| Basic Information | |
|---|---|
| Family ID | F101314 |
| Family Type | Metagenome |
| Number of Sequences | 102 |
| Average Sequence Length | 41 residues |
| Representative Sequence | LTYIYRTLSEKKSQDRKEDRTENPEGSQDQSGFLLFAVKINRN |
| Number of Associated Samples | 76 |
| Number of Associated Scaffolds | 102 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | No |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 0.00 % |
| % of genes near scaffold ends (potentially truncated) | 96.08 % |
| % of genes from short scaffolds (< 2000 bps) | 65.69 % |
| Associated GOLD sequencing projects | 69 |
| AlphaFold2 3D model prediction | No |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (80.392 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine (35.294 % of family members) |
| Environment Ontology (ENVO) | Unclassified (56.863 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Saline → Water (saline) (85.294 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 0.00% β-sheet: 27.91% Coil/Unstructured: 72.09% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 102 Family Scaffolds |
|---|---|---|
| PF02739 | 5_3_exonuc_N | 47.06 |
| PF01171 | ATP_bind_3 | 14.71 |
| PF01261 | AP_endonuc_2 | 4.90 |
| PF00156 | Pribosyltran | 2.94 |
| PF08240 | ADH_N | 1.96 |
| PF00004 | AAA | 1.96 |
| PF01436 | NHL | 1.96 |
| PF11734 | TilS_C | 1.96 |
| PF00067 | p450 | 1.96 |
| PF01434 | Peptidase_M41 | 0.98 |
| PF02784 | Orn_Arg_deC_N | 0.98 |
| PF01288 | HPPK | 0.98 |
| PF06480 | FtsH_ext | 0.98 |
| PF00892 | EamA | 0.98 |
| COG ID | Name | Functional Category | % Frequency in 102 Family Scaffolds |
|---|---|---|---|
| COG0258 | 5'-3' exonuclease Xni/ExoIX (flap endonuclease) | Replication, recombination and repair [L] | 47.06 |
| COG0037 | tRNA(Ile)-lysidine synthase TilS/MesJ | Translation, ribosomal structure and biogenesis [J] | 14.71 |
| COG0301 | Adenylyl- and sulfurtransferase ThiI (thiamine and tRNA 4-thiouridine biosynthesis) | Translation, ribosomal structure and biogenesis [J] | 14.71 |
| COG0482 | tRNA U34 2-thiouridine synthase MnmA/TrmU, contains the PP-loop ATPase domain | Translation, ribosomal structure and biogenesis [J] | 14.71 |
| COG0519 | GMP synthase, PP-ATPase domain/subunit | Nucleotide transport and metabolism [F] | 14.71 |
| COG0603 | 7-cyano-7-deazaguanine synthase (queuosine biosynthesis) | Translation, ribosomal structure and biogenesis [J] | 14.71 |
| COG1606 | ATP-utilizing enzyme, PP-loop superfamily | General function prediction only [R] | 14.71 |
| COG0465 | ATP-dependent Zn proteases | Posttranslational modification, protein turnover, chaperones [O] | 1.96 |
| COG2124 | Cytochrome P450 | Defense mechanisms [V] | 1.96 |
| COG0019 | Diaminopimelate decarboxylase | Amino acid transport and metabolism [E] | 0.98 |
| COG0801 | 7,8-dihydro-6-hydroxymethylpterin pyrophosphokinase (folate biosynthesis) | Coenzyme transport and metabolism [H] | 0.98 |
| COG1166 | Arginine decarboxylase (spermidine biosynthesis) | Amino acid transport and metabolism [E] | 0.98 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 80.39 % |
| Unclassified | root | N/A | 19.61 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300001748|JGI11772J19994_1001437 | All Organisms → cellular organisms → Bacteria | 5149 | Open in IMG/M |
| 3300001846|ACM22_1015922 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 2300 | Open in IMG/M |
| 3300001971|GOS2215_10097513 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 648 | Open in IMG/M |
| 3300002040|GOScombined01_102767314 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1852 | Open in IMG/M |
| 3300005404|Ga0066856_10081617 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1413 | Open in IMG/M |
| 3300005404|Ga0066856_10209712 | Not Available | 846 | Open in IMG/M |
| 3300005404|Ga0066856_10336629 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 648 | Open in IMG/M |
| 3300005432|Ga0066845_10007896 | All Organisms → cellular organisms → Bacteria | 3593 | Open in IMG/M |
| 3300005432|Ga0066845_10043654 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1641 | Open in IMG/M |
| 3300005432|Ga0066845_10096931 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Dehalococcoidia → unclassified Dehalococcoidia → Dehalococcoidia bacterium | 1114 | Open in IMG/M |
| 3300005432|Ga0066845_10136599 | Not Available | 936 | Open in IMG/M |
| 3300005432|Ga0066845_10421555 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 516 | Open in IMG/M |
| 3300005512|Ga0074648_1037616 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 2302 | Open in IMG/M |
| 3300005522|Ga0066861_10018653 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 2515 | Open in IMG/M |
| 3300005522|Ga0066861_10134246 | Not Available | 857 | Open in IMG/M |
| 3300005523|Ga0066865_10050764 | Not Available | 1439 | Open in IMG/M |
| 3300005523|Ga0066865_10297231 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 610 | Open in IMG/M |
| 3300005523|Ga0066865_10392420 | Not Available | 527 | Open in IMG/M |
| 3300005606|Ga0066835_10353775 | Not Available | 512 | Open in IMG/M |
| 3300005934|Ga0066377_10005645 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 3067 | Open in IMG/M |
| 3300005946|Ga0066378_10246381 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 557 | Open in IMG/M |
| 3300005971|Ga0066370_10029810 | All Organisms → cellular organisms → Bacteria | 1624 | Open in IMG/M |
| 3300005971|Ga0066370_10081640 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1055 | Open in IMG/M |
| 3300006024|Ga0066371_10005278 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 3313 | Open in IMG/M |
| 3300006024|Ga0066371_10037122 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1380 | Open in IMG/M |
| 3300006024|Ga0066371_10054643 | Not Available | 1153 | Open in IMG/M |
| 3300006024|Ga0066371_10109476 | Not Available | 832 | Open in IMG/M |
| 3300006024|Ga0066371_10199034 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 621 | Open in IMG/M |
| 3300006025|Ga0075474_10146667 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 742 | Open in IMG/M |
| 3300006027|Ga0075462_10090114 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 957 | Open in IMG/M |
| 3300006329|Ga0068486_1062041 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1318 | Open in IMG/M |
| 3300006334|Ga0099675_1621636 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 752 | Open in IMG/M |
| 3300006622|Ga0101442_116096 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 2539 | Open in IMG/M |
| 3300007113|Ga0101666_1014310 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1327 | Open in IMG/M |
| 3300007623|Ga0102948_1041013 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1495 | Open in IMG/M |
| 3300007725|Ga0102951_1011285 | All Organisms → cellular organisms → Bacteria | 2982 | Open in IMG/M |
| 3300007725|Ga0102951_1034239 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1547 | Open in IMG/M |
| 3300008012|Ga0075480_10060783 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 2189 | Open in IMG/M |
| 3300009000|Ga0102960_1010633 | All Organisms → cellular organisms → Bacteria | 3476 | Open in IMG/M |
| 3300009000|Ga0102960_1022677 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 2352 | Open in IMG/M |
| 3300009001|Ga0102963_1075382 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1382 | Open in IMG/M |
| 3300009703|Ga0114933_10070815 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 2499 | Open in IMG/M |
| 3300009790|Ga0115012_10499400 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 950 | Open in IMG/M |
| 3300010297|Ga0129345_1210924 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 686 | Open in IMG/M |
| 3300010318|Ga0136656_1032487 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1892 | Open in IMG/M |
| 3300012919|Ga0160422_11149324 | Not Available | 504 | Open in IMG/M |
| 3300012928|Ga0163110_11535014 | Not Available | 541 | Open in IMG/M |
| 3300012936|Ga0163109_11142364 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 568 | Open in IMG/M |
| 3300013188|Ga0116834_1001086 | All Organisms → cellular organisms → Bacteria | 4000 | Open in IMG/M |
| 3300013252|Ga0116817_1004957 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1223 | Open in IMG/M |
| 3300017818|Ga0181565_10045754 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 3173 | Open in IMG/M |
| 3300017818|Ga0181565_10083668 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 2272 | Open in IMG/M |
| 3300017824|Ga0181552_10280198 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 829 | Open in IMG/M |
| 3300017949|Ga0181584_10436654 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 815 | Open in IMG/M |
| 3300017951|Ga0181577_10153065 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1568 | Open in IMG/M |
| 3300017951|Ga0181577_10904980 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 526 | Open in IMG/M |
| 3300017952|Ga0181583_10208097 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1280 | Open in IMG/M |
| 3300017952|Ga0181583_10751769 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 576 | Open in IMG/M |
| 3300017956|Ga0181580_10176875 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1512 | Open in IMG/M |
| 3300017957|Ga0181571_10381907 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 875 | Open in IMG/M |
| 3300017969|Ga0181585_11095243 | Not Available | 504 | Open in IMG/M |
| 3300018036|Ga0181600_10075337 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 2065 | Open in IMG/M |
| 3300018426|Ga0181566_10614889 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 753 | Open in IMG/M |
| 3300018428|Ga0181568_11298726 | Not Available | 543 | Open in IMG/M |
| 3300019701|Ga0194015_1042391 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 552 | Open in IMG/M |
| 3300020053|Ga0181595_10028285 | All Organisms → cellular organisms → Bacteria | 3452 | Open in IMG/M |
| 3300020168|Ga0181588_10052434 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 2437 | Open in IMG/M |
| 3300020173|Ga0181602_10029315 | All Organisms → cellular organisms → Bacteria | 3258 | Open in IMG/M |
| 3300020188|Ga0181605_10030551 | All Organisms → cellular organisms → Bacteria | 3268 | Open in IMG/M |
| 3300020189|Ga0181578_10275168 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 790 | Open in IMG/M |
| 3300020194|Ga0181597_10025015 | All Organisms → cellular organisms → Bacteria | 4293 | Open in IMG/M |
| 3300020313|Ga0211485_1004548 | All Organisms → cellular organisms → Bacteria | 3092 | Open in IMG/M |
| 3300020325|Ga0211507_1047483 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 851 | Open in IMG/M |
| 3300020337|Ga0211508_1061442 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 876 | Open in IMG/M |
| 3300020410|Ga0211699_10175638 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 813 | Open in IMG/M |
| 3300020411|Ga0211587_10074611 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1504 | Open in IMG/M |
| 3300020416|Ga0211644_10325540 | Not Available | 634 | Open in IMG/M |
| 3300020418|Ga0211557_10096192 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1470 | Open in IMG/M |
| 3300021368|Ga0213860_10420960 | Not Available | 577 | Open in IMG/M |
| 3300022907|Ga0255775_1025621 | All Organisms → cellular organisms → Bacteria | 3344 | Open in IMG/M |
| 3300022928|Ga0255758_10031406 | All Organisms → cellular organisms → Bacteria | 3341 | Open in IMG/M |
| 3300022929|Ga0255752_10035369 | All Organisms → cellular organisms → Bacteria | 3339 | Open in IMG/M |
| 3300022939|Ga0255754_10271687 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 814 | Open in IMG/M |
| 3300022939|Ga0255754_10464301 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 549 | Open in IMG/M |
| 3300026077|Ga0208749_1033671 | Not Available | 1082 | Open in IMG/M |
| 3300026077|Ga0208749_1089840 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 641 | Open in IMG/M |
| 3300026083|Ga0208878_1005379 | All Organisms → cellular organisms → Bacteria | 3992 | Open in IMG/M |
| 3300026130|Ga0209961_1006674 | All Organisms → cellular organisms → Bacteria | 2928 | Open in IMG/M |
| 3300026130|Ga0209961_1033734 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1070 | Open in IMG/M |
| 3300026183|Ga0209932_1020362 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1740 | Open in IMG/M |
| 3300026201|Ga0208127_1007982 | All Organisms → cellular organisms → Bacteria | 4355 | Open in IMG/M |
| 3300026266|Ga0208410_1009475 | All Organisms → cellular organisms → Bacteria | 3558 | Open in IMG/M |
| 3300026292|Ga0208277_1017003 | All Organisms → cellular organisms → Bacteria | 3554 | Open in IMG/M |
| 3300027702|Ga0209036_1000639 | All Organisms → cellular organisms → Bacteria | 15238 | Open in IMG/M |
| 3300027702|Ga0209036_1160747 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 648 | Open in IMG/M |
| 3300027774|Ga0209433_10092800 | Not Available | 1111 | Open in IMG/M |
| 3300027830|Ga0209359_10188925 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 918 | Open in IMG/M |
| 3300031785|Ga0310343_10213914 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1325 | Open in IMG/M |
| 3300031785|Ga0310343_11003632 | Not Available | 630 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Marine | Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine | 35.29% |
| Salt Marsh | Environmental → Aquatic → Marine → Intertidal Zone → Salt Marsh → Salt Marsh | 24.51% |
| Marine | Environmental → Aquatic → Marine → Unclassified → Unclassified → Marine | 7.84% |
| Aqueous | Environmental → Aquatic → Marine → Coastal → Unclassified → Aqueous | 4.90% |
| Water | Environmental → Aquatic → Non-Marine Saline And Alkaline → Saline → Unclassified → Water | 4.90% |
| Pond Water | Environmental → Aquatic → Non-Marine Saline And Alkaline → Saline → Unclassified → Pond Water | 3.92% |
| Seawater | Environmental → Aquatic → Marine → Oceanic → Unclassified → Seawater | 1.96% |
| Surface Seawater | Environmental → Aquatic → Marine → Oceanic → Photic Zone → Surface Seawater | 1.96% |
| Seawater | Environmental → Aquatic → Marine → Coastal → Unclassified → Seawater | 1.96% |
| Freshwater To Marine Saline Gradient | Environmental → Aquatic → Marine → Coastal → Unclassified → Freshwater To Marine Saline Gradient | 1.96% |
| Saline Water And Sediment | Environmental → Aquatic → Non-Marine Saline And Alkaline → Saline → Epilimnion → Saline Water And Sediment | 1.96% |
| Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Sediment | 0.98% |
| Marine Plankton | Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine Plankton | 0.98% |
| Marine | Environmental → Aquatic → Marine → Oceanic → Photic Zone → Marine | 0.98% |
| Seawater | Environmental → Aquatic → Marine → Oceanic → Photic Zone → Seawater | 0.98% |
| Marine | Environmental → Aquatic → Marine → Oceanic → Aphotic Zone → Marine | 0.98% |
| Marine Surface Water | Environmental → Aquatic → Marine → Coastal → Unclassified → Marine Surface Water | 0.98% |
| Marine | Environmental → Aquatic → Marine → Intertidal Zone → Unclassified → Marine | 0.98% |
| Deep Subsurface | Environmental → Aquatic → Marine → Volcanic → Unclassified → Deep Subsurface | 0.98% |
| Volcanic Co2 Seep Seawater | Environmental → Aquatic → Marine → Volcanic → Unclassified → Volcanic Co2 Seep Seawater | 0.98% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300001748 | Saline surface water microbial communities from Etoliko Lagoon, Greece - surface water (0 m) | Environmental | Open in IMG/M |
| 3300001846 | Marine plankton microbial communities from the Amazon River plume, Atlantic Ocean - ACM22, ROCA_DNA119_0.2um_25b | Environmental | Open in IMG/M |
| 3300001971 | Marine microbial communities from the Sargasso Sea - GS000c | Environmental | Open in IMG/M |
| 3300002040 | GS000c - Sargasso Station 3 | Environmental | Open in IMG/M |
| 3300005404 | Marine microbial and viral communities from oxygen minimum zone, Eastern Pacific Ocean - ETNP201406SV205 | Environmental | Open in IMG/M |
| 3300005432 | Marine microbial and viral communities from oxygen minimum zone, Eastern Pacific Ocean - ETNP201310SV78 | Environmental | Open in IMG/M |
| 3300005512 | Saline surface water microbial communities from Etoliko Lagoon, Greece - halocline_water | Environmental | Open in IMG/M |
| 3300005522 | Marine microbial and viral communities from oxygen minimum zone, Eastern Pacific Ocean - ETNP2014F10-02SV257 | Environmental | Open in IMG/M |
| 3300005523 | Marine microbial and viral communities from oxygen minimum zone, Eastern Pacific Ocean - ETNP2014F12-01SV265 | Environmental | Open in IMG/M |
| 3300005606 | Marine microbial and viral communities from oxygen minimum zone, Eastern Pacific Ocean - ETNP201302SV84 | Environmental | Open in IMG/M |
| 3300005934 | Seawater microbial communities from Saanich Inlet, British Columbia, Canada - Knorr_S23_td_SurfaceB_ad_5m_LV_B | Environmental | Open in IMG/M |
| 3300005946 | Seawater microbial communities from Saanich Inlet, British Columbia, Canada - Knorr_S23_td_DCM_ad_71m_LV_A | Environmental | Open in IMG/M |
| 3300005971 | Seawater microbial communities from Saanich Inlet, British Columbia, Canada - Knorr_S15_td_SurfaceA_ad_5m_LV_A | Environmental | Open in IMG/M |
| 3300006024 | Seawater microbial communities from Saanich Inlet, British Columbia, Canada - Knorr_S15_td_DCM_ad_63m_LV_B | Environmental | Open in IMG/M |
| 3300006025 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_22_D_<0.8_DNA | Environmental | Open in IMG/M |
| 3300006027 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Fall_30_<0.8_DNA | Environmental | Open in IMG/M |
| 3300006329 | Marine microbial communities from North Pacific Subtropical Gyre, Station ALOHA - HOT233_1_0500m | Environmental | Open in IMG/M |
| 3300006334 | Marine microbial communities from North Pacific Subtropical Gyre, Station ALOHA - HOT224_1_0025m | Environmental | Open in IMG/M |
| 3300006622 | Marine coastal surface water microbial communities in Port Hacking, Sydney, Australia ? TJ08 time point | Environmental | Open in IMG/M |
| 3300007113 | Seawater microbiome, Papua New Guinea CO2 seep, Upa-Upasina 'bubble' site, Water-is | Environmental | Open in IMG/M |
| 3300007623 | Water microbial communities from South San Francisco under conditions of wetland restoration - Salt Pond MetaG R2A_A_H2O_MG | Environmental | Open in IMG/M |
| 3300007725 | Water microbial communities from South San Francisco under conditions of wetland restoration - Salt Pond MetaG R2A_B_H2O_MG | Environmental | Open in IMG/M |
| 3300008012 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_29_N_<0.8_DNA | Environmental | Open in IMG/M |
| 3300009000 | Salt pond water microbial communities from South San Francisco under conditions of wetland restoration - Salt Pond MetaG SF2_B_H2O_MG | Environmental | Open in IMG/M |
| 3300009001 | Salt pond water microbial communities from South San Francisco under conditions of wetland restoration - Salt Pond MetaG SF2_C_H2O_MG | Environmental | Open in IMG/M |
| 3300009703 | Deep subsurface microbial communities from Kolumbo volcano to uncover new lineages of life (NeLLi) - 4SBTROV12_W25 metaG | Environmental | Open in IMG/M |
| 3300009790 | Marine eukaryotic phytoplankton communities from Atlantic Ocean - Tropical Atlantic ANT10 Metagenome | Environmental | Open in IMG/M |
| 3300010297 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_20_0.8_DNA | Environmental | Open in IMG/M |
| 3300010318 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_15_0.8_DNA | Environmental | Open in IMG/M |
| 3300012919 | Marine microbial communities from the Central Pacific Ocean - Fk160115 60m metaG | Environmental | Open in IMG/M |
| 3300012928 | Marine microbial communities from the Costa Rica Dome - CRUD Field 142mm St17 metaG | Environmental | Open in IMG/M |
| 3300012936 | Marine microbial communities from the Costa Rica Dome - CRUD Field 142mm St13 metaG | Environmental | Open in IMG/M |
| 3300013188 | Marine hypoxic microbial communities from the Gulf of Mexico, USA - 6m_Station1_GOM_Metagenome | Environmental | Open in IMG/M |
| 3300013252 | Marine hypoxic microbial communities from the Gulf of Mexico, USA - 11m_Station6_GOM_Metagenome | Environmental | Open in IMG/M |
| 3300017818 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 101401AT metaG (megahit assembly) | Environmental | Open in IMG/M |
| 3300017824 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 011501BT metaG (megahit assembly) | Environmental | Open in IMG/M |
| 3300017949 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 071406AT metaG (megahit assembly) | Environmental | Open in IMG/M |
| 3300017951 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 101413BT metaG (megahit assembly) | Environmental | Open in IMG/M |
| 3300017952 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 071405CT metaG (megahit assembly) | Environmental | Open in IMG/M |
| 3300017956 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 071403BT metaG (megahit assembly) | Environmental | Open in IMG/M |
| 3300017957 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 101407AT metaG (megahit assembly) | Environmental | Open in IMG/M |
| 3300017969 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 071407BT metaG (megahit assembly) | Environmental | Open in IMG/M |
| 3300018036 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 041406US metaG (megahit assembly) | Environmental | Open in IMG/M |
| 3300018426 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 101402AT metaG (megahit assembly) | Environmental | Open in IMG/M |
| 3300018428 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 101404AT metaG (megahit assembly) | Environmental | Open in IMG/M |
| 3300019701 | Sediment microbial communities from the Broadkill River, Lewes, Delaware, United States ? BRC_1-2_MG | Environmental | Open in IMG/M |
| 3300020053 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 041401AS metaG (spades assembly) | Environmental | Open in IMG/M |
| 3300020168 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 071409BT metaG (spades assembly) | Environmental | Open in IMG/M |
| 3300020173 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 041408US metaG (spades assembly) | Environmental | Open in IMG/M |
| 3300020188 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 041411US metaG (spades assembly) | Environmental | Open in IMG/M |
| 3300020189 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 071401CT metaG (spades assembly) | Environmental | Open in IMG/M |
| 3300020194 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 041403US metaG (spades assembly) | Environmental | Open in IMG/M |
| 3300020313 | Marine microbial communities from Tara Oceans - TARA_A100001037 (ERX556055-ERR599061) | Environmental | Open in IMG/M |
| 3300020325 | Marine microbial communities from Tara Oceans - TARA_B100000034 (ERX556073-ERR598966) | Environmental | Open in IMG/M |
| 3300020337 | Marine microbial communities from Tara Oceans - TARA_E500000075 (ERX289009-ERR315861) | Environmental | Open in IMG/M |
| 3300020410 | Marine microbial communities from Tara Oceans - TARA_B100000519 (ERX555959-ERR599148) | Environmental | Open in IMG/M |
| 3300020411 | Marine microbial communities from Tara Oceans - TARA_B100000131 (ERX556098-ERR599130) | Environmental | Open in IMG/M |
| 3300020416 | Marine microbial communities from Tara Oceans - TARA_B100001109 (ERX556137-ERR599039) | Environmental | Open in IMG/M |
| 3300020418 | Marine microbial communities from Tara Oceans - TARA_B100002051 (ERX556028-ERR599136) | Environmental | Open in IMG/M |
| 3300021368 | Coastal seawater microbial communities near Pivers Island, North Carolina, United States - PICO550 | Environmental | Open in IMG/M |
| 3300022907 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 011511BT metaG | Environmental | Open in IMG/M |
| 3300022928 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 011513CT metaG | Environmental | Open in IMG/M |
| 3300022929 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 011512CT metaG | Environmental | Open in IMG/M |
| 3300022939 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 101412BT metaG | Environmental | Open in IMG/M |
| 3300025815 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_22_D_<0.8_DNA (SPAdes) | Environmental | Open in IMG/M |
| 3300026077 | Seawater microbial communities from Saanich Inlet, British Columbia, Canada - Knorr_S15_td_DCM_ad_63m_LV_B (SPAdes) | Environmental | Open in IMG/M |
| 3300026083 | Seawater microbial communities from Saanich Inlet, British Columbia, Canada - Knorr_S15_td_SurfaceA_ad_5m_LV_A (SPAdes) | Environmental | Open in IMG/M |
| 3300026130 | Water microbial communities from South San Francisco under conditions of wetland restoration - Salt Pond MetaG R2A_B_H2O_MG (SPAdes) | Environmental | Open in IMG/M |
| 3300026183 | Salt pond water microbial communities from South San Francisco under conditions of wetland restoration - Salt Pond MetaG SF2_B_H2O_MG (SPAdes) | Environmental | Open in IMG/M |
| 3300026201 | Marine microbial and viral communities from oxygen minimum zone, Eastern Pacific Ocean - ETNP201306SV45 (SPAdes) | Environmental | Open in IMG/M |
| 3300026266 | Marine microbial and viral communities from oxygen minimum zone, Eastern Pacific Ocean - ETNP2014F10-02SV257 (SPAdes) | Environmental | Open in IMG/M |
| 3300026292 | Marine microbial and viral communities from oxygen minimum zone, Eastern Pacific Ocean - ETNP201406SV205 (SPAdes) | Environmental | Open in IMG/M |
| 3300027702 | Marine microbial communities from the Southern Atlantic Ocean, analyzing organic carbon cycling - DCM_A/KNORR_S2/LV (SPAdes) | Environmental | Open in IMG/M |
| 3300027774 | Marine microbial communities from oxygen minimum zone in mesopelagic equatorial Pacific - METZYME_5_50m (SPAdes) | Environmental | Open in IMG/M |
| 3300027830 | Marine microbial communities from the Southern Atlantic Ocean, analyzing organic carbon cycling - Surface_A/KNORR_S2/LV (SPAdes) | Environmental | Open in IMG/M |
| 3300031785 | Marine microbial communities from station ALOHA, North Pacific Subtropical Gyre - HC15-DNA-20-25_MG | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| JGI11772J19994_10014371 | 3300001748 | Saline Water And Sediment | YRTLSEKKSQDRKEDRTENPEGSQDQSGFLLFEVKIYGN* |
| ACM22_10159224 | 3300001846 | Marine Plankton | EQKLTYIYRTLSEKKSQDRKEDRTENPEGSQDQSGFLLFAVKINRN* |
| GOS2215_100975132 | 3300001971 | Marine | QKLTYIYRTLSEKKSQDGKEDRTENPEGSQDQSGFLLFAVKINRN* |
| GOScombined01_1027673141 | 3300002040 | Marine | TLVNLLHEQKLTYIYRTLSEKKSQDRKEDRTENPEGSQDQSGFLLFAVKINRN* |
| Ga0066856_100816171 | 3300005404 | Marine | RIKTKYIYRTLSEKKSQDRKEDRTENPEGSQDQSGFLLFAA* |
| Ga0066856_102097121 | 3300005404 | Marine | EQKLTYIYRTLSEKKSQDRKEDRTENPEGSQDQSGFLLFTKVFN* |
| Ga0066856_103366292 | 3300005404 | Marine | *EQKLTYIYRTLSEKKSQDRKEDRTENPEGSQDQSGFLLFAVKINRN* |
| Ga0066845_100078961 | 3300005432 | Marine | KLTYIYRTLSEKKSQDRKEDRTENPEGSQDQSGFLLFAVILLVN* |
| Ga0066845_100436541 | 3300005432 | Marine | IKTKYIYRTLSEKKSQDRKEDRTENPEGSQDQSGFLLFAA* |
| Ga0066845_100969311 | 3300005432 | Marine | LTYIYRTLSEKKSQDRKEDRTENPEGSQDQSGFLLFKIN* |
| Ga0066845_101365991 | 3300005432 | Marine | KLTYIYRTLSEKKSQDRKEDRIENPEGSQDQSGFLLFSRFFY* |
| Ga0066845_104215551 | 3300005432 | Marine | KLTYIYRTLSEKKSQDRKEDRTENPEGSQDQSGFLLFAVKINRN* |
| Ga0074648_10376164 | 3300005512 | Saline Water And Sediment | AQEQKLTYIYRTLSEKKSQDRKEDRTENPEGSQDQSGFLLFAVKINGN* |
| Ga0066861_100186534 | 3300005522 | Marine | RIKTNYIYRTLSEKKSQDRKEDRTENPEGSQDQSGFLLFAA* |
| Ga0066861_101342463 | 3300005522 | Marine | VRIKTNYIYRTLSEKKSKDRKEDRTENPEGSQDQSGFLLFFKLMPN* |
| Ga0066865_100507644 | 3300005523 | Marine | QKLTYIYRTLSEKKSQDRKEDRTENPEGSQDQSGFLLFTKTFL* |
| Ga0066865_102972311 | 3300005523 | Marine | YRTLSEKKSQDRKEDRIENPEGSQDQSGFLLFAVKINRN* |
| Ga0066865_103924201 | 3300005523 | Marine | EQKLTYIYRTLSEKKSQDRKEDRTENPEGSQDQSGFLLSTKVFY* |
| Ga0066835_103537752 | 3300005606 | Marine | RTLSEKKSQDRKEDRTENPEGSQDQSGFLLFTKILL* |
| Ga0066377_100056451 | 3300005934 | Marine | EQKLTYIYRTLSEKKSQDRKEDRTENPEGSQDQSGFLLFTKVFI* |
| Ga0066378_102463812 | 3300005946 | Marine | LTYIYRTLSEKKSQDRKEDRTENPEGSQDQSGFLLFAVKINRN* |
| Ga0066370_100298101 | 3300005971 | Marine | KLTYIYRTLSEKKSKDRKEDRTENPEGSQDQSGFLLSTAKFL* |
| Ga0066370_100816403 | 3300005971 | Marine | TYIYRTLSEKKSQDRKEDRTENPEGSQDQSGFLLFAVKINRN* |
| Ga0066371_100052781 | 3300006024 | Marine | IYRTLSEKKSKDRKEDRTENPEGSQDQSGFLLFAA* |
| Ga0066371_100371223 | 3300006024 | Marine | QEQKLTYIYRTLSEKKSQDRKEDRTENPEGSQDQSGFLLFAVKINRN* |
| Ga0066371_100546433 | 3300006024 | Marine | RIKTNYIYRTLSEKKSKDRKEDRTENPEGSQDQSGFLLSTVKFL* |
| Ga0066371_101094762 | 3300006024 | Marine | IYRTLSEKKSQDRKEDRTENPEGSQDQSGFLLFGISHLLLLI* |
| Ga0066371_101990342 | 3300006024 | Marine | TYIYRTLSEKKSQD*KEDRTENPEGSQDQSGFLLFAVILFIN* |
| Ga0075474_100987381 | 3300006025 | Aqueous | TYIYRTLSEKKSQDRKEDRTKNPEGSQDQSGFLLFTKVFN* |
| Ga0075474_101466671 | 3300006025 | Aqueous | LSEKKSQDRKEDRTENPEGSQDQSGFLLFAVKINGN* |
| Ga0075462_100901142 | 3300006027 | Aqueous | IYRTLSEKKSQDRKEDRTENPEGSQDQSGFLLFAVKIN* |
| Ga0068486_10620411 | 3300006329 | Marine | QKLTYIYITLSEKKSQDGKKDRTENPEGSQDQSGFLLFAAK* |
| Ga0099675_16216361 | 3300006334 | Marine | LTYIYKTLSEKKSKDRKEDRIENPEGSQDQSGFLLYAID* |
| Ga0101442_1160961 | 3300006622 | Marine Surface Water | TLSEKKSQDRKEDRTENPEGSQDQSGFLLFAVKINRN* |
| Ga0101666_10143103 | 3300007113 | Volcanic Co2 Seep Seawater | IYRTLSEKKSQDRKEDRTENPEGSQDQSGFLLFAVKINRN* |
| Ga0102948_10410131 | 3300007623 | Water | RTLSEKKSQDRKEDRTENPEGSQDQSGFLLFAVKTNRN* |
| Ga0102951_10112851 | 3300007725 | Water | KLTYIYRTLSEKKSQDRKEDRTKNPEGSQDQSGFLLFAVKINGN* |
| Ga0102951_10342391 | 3300007725 | Water | KLTYIYRTLSEKKSQDRKEDRTENPEGSQDQSGFLLFAVKINGN* |
| Ga0075480_100607831 | 3300008012 | Aqueous | YIYRTLSEKKSQDRKEDRTENPEGSQDQSGFLLFAVKINRN* |
| Ga0102960_10106336 | 3300009000 | Pond Water | LTYIYRTLSEKKSQDRKEDRTENPEGSQDQSGFLLFAVKTNRN* |
| Ga0102960_10226774 | 3300009000 | Pond Water | EKKSQDRKEDRTENPEGSQDQSGFLLFAVKINGN* |
| Ga0102963_10753821 | 3300009001 | Pond Water | KLTYIYRTLSEKKSQDRKEDRTENPEGSQDQSGFLLFAVKTNRN* |
| Ga0114933_100708151 | 3300009703 | Deep Subsurface | IYRTLSEKKSQDRKEDRIKNPGRSQDQSGFLLFAVRLFRN* |
| Ga0115012_104994001 | 3300009790 | Marine | TYIYRTLSEKKSKDGKEDRIKNPGGSQDQLGFLLFMISCNF* |
| Ga0129345_12109241 | 3300010297 | Freshwater To Marine Saline Gradient | TLSEKKSQDRKEDRTENPEGSQDQSGFLLFAVKINGN* |
| Ga0136656_10324871 | 3300010318 | Freshwater To Marine Saline Gradient | EQKLTYIYRTLSEKKSQDRKEDRTENPEGSQDQSGFLLFAVKINGN* |
| Ga0160422_111493241 | 3300012919 | Seawater | TYIYRTLSEKKSQDRKEDRTENPEGSQDQSGFLLFTKAFNL* |
| Ga0163110_115350141 | 3300012928 | Surface Seawater | QEQKLTYIYRTLSEKKSQDRKEDRIENPEGSQDQSGFLLFTKVFN* |
| Ga0163109_111423641 | 3300012936 | Surface Seawater | LTYIYRTLSEKKSQDRKEDSTENPEGSQDQSGFLLFA* |
| Ga0116834_10010861 | 3300013188 | Marine | EQKLTYIYRTLSEKKSQDRKEDRTENPEGSQDQSGFLLFAVKIN* |
| Ga0116817_10049572 | 3300013252 | Marine | YRTLSEKKSQDRKEDRTENPEGSQDQSGFLLFAVK* |
| Ga0181565_100457541 | 3300017818 | Salt Marsh | LSEKKSQDRKEDRTENPEGSQDQSGFLLFAVKINGN |
| Ga0181565_100836681 | 3300017818 | Salt Marsh | KLTYIYRTLSEKKSQDRKEDRTENPEGSQDQSGFLLFC |
| Ga0181552_102801981 | 3300017824 | Salt Marsh | KLTYIYRTLSEKKSQDRKEDRTENPEGSQDQSGFLLFAVKINGN |
| Ga0181584_104366541 | 3300017949 | Salt Marsh | KLTYIYRTLSEKKSQDRKEDRTENPEGSQDQSGFLLFAVKTNRN |
| Ga0181577_101530651 | 3300017951 | Salt Marsh | EQKLTYIYRTLSEKKSQDRKEDRTENPEGSQDQSGFLLFAVKINGN |
| Ga0181577_109049801 | 3300017951 | Salt Marsh | TYIYRTLSEKKSQDRKEDRTENPEGSQDQSGFLLFAVEINRN |
| Ga0181583_102080973 | 3300017952 | Salt Marsh | TYIYRTLSEKKSQDRKEDRTENPEGSQDQSGFLLFC |
| Ga0181583_107517691 | 3300017952 | Salt Marsh | TYIYRTLSEKKSQDRKEDRTENPEGSQDQSGFLLFAVKTNRN |
| Ga0181580_101768751 | 3300017956 | Salt Marsh | EHKLTYIYRTLSEKKSQDRKEDRTENPEGSQDQSGFLLFC |
| Ga0181571_103819071 | 3300017957 | Salt Marsh | EDKLTYIYRTLSEKKSQDRKEDRTENPEGSQDQSGFLLFC |
| Ga0181585_110952431 | 3300017969 | Salt Marsh | AQEQKLTYIYRTLSEKKSQDRKEDRTENPEGSQDQSGFLLSNKVFFD |
| Ga0181600_100753371 | 3300018036 | Salt Marsh | TLSEKKSQDRKEDRTENPEGSQDQSGFLLFAVKINGN |
| Ga0181566_106148891 | 3300018426 | Salt Marsh | KLTYIYRTLSEKKSQDRKEDRIENPEGSQDQSGFLLFTKVFN |
| Ga0181568_112987261 | 3300018428 | Salt Marsh | YIYRTLSEKKSQDRKEDRTENPEGSQDQSGFLLFAVKIN |
| Ga0194015_10423911 | 3300019701 | Sediment | RTLSEKKSQDRKEDRTENPEGSQDQSGFLLFAVKINGN |
| Ga0181595_100282856 | 3300020053 | Salt Marsh | LAQEQKLTYIYRTLSEKKSQDRKEDRTENPEGSQDQSGFLLFAVK |
| Ga0181588_100524341 | 3300020168 | Salt Marsh | QKLTYIYRTLSEKKSQDRKEDRTENPEGSQDQSGFLLFAVKINGN |
| Ga0181602_100293156 | 3300020173 | Salt Marsh | LAQEQKLTYIYRTLSEKKSQDRKEDRTENPEGSQDQSGFLLFAVKINGN |
| Ga0181605_100305511 | 3300020188 | Salt Marsh | SNFLAQEQKLTYIYRTLSEKKSQDRKEDRTENPEGSQDQSGFLLFAVKINGN |
| Ga0181578_102751681 | 3300020189 | Salt Marsh | SEKKSQDRKEDRTENPEGSQDQSGFLLFAVKINRN |
| Ga0181597_100250151 | 3300020194 | Salt Marsh | AQEQKLTYIYRTLSEKKSQDRKEDRTENPEGSQDQSGFLLITINL |
| Ga0211485_10045481 | 3300020313 | Marine | YIYRTLSEKKSQDRKEDRTENPEGSQDQSGFLLFAVKINRN |
| Ga0211507_10474831 | 3300020325 | Marine | LTYIYRTLSEKKSQDRKEDRIENPGGSQDQSGFLLFAVK |
| Ga0211508_10614422 | 3300020337 | Marine | YIYRTLSEKKSQDRKEDRIKNPEGSQDQSGFLLFAVKTNRN |
| Ga0211699_101756382 | 3300020410 | Marine | KLPYIYRTLSEKKSQDGKEDRTENPEGSQDQSGFLLCTFNLSI |
| Ga0211587_100746114 | 3300020411 | Marine | EQKLTYIYRTLSEKKSQDRKEDRTENPEGSQDQSGFLLFAVKINRN |
| Ga0211644_103255402 | 3300020416 | Marine | EQKLTYIYRTLSEKKSQDRKEDRIENPEGSQDQSGFLLFTKVFN |
| Ga0211557_100961922 | 3300020418 | Marine | KKSQDRKEDRTENPEGSQDQSGFLLLIKINMPKTSNL |
| Ga0213860_100176221 | 3300021368 | Seawater | IYRTLSEKKSQDRKEDRTENPEGSQDQSGFLLSNKVFFD |
| Ga0213860_104209601 | 3300021368 | Seawater | YRTLSEKKSQDRKEDRTENPEGSQDQSGFLLFKIN |
| Ga0255775_10256216 | 3300022907 | Salt Marsh | QEQKLTYIYRTLSEKKSQDRKEDRTENPEGSQDQSGFLLFAVK |
| Ga0255758_100314066 | 3300022928 | Salt Marsh | EQKLTYIYRTLSEKKSQDRKEDRTENPEGSQDQSGFLLFAVK |
| Ga0255752_100353696 | 3300022929 | Salt Marsh | QKLTYIYRTLSEKKSQDRKEDRTENPEGSQDQSGFLLFAVEINRN |
| Ga0255754_102716872 | 3300022939 | Salt Marsh | QKLTYIYRTLSEKKSQDRKEDRTENPEGSQDQSGFLLFTKVFN |
| Ga0255754_104643012 | 3300022939 | Salt Marsh | EQKLTYIYRTLSEKKSQDRKEDRTENPEGSQDQSGFLLFAVEINRN |
| Ga0208785_10514453 | 3300025815 | Aqueous | TYIYRTLSEKKSQDRKEDRTKNPEGSQDQSGFLLFTKVFN |
| Ga0208749_10336711 | 3300026077 | Marine | TYIYRTLSEKKSQDRKEDRTENPEGSQDQSGFLLFKIN |
| Ga0208749_10898401 | 3300026077 | Marine | IYRTLSEKKSQDXKEDRTENPEGSQDQSGFLLFAVILFIN |
| Ga0208878_10053791 | 3300026083 | Marine | IYRTLSEKKSQDRKEDRTENPEGSQDQSGFLLFAVKINRN |
| Ga0209961_10066741 | 3300026130 | Water | LTYIYRTLSEKKSQDRKEDRTKNPEGSQDQSGFLLFAVKINGN |
| Ga0209961_10337342 | 3300026130 | Water | LTYIYRTLSEKKSQDRKEDRTKNPEGSQDQSGFLLFAVKTNRN |
| Ga0209932_10203624 | 3300026183 | Pond Water | LTYIYRTLSEKKSQDRKEDRTENPEGSQDQSGFLLFAVKTNRN |
| Ga0208127_10079826 | 3300026201 | Marine | TLSEKKSQDRKEDRTENPEGSQDQSGFLLFAVILLVN |
| Ga0208410_10094756 | 3300026266 | Marine | IYRTLSEKKSQDRKEDRTENPEGSQDQSGFLLFAA |
| Ga0208277_10170036 | 3300026292 | Marine | RTLSEKKSQDRKEDRTENPEGSQDQSGFLLFAVILLVN |
| Ga0209036_100063917 | 3300027702 | Marine | RTLSEKKSQDRKEDRTENPEGSQDQSGFLLFAVKINRN |
| Ga0209036_11607471 | 3300027702 | Marine | IYRTLSEKKSQDRKEDRIKNPGGSQDQSGFLLFAVRLFRN |
| Ga0209433_100928001 | 3300027774 | Marine | EQKLTYIYRTLSEKKSKDGKEDRIKNPEGSQDQSGFLLYIHQFL |
| Ga0209359_101889251 | 3300027830 | Marine | SEKKSKDRKEDRTENPEGSQDQSGFLLFAVKINRN |
| Ga0310343_102139143 | 3300031785 | Seawater | QKLTYIYRTLSEKKSKDRKEDRTENPEGSQDQSGFLLFAVK |
| Ga0310343_110036321 | 3300031785 | Seawater | KLTYIYRTLSEKKSQDRKEDRTENPEGSQDQSGFLLSIVKYL |
| ⦗Top⦘ |