMRLRMLAGQPAFLLACR*
Ga0137377_1089958123300012211Vadose Zone SoilVADQRREQDSAKRMKNDDVTLMRLRMLAGQPAYLLACR*
Ga0157329_104219923300012491Arabidopsis RhizosphereTLAHPDVFARLIEDQRREQDSAKRMKNDDVTLMRLRMLAGQPAYLLACR*
Ga0157313_103712123300012503Arabidopsis RhizosphereAHPDVFARLIEDQRREQDSAKRMKNDDVTLMRLRMLAGQPAYLLACR*
Ga0157338_107783723300012515Arabidopsis RhizosphereVGDQRREQDSAKRMKNDDVTLMRLRMLAGQPAFLLACR*
Ga0157352_102916713300012519Unplanted SoilFARLIEDQRREQDSAKRMKNDDVTLMRLRMLAGQPAYLLACR*
Ga0137395_1037446913300012917Vadose Zone SoilARLVEDQRREQNSAKRMKNDDVTLMRLRMLAGQPAFLLACR*
Ga0137404_1052325923300012929Vadose Zone SoilDTLTTLAHPDVFARLIGDQRREQDSAKRMKNDDVTLMRLRMLAGQPAYLLACR*
Ga0164309_1010901323300012984SoilFARLIEDQRREQDSAKRMKNDDVTLMRLRMLAGQPAYLLACG*
Ga0164308_1007704933300012985SoilARLIEDQRREQDSAKRMKNDDVTLMRLRMLAGQPAYLLVCR*
Ga0182024_1242485823300014501PermafrostARFVEDQRREQDGASRMKNDDVTLMRLRMLADQPSFLLACR*
Ga0137403_1130446913300015264Vadose Zone SoilLTTLAHPDVFAQLVADQRREQDGAKRLKNDDVTLMRLRMLDSQPAYLLACR*
Ga0182039_1119843213300016422SoilKVWATLTTLAHPDVFARLVEDQRREQNSVKRMKNDDVTLMRLRLLAGQPAFLLACR
Ga0187883_1024317413300018037PeatlandRLVEDQRREQNSAKRMKNDDVTLMRLRMLASQPAFLLACR
Ga0187862_1087799213300018040PeatlandVFARLVSDQRKEQDGAKRMKNDDVTLMRLRMLAGQPSFVLACR
Ga0187784_1120490813300018062Tropical PeatlandTTLAHPDVFARLVEDQRREQDSAKRMKNDDVTLMRLRLLAGQPAFLLACR
Ga0173479_1079279813300019362SoilIEDQRREQDSAKRMKNDDVTLMRLRMLAGQPAYLLACR
Ga0210405_1035183523300021171SoilLAHPDVFARLVGDQRREQDSAKRMKNDDVTLMRLRMLAGQPAYLLACR
Ga0210387_1055626913300021405SoilLTTLAHPDVFARLVGDQRREQDSAKRMKNDDVTLMRLRMLAGQPAYLLTCR
Ga0210384_1031977323300021432SoilLTTLAHPDVFARLVEDQRREQNSAKRMKNDDVTLMRLRMLADQPAYLLACR
Ga0210398_1003664813300021477SoilDVFARLVEDQRREQNSAKRMKNDDVTLMRLRMLAGQPAFLLACR
Ga0210402_1163241513300021478SoilYQRREQDSAKRMKNDDVTLMRLRMLAGQPAYLLACR
Ga0210410_1025873123300021479SoilLVGDQRREQDSAKRMKNDDVTLMRLRMLAGQPAYLLACR
Ga0247691_104208623300024222SoilHPDVFARLVADQRREQDSAKRMKNDDVTLMRLRMLAGQPAYLLACR
Ga0207642_1016823223300025899Miscanthus RhizosphereARLIEDQRREQDSAKRMKNDDVTLMRLRMLAGQPAYLLACR
Ga0207684_1009990113300025910Corn, Switchgrass And Miscanthus RhizosphereDQRREQDSAKRMKNDDVTLMRLRMLAGQPAFLLACR
Ga0207695_1130002523300025913Corn RhizosphereAHPDVFARLIEDQRREQDSAKRMKNDDVTLMRLRMLAGQPAYLLACR
Ga0207663_1112411413300025916Corn, Switchgrass And Miscanthus RhizosphereVFAQLVADQRREQDGSRRLKNDDVTLMRLRMLDGQPAYLLACR
Ga0207700_1036299023300025928Corn, Switchgrass And Miscanthus RhizosphereLAHPDVFARLVADQRKEQDGSRRLKNDDVTLMRLRMLDSQPAYLLACR
Ga0207664_1109799813300025929Agricultural SoilLTTLAHPDVFARLIEDQRREQDSAKRMKNDDVTLMRLRMLAGQPAYLLACR
Ga0207664_1142683913300025929Agricultural SoilVFARLVEDQRREQDSAKRMKNDDVTLMRLRMLAGQPAYLLACR
Ga0207704_1012932223300025938Miscanthus RhizosphereLIEDQRREQDSAKRMKNDDVTLMRLRMLAGQPAYLLACR
Ga0207679_1194175623300025945Corn RhizosphereLATLAHPDVFAQLVADQRREQDGAKRLKNDDVTLMRLRMLDSQPAYLLACR
Ga0207708_1059101323300026075Corn, Switchgrass And Miscanthus RhizosphereLTTLAHPDVFARLVADQRREQDGSRRLKNDDVTLMRLRMLDGQPAYLLACR
Ga0209438_106993813300026285Grasslands SoilARVWDTLTTLAHPDVFARLVEDQRREQDSGKRMKNDDVTLMRLRMLAGQPAYLLACR
Ga0179587_1023560013300026557Vadose Zone SoilTRLVEDQRREQDSGKRMKNDDVTLMRLRMLAGQPAYLLACR
Ga0208986_103238213300027031Forest SoilHPDVFARLIEDQRREQDSAKRMKNDDVTLMRLRMLVGQPAYLLACR
Ga0208729_10223123300027166Forest SoilPDVFARLVEDQRNEQDGAKRMKNDDVTLMRLRVLADQPSFVLACR
Ga0209530_108661423300027692Forest SoilMLGGLAHPDVFARFVEDQRREQDGAKRMKNDDVTLMRLRMLADQPAFLLACR
Ga0209275_1002817433300027884SoilTTLAGLAHPDVFSRFVADQRKEIDAAKRLKNDDVTLMRMRITAHQPSFLLACR
Ga0209275_1089297913300027884SoilFARFVEDQRREQDSAKRMKNDDVTLMRLRMLAGQPAFLLACR
Ga0209069_1045099923300027915WatershedsDQRREQDSAKRMKNDDVTLMRLRMLAGQPAYLLACR
Ga0302220_1038708913300028742PalsaTGLVHPDVFARLVEDQRKEQDDAKRMKNDDVTLMRLRMLADQPSYLLACR
Ga0302231_1048699623300028775PalsaARLVEDQRKEQDAAKRMKNDDVTLMRLRMLADQPSFVLACR
Ga0302232_1013314923300028789PalsaDQRKEQDAAKRMKNDDVTLMRLRMLADQPSFVLACR
Ga0302229_1005938813300028879PalsaPDVFGRLVEDQRKEQDDAKRMKNDDVTLMRLRVLADQPSFVLTCR
Ga0311340_1044664713300029943PalsaGLVHPDVFARLVSDQRKEQDAAKRMKNDDVTLMRLRMLADQPSFVLACR
Ga0311340_1061586323300029943PalsaDQRKEQDDAKRMKNDDVTLMRLRMLADQPSFVLACR
Ga0302178_1000559193300030013PalsaLTGLVHPDVFARLVEDQRKEQDDAKRMKNDDVTLMRLRMLADQPSYLLACR
Ga0302178_1039792223300030013PalsaGLVHPDVFGRLVEDQRKEQDDAKRMKNDDVTLMRLRVLADQPSFVLACR
Ga0310037_1007651823300030494Peatlands SoilTTLAHPDVFARLVEDQRREQNSAKRMKNDDVTLMRLRMLASQPAFLLACR
Ga0311357_1012033013300030524PalsaDQRKEQDGAKRMKNDDVTLMRLRMLADQPSFLLACR
Ga0302325_1016141513300031234PalsaARLVSDQRKEQDDAKRMKNDDVTLMRLRMLADQPSFVLACR
Ga0302324_10027991213300031236PalsaPDVFARLVSDQRKEQDAAKRMKNDDVTLMRLRMLADQPSFVLACR
Ga0302326_1129946023300031525PalsaLVEDQRREQDSAKRMKNDDVTLMRLRMLADQPYFLLACR
Ga0318515_1018048823300031572SoilDQRREQDSAKRMKNDDVTLMRLRMLADQPSFLLACR
Ga0310686_10920838113300031708SoilTLAHPDVFARLVEDQRREQNSAKRMKNDDVTLMRLRMLAGQPAFLLACR
Ga0318567_1039028423300031821SoilLAHPDVFARLVEDQRREQNSVKRMKNDDVTLMRLRLLAGQPAFLLACR
Ga0318495_1026026923300031860SoilSTLTTLAHPDVFARLVGDQRREQDSAKRMKNDDVTLMRLRMLAGQPAFLLACR
Ga0306921_1188496313300031912SoilHPDVFARLVEDQRREQNSVKRMKNDDVTLMRLRLLAGQPAFLLACR
Ga0318524_1056892213300032067SoilADLAHPAVFARFVEDQRDEADGAKRMKNDDVTLMRLRMLAAQPSYVLACR
Ga0318524_1064933023300032067SoilARLVEDQRREQNSAKRMKNDDVTLMRLRLLAGQPAFLLACR
Ga0311301_1156045923300032160Peatlands SoilPEVFARLIEDQRREQNSAKRMKNDDVTLMRLRMLAGQPAYLLACR
Ga0307471_10312331123300032180Hardwood Forest SoilDTLTTLAHPDVFARLIEDQRREQDSAKRMKNDDVTLMRLRMLAGQPAYLLACR
Ga0335085_1013088833300032770SoilQRREQDSATRMKNDDVTLMRLRMLAGQPAFLLACR
Ga0335085_1201610413300032770SoilDQRREQNSAKRMKNDDVTLMRLRLLAGQPAFLLACR
Ga0335074_1037849623300032895SoilTMAGLAHPEVFARFVADQRKEIDAAKRLKNDDVTLLRLRITADQPSFLLACR
Ga0335077_1029803313300033158SoilGLAHPDVFARFVADQRKEIDAAKRLKNDDVTLMRLRITADQPSFLLACR
Ga0373958_0113329_480_6383300034819Rhizosphere SoilMLTTLAHPDVFARLIEDQRREQDSAKRMKNDDVTLMRLRMLAGQPAYLLACR


 ⦗Top⦘


© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.