| Basic Information | |
|---|---|
| Family ID | F101376 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 102 |
| Average Sequence Length | 45 residues |
| Representative Sequence | HPDVFARLVEDQRREQDSAKRMKNDDVTLMRLRMLAGQPAYLLACR |
| Number of Associated Samples | 93 |
| Number of Associated Scaffolds | 102 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 0.00 % |
| % of genes near scaffold ends (potentially truncated) | 99.02 % |
| % of genes from short scaffolds (< 2000 bps) | 89.22 % |
| Associated GOLD sequencing projects | 90 |
| AlphaFold2 3D model prediction | No |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (69.608 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa (11.765 % of family members) |
| Environment Ontology (ENVO) | Unclassified (23.529 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (51.961 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 76.09% β-sheet: 0.00% Coil/Unstructured: 23.91% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 102 Family Scaffolds |
|---|---|---|
| PF01636 | APH | 7.84 |
| PF00069 | Pkinase | 7.84 |
| PF08241 | Methyltransf_11 | 0.98 |
| PF05448 | AXE1 | 0.98 |
| PF01979 | Amidohydro_1 | 0.98 |
| PF01633 | Choline_kinase | 0.98 |
| PF01035 | DNA_binding_1 | 0.98 |
| PF12323 | HTH_OrfB_IS605 | 0.98 |
| COG ID | Name | Functional Category | % Frequency in 102 Family Scaffolds |
|---|---|---|---|
| COG0515 | Serine/threonine protein kinase | Signal transduction mechanisms [T] | 31.37 |
| COG0350 | DNA repair enzyme Ada (O6-methylguanine-DNA--protein-cysteine methyltransferase) | Replication, recombination and repair [L] | 0.98 |
| COG1506 | Dipeptidyl aminopeptidase/acylaminoacyl peptidase | Amino acid transport and metabolism [E] | 0.98 |
| COG3458 | Cephalosporin-C deacetylase or related acetyl esterase | Secondary metabolites biosynthesis, transport and catabolism [Q] | 0.98 |
| COG3695 | Alkylated DNA nucleotide flippase Atl1, participates in nucleotide excision repair, Ada-like DNA-binding domain | Transcription [K] | 0.98 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 69.61 % |
| Unclassified | root | N/A | 30.39 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 2189573002|GZIGXIF01BOZ9Z | Not Available | 509 | Open in IMG/M |
| 3300000955|JGI1027J12803_100898862 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Frankiales → Frankiaceae → Frankia | 725 | Open in IMG/M |
| 3300001867|JGI12627J18819_10148185 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Frankiales → Frankiaceae → Frankia | 956 | Open in IMG/M |
| 3300002245|JGIcombinedJ26739_101012436 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Frankiales → Frankiaceae → Frankia | 716 | Open in IMG/M |
| 3300003505|JGIcombinedJ51221_10263263 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Frankiales → Frankiaceae → Frankia → unclassified Frankia → Frankia sp. EAN1pec | 701 | Open in IMG/M |
| 3300004082|Ga0062384_100682207 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 705 | Open in IMG/M |
| 3300005147|Ga0066821_1004450 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 848 | Open in IMG/M |
| 3300005164|Ga0066815_10074905 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Frankiales → Frankiaceae → Frankia | 600 | Open in IMG/M |
| 3300005338|Ga0068868_101144346 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Frankiales → Frankiaceae → Frankia | 717 | Open in IMG/M |
| 3300005458|Ga0070681_10363947 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Frankiales → Frankiaceae → Frankia → unclassified Frankia → Frankia sp. EUN1f | 1356 | Open in IMG/M |
| 3300005458|Ga0070681_11028699 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 744 | Open in IMG/M |
| 3300005518|Ga0070699_100867251 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 826 | Open in IMG/M |
| 3300005529|Ga0070741_10085864 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 3425 | Open in IMG/M |
| 3300005575|Ga0066702_10316793 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 951 | Open in IMG/M |
| 3300005587|Ga0066654_10366119 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Frankiales → Frankiaceae → Frankia | 784 | Open in IMG/M |
| 3300006031|Ga0066651_10665330 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Frankiales → Frankiaceae → Frankia | 557 | Open in IMG/M |
| 3300006237|Ga0097621_101630191 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 614 | Open in IMG/M |
| 3300006573|Ga0074055_11764947 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 521 | Open in IMG/M |
| 3300006580|Ga0074049_10005958 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Frankiales → Frankiaceae → Frankia | 589 | Open in IMG/M |
| 3300006791|Ga0066653_10399040 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Frankiales → Frankiaceae → Frankia | 703 | Open in IMG/M |
| 3300006854|Ga0075425_102237731 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Frankiales → Frankiaceae → Frankia → unclassified Frankia → Frankia sp. EUN1f | 608 | Open in IMG/M |
| 3300009137|Ga0066709_104327125 | Not Available | 518 | Open in IMG/M |
| 3300009520|Ga0116214_1362360 | Not Available | 562 | Open in IMG/M |
| 3300009521|Ga0116222_1049936 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1824 | Open in IMG/M |
| 3300009525|Ga0116220_10401611 | Not Available | 613 | Open in IMG/M |
| 3300009628|Ga0116125_1062028 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 964 | Open in IMG/M |
| 3300009700|Ga0116217_10307659 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1018 | Open in IMG/M |
| 3300010341|Ga0074045_10973930 | Not Available | 534 | Open in IMG/M |
| 3300010379|Ga0136449_100409689 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 2400 | Open in IMG/M |
| 3300010379|Ga0136449_102702996 | Not Available | 704 | Open in IMG/M |
| 3300010379|Ga0136449_102703174 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 704 | Open in IMG/M |
| 3300011120|Ga0150983_12972948 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 996 | Open in IMG/M |
| 3300012189|Ga0137388_12033912 | Not Available | 502 | Open in IMG/M |
| 3300012205|Ga0137362_10814986 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 799 | Open in IMG/M |
| 3300012211|Ga0137377_10899581 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 817 | Open in IMG/M |
| 3300012491|Ga0157329_1042199 | Not Available | 515 | Open in IMG/M |
| 3300012503|Ga0157313_1037121 | Not Available | 582 | Open in IMG/M |
| 3300012515|Ga0157338_1077837 | Not Available | 531 | Open in IMG/M |
| 3300012519|Ga0157352_1029167 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 721 | Open in IMG/M |
| 3300012917|Ga0137395_10374469 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1017 | Open in IMG/M |
| 3300012929|Ga0137404_10523259 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1060 | Open in IMG/M |
| 3300012984|Ga0164309_10109013 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1765 | Open in IMG/M |
| 3300012985|Ga0164308_10077049 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 2264 | Open in IMG/M |
| 3300014501|Ga0182024_12424858 | Not Available | 568 | Open in IMG/M |
| 3300015264|Ga0137403_11304469 | Not Available | 572 | Open in IMG/M |
| 3300016422|Ga0182039_11198432 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 686 | Open in IMG/M |
| 3300018037|Ga0187883_10243174 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 921 | Open in IMG/M |
| 3300018040|Ga0187862_10877992 | Not Available | 514 | Open in IMG/M |
| 3300018062|Ga0187784_11204908 | Not Available | 601 | Open in IMG/M |
| 3300019362|Ga0173479_10792798 | Not Available | 523 | Open in IMG/M |
| 3300021171|Ga0210405_10351835 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1162 | Open in IMG/M |
| 3300021405|Ga0210387_10556269 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1020 | Open in IMG/M |
| 3300021432|Ga0210384_10319773 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1397 | Open in IMG/M |
| 3300021477|Ga0210398_10036648 | All Organisms → cellular organisms → Bacteria | 4080 | Open in IMG/M |
| 3300021478|Ga0210402_11632415 | Not Available | 571 | Open in IMG/M |
| 3300021479|Ga0210410_10258731 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1561 | Open in IMG/M |
| 3300024222|Ga0247691_1042086 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 693 | Open in IMG/M |
| 3300025899|Ga0207642_10168232 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1183 | Open in IMG/M |
| 3300025910|Ga0207684_10099901 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 2479 | Open in IMG/M |
| 3300025913|Ga0207695_11300025 | Not Available | 608 | Open in IMG/M |
| 3300025916|Ga0207663_11124114 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 632 | Open in IMG/M |
| 3300025928|Ga0207700_10362990 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1263 | Open in IMG/M |
| 3300025929|Ga0207664_11097998 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 711 | Open in IMG/M |
| 3300025929|Ga0207664_11426839 | Not Available | 613 | Open in IMG/M |
| 3300025938|Ga0207704_10129322 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1745 | Open in IMG/M |
| 3300025945|Ga0207679_11941756 | Not Available | 536 | Open in IMG/M |
| 3300026075|Ga0207708_10591013 | Not Available | 939 | Open in IMG/M |
| 3300026285|Ga0209438_1069938 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1146 | Open in IMG/M |
| 3300026557|Ga0179587_10235600 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1168 | Open in IMG/M |
| 3300027031|Ga0208986_1032382 | Not Available | 562 | Open in IMG/M |
| 3300027166|Ga0208729_102231 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 995 | Open in IMG/M |
| 3300027692|Ga0209530_1086614 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 896 | Open in IMG/M |
| 3300027884|Ga0209275_10028174 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 2573 | Open in IMG/M |
| 3300027884|Ga0209275_10892979 | Not Available | 512 | Open in IMG/M |
| 3300027915|Ga0209069_10450999 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 715 | Open in IMG/M |
| 3300028742|Ga0302220_10387089 | Not Available | 503 | Open in IMG/M |
| 3300028775|Ga0302231_10486996 | Not Available | 521 | Open in IMG/M |
| 3300028789|Ga0302232_10133149 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1259 | Open in IMG/M |
| 3300028879|Ga0302229_10059388 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1879 | Open in IMG/M |
| 3300029943|Ga0311340_10446647 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1172 | Open in IMG/M |
| 3300029943|Ga0311340_10615863 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 946 | Open in IMG/M |
| 3300030013|Ga0302178_10005591 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales | 8881 | Open in IMG/M |
| 3300030013|Ga0302178_10397922 | Not Available | 615 | Open in IMG/M |
| 3300030494|Ga0310037_10076518 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1569 | Open in IMG/M |
| 3300030524|Ga0311357_10120330 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 2617 | Open in IMG/M |
| 3300031234|Ga0302325_10161415 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 3974 | Open in IMG/M |
| 3300031236|Ga0302324_100279912 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Frankiales → Frankiaceae → Frankia | 2576 | Open in IMG/M |
| 3300031525|Ga0302326_11299460 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 991 | Open in IMG/M |
| 3300031572|Ga0318515_10180488 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1129 | Open in IMG/M |
| 3300031708|Ga0310686_109208381 | Not Available | 542 | Open in IMG/M |
| 3300031821|Ga0318567_10390284 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 788 | Open in IMG/M |
| 3300031860|Ga0318495_10260269 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 775 | Open in IMG/M |
| 3300031912|Ga0306921_11884963 | Not Available | 640 | Open in IMG/M |
| 3300032067|Ga0318524_10568922 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 596 | Open in IMG/M |
| 3300032067|Ga0318524_10649330 | Not Available | 556 | Open in IMG/M |
| 3300032160|Ga0311301_11560459 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 807 | Open in IMG/M |
| 3300032180|Ga0307471_103123311 | Not Available | 587 | Open in IMG/M |
| 3300032770|Ga0335085_10130888 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 3183 | Open in IMG/M |
| 3300032770|Ga0335085_12016104 | Not Available | 585 | Open in IMG/M |
| 3300032895|Ga0335074_10378496 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1552 | Open in IMG/M |
| 3300033158|Ga0335077_10298033 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1766 | Open in IMG/M |
| 3300034819|Ga0373958_0113329 | Not Available | 648 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 11.76% |
| Palsa | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa | 11.76% |
| Peatlands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil | 8.82% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 6.86% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 6.86% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 4.90% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 4.90% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 3.92% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 3.92% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 3.92% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 2.94% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Rhizosphere | 2.94% |
| Peatland | Environmental → Aquatic → Freshwater → Wetlands → Bog → Peatland | 1.96% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 1.96% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 1.96% |
| Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil | 1.96% |
| Corn Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere | 1.96% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Agricultural Soil | 1.96% |
| Bog Forest Soil | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil | 0.98% |
| Peatland | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Peatland | 0.98% |
| Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 0.98% |
| Grass Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grass Soil | 0.98% |
| Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 0.98% |
| Unplanted Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Unplanted Soil | 0.98% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 0.98% |
| Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 0.98% |
| Bog Forest Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Bog Forest Soil | 0.98% |
| Permafrost | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Permafrost | 0.98% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Roots → Rhizosphere → Soil → Miscanthus Rhizosphere | 0.98% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 0.98% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 0.98% |
| Rhizosphere Soil | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Rhizosphere Soil | 0.98% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere | 0.98% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 2189573002 | Grass soil microbial communities from Rothamsted Park, UK - FE1 (NaCl 30g/L 5ml) | Environmental | Open in IMG/M |
| 3300000955 | Soil microbial communities from Great Prairies - Iowa, Native Prairie soil | Environmental | Open in IMG/M |
| 3300001867 | Texas A ecozone_OM1H0_M2 (Combined assembly for Texas A ecozone Site metagenome samples, ASSEMBLY_DATE=20130705) | Environmental | Open in IMG/M |
| 3300002245 | Jack Pine, Ontario site 1_JW_OM2H0_M3 (Jack Pine, Ontario combined, ASSEMBLY_DATE=20131027) | Environmental | Open in IMG/M |
| 3300003505 | Forest soil microbial communities from Harvard Forest LTER, USA - Combined assembly of forest soil metaG samples (ASSEMBLY_DATE=20140924) | Environmental | Open in IMG/M |
| 3300004082 | Coassembly of ECP03_0M1, ECP03_OM2, ECP03_OM3 | Environmental | Open in IMG/M |
| 3300005147 | Soil and rhizosphere microbial communities from Laval, Canada - mgLMC | Environmental | Open in IMG/M |
| 3300005164 | Soil and rhizosphere microbial communities from Laval, Canada - mgLAC | Environmental | Open in IMG/M |
| 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Host-Associated | Open in IMG/M |
| 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Environmental | Open in IMG/M |
| 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Environmental | Open in IMG/M |
| 3300005529 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen16_06102014_R1 | Environmental | Open in IMG/M |
| 3300005575 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_151 | Environmental | Open in IMG/M |
| 3300005587 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_103 | Environmental | Open in IMG/M |
| 3300006031 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Angelo_100 | Environmental | Open in IMG/M |
| 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) | Host-Associated | Open in IMG/M |
| 3300006573 | Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtLAC (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300006580 | Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtLPC (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300006791 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_102 | Environmental | Open in IMG/M |
| 3300006854 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD4 | Host-Associated | Open in IMG/M |
| 3300009137 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_158 | Environmental | Open in IMG/M |
| 3300009520 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_1_NS metaG | Environmental | Open in IMG/M |
| 3300009521 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_9_AC metaG | Environmental | Open in IMG/M |
| 3300009525 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_7_NC metaG | Environmental | Open in IMG/M |
| 3300009628 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_16_10 | Environmental | Open in IMG/M |
| 3300009700 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_4_PS metaG | Environmental | Open in IMG/M |
| 3300010341 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - Bog Forest MetaG ECP23OM2 | Environmental | Open in IMG/M |
| 3300010379 | Sb_50d combined assembly | Environmental | Open in IMG/M |
| 3300011120 | Combined assembly of Microbial Forest Soil metaT | Environmental | Open in IMG/M |
| 3300012189 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4A metaG | Environmental | Open in IMG/M |
| 3300012205 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_100_16 metaG | Environmental | Open in IMG/M |
| 3300012211 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_40_16 metaG | Environmental | Open in IMG/M |
| 3300012491 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.8.old.040610 | Host-Associated | Open in IMG/M |
| 3300012503 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.5.old.080610_R | Host-Associated | Open in IMG/M |
| 3300012515 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.7.yng.070610 | Host-Associated | Open in IMG/M |
| 3300012519 | Unplanted soil (control) microbial communities from North Carolina - M.Soil.7.yng.070610 | Environmental | Open in IMG/M |
| 3300012917 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czobulk2.16 metaG | Environmental | Open in IMG/M |
| 3300012929 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012984 | Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_247_MG | Environmental | Open in IMG/M |
| 3300012985 | Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_246_MG | Environmental | Open in IMG/M |
| 3300014501 | Permafrost microbial communities from Stordalen Mire, Sweden - P3-2 metaG (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300015264 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300016422 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111 | Environmental | Open in IMG/M |
| 3300018037 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_20_10 | Environmental | Open in IMG/M |
| 3300018040 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_10_150 | Environmental | Open in IMG/M |
| 3300018062 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_SJ02_MP15_20_MG | Environmental | Open in IMG/M |
| 3300019362 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S104-311B-1 (version 2) | Environmental | Open in IMG/M |
| 3300021171 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-11-M | Environmental | Open in IMG/M |
| 3300021405 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-O | Environmental | Open in IMG/M |
| 3300021432 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-M | Environmental | Open in IMG/M |
| 3300021477 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-4-O | Environmental | Open in IMG/M |
| 3300021478 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-M | Environmental | Open in IMG/M |
| 3300021479 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-4-M | Environmental | Open in IMG/M |
| 3300024222 | Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK32 | Environmental | Open in IMG/M |
| 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300026285 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_20cm (SPAdes) | Environmental | Open in IMG/M |
| 3300026557 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_08_16fungal | Environmental | Open in IMG/M |
| 3300027031 | Forest soil microbial communities from El Dorado National Forest, California, USA - Mediterranean Blodgett CA OM1_O2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027166 | Forest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaG HF033 (SPAdes) | Environmental | Open in IMG/M |
| 3300027692 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_Ref_O1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027884 | Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027915 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Straight Creek_MetaG_SC_2013 (SPAdes) | Environmental | Open in IMG/M |
| 3300028742 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_E1_3 | Environmental | Open in IMG/M |
| 3300028775 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_N2_2 | Environmental | Open in IMG/M |
| 3300028789 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_N2_3 | Environmental | Open in IMG/M |
| 3300028879 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_N1_3 | Environmental | Open in IMG/M |
| 3300029943 | I_Palsa_N3 coassembly | Environmental | Open in IMG/M |
| 3300030013 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Palsa_E1_3 | Environmental | Open in IMG/M |
| 3300030494 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_3_AS metaG (v2) | Environmental | Open in IMG/M |
| 3300030524 | II_Palsa_N3 coassembly | Environmental | Open in IMG/M |
| 3300031234 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Palsa_T0_2 | Environmental | Open in IMG/M |
| 3300031236 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Palsa_T0_1 | Environmental | Open in IMG/M |
| 3300031525 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Palsa_T0_3 | Environmental | Open in IMG/M |
| 3300031572 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f19 | Environmental | Open in IMG/M |
| 3300031708 | FICUS49499 Metagenome Czech Republic combined assembly | Environmental | Open in IMG/M |
| 3300031821 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f20 | Environmental | Open in IMG/M |
| 3300031860 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.108b1f25 | Environmental | Open in IMG/M |
| 3300031912 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080 (v2) | Environmental | Open in IMG/M |
| 3300032067 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f22 | Environmental | Open in IMG/M |
| 3300032160 | Sb_50d combined assembly (MetaSPAdes) | Environmental | Open in IMG/M |
| 3300032180 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515 | Environmental | Open in IMG/M |
| 3300032770 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.5 | Environmental | Open in IMG/M |
| 3300032895 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.3 | Environmental | Open in IMG/M |
| 3300033158 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.1 | Environmental | Open in IMG/M |
| 3300034819 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 | Host-Associated | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| FE1_04614600 | 2189573002 | Grass Soil | EDQRREQDSAKRMKNDDVTLMRLRMLAGYPAYLLACR |
| JGI1027J12803_1008988621 | 3300000955 | Soil | DQRREQDSSKRMKNDDVTLMRLRMLAGQPAYLLACR* |
| JGI12627J18819_101481852 | 3300001867 | Forest Soil | TTLAHPDVFARLIADQRREQDSAKRMKNDDVTLMRLRMLAGQPAYLLACR* |
| JGIcombinedJ26739_1010124362 | 3300002245 | Forest Soil | SDHRKEQDDAKRMKNDDVTLMRLRLLADQPSFVLACR* |
| JGIcombinedJ51221_102632631 | 3300003505 | Forest Soil | AGLVHPDVFARLVSDQRKEQDAAKRMKNDDVTLMRLRMLADQPSFVLACR* |
| Ga0062384_1006822072 | 3300004082 | Bog Forest Soil | VLGGLAHPAIFSRFVDDQRREIDSAKRMKNDDITLMRLRVLADPPWQAQHNV* |
| Ga0066821_10044502 | 3300005147 | Soil | LVQDQRREQNSAKRMKNDDVTLMRLRMLAGQPAFLLAAR* |
| Ga0066815_100749052 | 3300005164 | Soil | AHPDVFARLIEDQRREQDSAKRMKNDDVTLMRLRILAGQPAYLLACR* |
| Ga0068868_1011443462 | 3300005338 | Miscanthus Rhizosphere | LTTLAHPDVFARLIEDQRREQDSAKRMKNDDVTLMRLRMLAGQPAYLLACR* |
| Ga0070681_103639472 | 3300005458 | Corn Rhizosphere | VFARLIEDQRREQDSAKRMKNDDVTLMRLRMLAGQPAYLLACR* |
| Ga0070681_110286991 | 3300005458 | Corn Rhizosphere | GEAKVWDTLTTLAHPDVFAQLVADQRREQDGSRRLKNDDVTLMRLRMLDGQPAYLLACR* |
| Ga0070699_1008672511 | 3300005518 | Corn, Switchgrass And Miscanthus Rhizosphere | LAHPDVFARLVGDQRREQDGVKRMKNDDVTLMRLRMLAGQPAFLLACR* |
| Ga0070741_100858641 | 3300005529 | Surface Soil | LTTLAHPDVFARLVADQRREQDSAKRLKNDDVTLMRLRMLDSQPAYLLACR* |
| Ga0066702_103167931 | 3300005575 | Soil | HPDVFARLVEDQRREQDSAKRMKNDDVTLMRLRMLAGQPAYLLACR* |
| Ga0066654_103661192 | 3300005587 | Soil | KVWDTLTTLAHPDVFAQLIADQRKEQDGSRRLKNDDVTLMRLRMLASQPAYLLACR* |
| Ga0066651_106653302 | 3300006031 | Soil | FAQLIADQRKEQDGSRRLKNDDVTLMRLRMLDSQPAYLLACR* |
| Ga0097621_1016301912 | 3300006237 | Miscanthus Rhizosphere | RREQDGSRRLKNDDVTLMRLRMLDSQPAYLLACR* |
| Ga0074055_117649472 | 3300006573 | Soil | VWDALTTLAHPDVFARLVQDQRREQNSAKRMKNDDVTLMRLRMLAGQPAFLLAAR* |
| Ga0074049_100059581 | 3300006580 | Soil | EDQRREQDSAKRMKNDDVTLMRLRMLVGQPAYLLACR* |
| Ga0066653_103990402 | 3300006791 | Soil | RLIEDHRREQDSASRMKNDDVTLMRLRMLAGQPAYLLVCR* |
| Ga0075425_1022377311 | 3300006854 | Populus Rhizosphere | QRREQDSAKRMKNDDVTLMRLRMLAGQPAYLLACR* |
| Ga0066709_1043271251 | 3300009137 | Grasslands Soil | AKVWDTLTTLAHPDVFAQLIADQRKEQDGSRRLKNDDVTLMRLRMLDSQPAYLLACR* |
| Ga0116214_13623602 | 3300009520 | Peatlands Soil | ARLIEDQRREQNSAKRMKNDDVTLMRLRMLAGQPAYLLACR* |
| Ga0116222_10499361 | 3300009521 | Peatlands Soil | TLTTLAHPDVFARLVEDQRREQNSTKRMKNDDVTLMRLRMLAGQPAFLLACR* |
| Ga0116220_104016111 | 3300009525 | Peatlands Soil | ARLVEDQRREQNSAKRMKNDDVTLMRLRMLAGQPAYLLACR* |
| Ga0116125_10620281 | 3300009628 | Peatland | RKEQDAAKRMKNDDVTLMRLRMLADQPSFVLACR* |
| Ga0116217_103076591 | 3300009700 | Peatlands Soil | TLAHPDVFARLVEDQRREQNSTKRMKNDDVTLMRLRMLAGQPAFLLACR* |
| Ga0074045_109739301 | 3300010341 | Bog Forest Soil | QRREQNSAKRMKNDDVTLMRLRMLASPPAFLLACR* |
| Ga0136449_1004096893 | 3300010379 | Peatlands Soil | LATLAHPDVFARLIEDQRREQNSAKRMKNDDVTLMRLRMLASQPAFLLACR* |
| Ga0136449_1027029962 | 3300010379 | Peatlands Soil | VFARLVEDQRREQNSAKRMKNDDVTLMRLRMLAGQPAYLLACR* |
| Ga0136449_1027031741 | 3300010379 | Peatlands Soil | TTLAHPDVFARLVEDQRREQNSAKRMKNDDVTLMRLRMLASQPAFLLACR* |
| Ga0150983_129729482 | 3300011120 | Forest Soil | SDQRKEIDIAKRLKNDDVTLMRLRIAADQPSFLLACR* |
| Ga0137388_120339121 | 3300012189 | Vadose Zone Soil | PDVFARLVEDQRREQNSAKRMKNDDVTLMRLRMLTGQPAFLLACR* |
| Ga0137362_108149861 | 3300012205 | Vadose Zone Soil | QRREQNSAKRMKNDDVTLMRLRMLAGQPAFLLACR* |
| Ga0137377_108995812 | 3300012211 | Vadose Zone Soil | VADQRREQDSAKRMKNDDVTLMRLRMLAGQPAYLLACR* |
| Ga0157329_10421992 | 3300012491 | Arabidopsis Rhizosphere | TLAHPDVFARLIEDQRREQDSAKRMKNDDVTLMRLRMLAGQPAYLLACR* |
| Ga0157313_10371212 | 3300012503 | Arabidopsis Rhizosphere | AHPDVFARLIEDQRREQDSAKRMKNDDVTLMRLRMLAGQPAYLLACR* |
| Ga0157338_10778372 | 3300012515 | Arabidopsis Rhizosphere | VGDQRREQDSAKRMKNDDVTLMRLRMLAGQPAFLLACR* |
| Ga0157352_10291671 | 3300012519 | Unplanted Soil | FARLIEDQRREQDSAKRMKNDDVTLMRLRMLAGQPAYLLACR* |
| Ga0137395_103744691 | 3300012917 | Vadose Zone Soil | ARLVEDQRREQNSAKRMKNDDVTLMRLRMLAGQPAFLLACR* |
| Ga0137404_105232592 | 3300012929 | Vadose Zone Soil | DTLTTLAHPDVFARLIGDQRREQDSAKRMKNDDVTLMRLRMLAGQPAYLLACR* |
| Ga0164309_101090132 | 3300012984 | Soil | FARLIEDQRREQDSAKRMKNDDVTLMRLRMLAGQPAYLLACG* |
| Ga0164308_100770493 | 3300012985 | Soil | ARLIEDQRREQDSAKRMKNDDVTLMRLRMLAGQPAYLLVCR* |
| Ga0182024_124248582 | 3300014501 | Permafrost | ARFVEDQRREQDGASRMKNDDVTLMRLRMLADQPSFLLACR* |
| Ga0137403_113044691 | 3300015264 | Vadose Zone Soil | LTTLAHPDVFAQLVADQRREQDGAKRLKNDDVTLMRLRMLDSQPAYLLACR* |
| Ga0182039_111984321 | 3300016422 | Soil | KVWATLTTLAHPDVFARLVEDQRREQNSVKRMKNDDVTLMRLRLLAGQPAFLLACR |
| Ga0187883_102431741 | 3300018037 | Peatland | RLVEDQRREQNSAKRMKNDDVTLMRLRMLASQPAFLLACR |
| Ga0187862_108779921 | 3300018040 | Peatland | VFARLVSDQRKEQDGAKRMKNDDVTLMRLRMLAGQPSFVLACR |
| Ga0187784_112049081 | 3300018062 | Tropical Peatland | TTLAHPDVFARLVEDQRREQDSAKRMKNDDVTLMRLRLLAGQPAFLLACR |
| Ga0173479_107927981 | 3300019362 | Soil | IEDQRREQDSAKRMKNDDVTLMRLRMLAGQPAYLLACR |
| Ga0210405_103518352 | 3300021171 | Soil | LAHPDVFARLVGDQRREQDSAKRMKNDDVTLMRLRMLAGQPAYLLACR |
| Ga0210387_105562691 | 3300021405 | Soil | LTTLAHPDVFARLVGDQRREQDSAKRMKNDDVTLMRLRMLAGQPAYLLTCR |
| Ga0210384_103197732 | 3300021432 | Soil | LTTLAHPDVFARLVEDQRREQNSAKRMKNDDVTLMRLRMLADQPAYLLACR |
| Ga0210398_100366481 | 3300021477 | Soil | DVFARLVEDQRREQNSAKRMKNDDVTLMRLRMLAGQPAFLLACR |
| Ga0210402_116324151 | 3300021478 | Soil | YQRREQDSAKRMKNDDVTLMRLRMLAGQPAYLLACR |
| Ga0210410_102587312 | 3300021479 | Soil | LVGDQRREQDSAKRMKNDDVTLMRLRMLAGQPAYLLACR |
| Ga0247691_10420862 | 3300024222 | Soil | HPDVFARLVADQRREQDSAKRMKNDDVTLMRLRMLAGQPAYLLACR |
| Ga0207642_101682322 | 3300025899 | Miscanthus Rhizosphere | ARLIEDQRREQDSAKRMKNDDVTLMRLRMLAGQPAYLLACR |
| Ga0207684_100999011 | 3300025910 | Corn, Switchgrass And Miscanthus Rhizosphere | DQRREQDSAKRMKNDDVTLMRLRMLAGQPAFLLACR |
| Ga0207695_113000252 | 3300025913 | Corn Rhizosphere | AHPDVFARLIEDQRREQDSAKRMKNDDVTLMRLRMLAGQPAYLLACR |
| Ga0207663_111241141 | 3300025916 | Corn, Switchgrass And Miscanthus Rhizosphere | VFAQLVADQRREQDGSRRLKNDDVTLMRLRMLDGQPAYLLACR |
| Ga0207700_103629902 | 3300025928 | Corn, Switchgrass And Miscanthus Rhizosphere | LAHPDVFARLVADQRKEQDGSRRLKNDDVTLMRLRMLDSQPAYLLACR |
| Ga0207664_110979981 | 3300025929 | Agricultural Soil | LTTLAHPDVFARLIEDQRREQDSAKRMKNDDVTLMRLRMLAGQPAYLLACR |
| Ga0207664_114268391 | 3300025929 | Agricultural Soil | VFARLVEDQRREQDSAKRMKNDDVTLMRLRMLAGQPAYLLACR |
| Ga0207704_101293222 | 3300025938 | Miscanthus Rhizosphere | LIEDQRREQDSAKRMKNDDVTLMRLRMLAGQPAYLLACR |
| Ga0207679_119417562 | 3300025945 | Corn Rhizosphere | LATLAHPDVFAQLVADQRREQDGAKRLKNDDVTLMRLRMLDSQPAYLLACR |
| Ga0207708_105910132 | 3300026075 | Corn, Switchgrass And Miscanthus Rhizosphere | LTTLAHPDVFARLVADQRREQDGSRRLKNDDVTLMRLRMLDGQPAYLLACR |
| Ga0209438_10699381 | 3300026285 | Grasslands Soil | ARVWDTLTTLAHPDVFARLVEDQRREQDSGKRMKNDDVTLMRLRMLAGQPAYLLACR |
| Ga0179587_102356001 | 3300026557 | Vadose Zone Soil | TRLVEDQRREQDSGKRMKNDDVTLMRLRMLAGQPAYLLACR |
| Ga0208986_10323821 | 3300027031 | Forest Soil | HPDVFARLIEDQRREQDSAKRMKNDDVTLMRLRMLVGQPAYLLACR |
| Ga0208729_1022312 | 3300027166 | Forest Soil | PDVFARLVEDQRNEQDGAKRMKNDDVTLMRLRVLADQPSFVLACR |
| Ga0209530_10866142 | 3300027692 | Forest Soil | MLGGLAHPDVFARFVEDQRREQDGAKRMKNDDVTLMRLRMLADQPAFLLACR |
| Ga0209275_100281743 | 3300027884 | Soil | TTLAGLAHPDVFSRFVADQRKEIDAAKRLKNDDVTLMRMRITAHQPSFLLACR |
| Ga0209275_108929791 | 3300027884 | Soil | FARFVEDQRREQDSAKRMKNDDVTLMRLRMLAGQPAFLLACR |
| Ga0209069_104509992 | 3300027915 | Watersheds | DQRREQDSAKRMKNDDVTLMRLRMLAGQPAYLLACR |
| Ga0302220_103870891 | 3300028742 | Palsa | TGLVHPDVFARLVEDQRKEQDDAKRMKNDDVTLMRLRMLADQPSYLLACR |
| Ga0302231_104869962 | 3300028775 | Palsa | ARLVEDQRKEQDAAKRMKNDDVTLMRLRMLADQPSFVLACR |
| Ga0302232_101331492 | 3300028789 | Palsa | DQRKEQDAAKRMKNDDVTLMRLRMLADQPSFVLACR |
| Ga0302229_100593881 | 3300028879 | Palsa | PDVFGRLVEDQRKEQDDAKRMKNDDVTLMRLRVLADQPSFVLTCR |
| Ga0311340_104466471 | 3300029943 | Palsa | GLVHPDVFARLVSDQRKEQDAAKRMKNDDVTLMRLRMLADQPSFVLACR |
| Ga0311340_106158632 | 3300029943 | Palsa | DQRKEQDDAKRMKNDDVTLMRLRMLADQPSFVLACR |
| Ga0302178_100055919 | 3300030013 | Palsa | LTGLVHPDVFARLVEDQRKEQDDAKRMKNDDVTLMRLRMLADQPSYLLACR |
| Ga0302178_103979222 | 3300030013 | Palsa | GLVHPDVFGRLVEDQRKEQDDAKRMKNDDVTLMRLRVLADQPSFVLACR |
| Ga0310037_100765182 | 3300030494 | Peatlands Soil | TTLAHPDVFARLVEDQRREQNSAKRMKNDDVTLMRLRMLASQPAFLLACR |
| Ga0311357_101203301 | 3300030524 | Palsa | DQRKEQDGAKRMKNDDVTLMRLRMLADQPSFLLACR |
| Ga0302325_101614151 | 3300031234 | Palsa | ARLVSDQRKEQDDAKRMKNDDVTLMRLRMLADQPSFVLACR |
| Ga0302324_1002799121 | 3300031236 | Palsa | PDVFARLVSDQRKEQDAAKRMKNDDVTLMRLRMLADQPSFVLACR |
| Ga0302326_112994602 | 3300031525 | Palsa | LVEDQRREQDSAKRMKNDDVTLMRLRMLADQPYFLLACR |
| Ga0318515_101804882 | 3300031572 | Soil | DQRREQDSAKRMKNDDVTLMRLRMLADQPSFLLACR |
| Ga0310686_1092083811 | 3300031708 | Soil | TLAHPDVFARLVEDQRREQNSAKRMKNDDVTLMRLRMLAGQPAFLLACR |
| Ga0318567_103902842 | 3300031821 | Soil | LAHPDVFARLVEDQRREQNSVKRMKNDDVTLMRLRLLAGQPAFLLACR |
| Ga0318495_102602692 | 3300031860 | Soil | STLTTLAHPDVFARLVGDQRREQDSAKRMKNDDVTLMRLRMLAGQPAFLLACR |
| Ga0306921_118849631 | 3300031912 | Soil | HPDVFARLVEDQRREQNSVKRMKNDDVTLMRLRLLAGQPAFLLACR |
| Ga0318524_105689221 | 3300032067 | Soil | ADLAHPAVFARFVEDQRDEADGAKRMKNDDVTLMRLRMLAAQPSYVLACR |
| Ga0318524_106493302 | 3300032067 | Soil | ARLVEDQRREQNSAKRMKNDDVTLMRLRLLAGQPAFLLACR |
| Ga0311301_115604592 | 3300032160 | Peatlands Soil | PEVFARLIEDQRREQNSAKRMKNDDVTLMRLRMLAGQPAYLLACR |
| Ga0307471_1031233112 | 3300032180 | Hardwood Forest Soil | DTLTTLAHPDVFARLIEDQRREQDSAKRMKNDDVTLMRLRMLAGQPAYLLACR |
| Ga0335085_101308883 | 3300032770 | Soil | QRREQDSATRMKNDDVTLMRLRMLAGQPAFLLACR |
| Ga0335085_120161041 | 3300032770 | Soil | DQRREQNSAKRMKNDDVTLMRLRLLAGQPAFLLACR |
| Ga0335074_103784962 | 3300032895 | Soil | TMAGLAHPEVFARFVADQRKEIDAAKRLKNDDVTLLRLRITADQPSFLLACR |
| Ga0335077_102980331 | 3300033158 | Soil | GLAHPDVFARFVADQRKEIDAAKRLKNDDVTLMRLRITADQPSFLLACR |
| Ga0373958_0113329_480_638 | 3300034819 | Rhizosphere Soil | MLTTLAHPDVFARLIEDQRREQDSAKRMKNDDVTLMRLRMLAGQPAYLLACR |
| ⦗Top⦘ |