NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F101306

Metagenome / Metatranscriptome Family F101306

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F101306
Family Type Metagenome / Metatranscriptome
Number of Sequences 102
Average Sequence Length 77 residues
Representative Sequence MKISQKVEFGQIDHTYLSSWKSDNEVELHKGDDVVMFTMTEEVMAQLHKKLGDKLTQIAAERLEAAKQLAQEESSDDE
Number of Associated Samples 69
Number of Associated Scaffolds 102

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 92.16 %
% of genes near scaffold ends (potentially truncated) 17.65 %
% of genes from short scaffolds (< 2000 bps) 76.47 %
Associated GOLD sequencing projects 60
AlphaFold2 3D model prediction Yes
3D model pTM-score0.52

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (82.353 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Environmental → Aquatic → Marine → Unclassified → Unclassified → Marine
(41.176 % of family members)
Environment Ontology (ENVO) Unclassified
(77.451 % of family members)
Earth Microbiome Project Ontology (EMPO) Free-living → Saline → Water (saline)
(88.235 % of family members)



 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      


 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 33.02%    β-sheet: 23.58%    Coil/Unstructured: 43.40%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  
pTM-score: 0.52
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.


 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 102 Family Scaffolds
PF06067DUF932 2.94
PF03721UDPG_MGDP_dh_N 0.98
PF00777Glyco_transf_29 0.98
PF04542Sigma70_r2 0.98

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 102 Family Scaffolds
COG0240Glycerol-3-phosphate dehydrogenaseEnergy production and conversion [C] 0.98
COG0568DNA-directed RNA polymerase, sigma subunit (sigma70/sigma32)Transcription [K] 0.98
COG0677UDP-N-acetyl-D-mannosaminuronate dehydrogenaseCell wall/membrane/envelope biogenesis [M] 0.98
COG1004UDP-glucose 6-dehydrogenaseCell wall/membrane/envelope biogenesis [M] 0.98
COG1191DNA-directed RNA polymerase specialized sigma subunitTranscription [K] 0.98
COG12503-hydroxyacyl-CoA dehydrogenaseLipid transport and metabolism [I] 0.98
COG1595DNA-directed RNA polymerase specialized sigma subunit, sigma24 familyTranscription [K] 0.98
COG1893Ketopantoate reductaseCoenzyme transport and metabolism [H] 0.98
COG4941Predicted RNA polymerase sigma factor, contains C-terminal TPR domainTranscription [K] 0.98


 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms92.16 %
UnclassifiedrootN/A7.84 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
3300002231|KVRMV2_101673203All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Chloroflexi incertae sedis → SAR202 cluster → SAR202 cluster bacterium632Open in IMG/M
3300005057|Ga0068511_1079805All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Chloroflexi incertae sedis → SAR202 cluster → SAR202 cluster bacterium567Open in IMG/M
3300005433|Ga0066830_10106806All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Chloroflexi incertae sedis → SAR202 cluster → SAR202 cluster bacterium596Open in IMG/M
3300005837|Ga0078893_12112313All Organisms → Viruses → Predicted Viral1580Open in IMG/M
3300006332|Ga0068500_1103750All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Chloroflexi incertae sedis → SAR202 cluster → SAR202 cluster bacterium6705Open in IMG/M
3300006332|Ga0068500_1114149All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Chloroflexi incertae sedis → SAR202 cluster → SAR202 cluster bacterium1174Open in IMG/M
3300006565|Ga0100228_1036740All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Chloroflexi incertae sedis → SAR202 cluster → SAR202 cluster bacterium1406Open in IMG/M
3300006735|Ga0098038_1102262All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Chloroflexi incertae sedis → SAR202 cluster → SAR202 cluster bacterium987Open in IMG/M
3300006789|Ga0098054_1016805Not Available2944Open in IMG/M
3300006789|Ga0098054_1258239All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Chloroflexi incertae sedis → SAR202 cluster → SAR202 cluster bacterium628Open in IMG/M
3300006793|Ga0098055_1257627All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Chloroflexi incertae sedis → SAR202 cluster → SAR202 cluster bacterium655Open in IMG/M
3300006921|Ga0098060_1126134All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Chloroflexi incertae sedis → SAR202 cluster → SAR202 cluster bacterium717Open in IMG/M
3300006921|Ga0098060_1195016All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Chloroflexi incertae sedis → SAR202 cluster → SAR202 cluster bacterium554Open in IMG/M
3300006929|Ga0098036_1045890All Organisms → Viruses → Predicted Viral1362Open in IMG/M
3300007116|Ga0101667_1051659All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Chloroflexi incertae sedis → SAR202 cluster → SAR202 cluster bacterium738Open in IMG/M
3300007963|Ga0110931_1132427All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Chloroflexi incertae sedis → SAR202 cluster → SAR202 cluster bacterium750Open in IMG/M
3300009420|Ga0114994_10038400All Organisms → Viruses → Predicted Viral3333Open in IMG/M
3300009425|Ga0114997_10611537Not Available574Open in IMG/M
3300009481|Ga0114932_10034097All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Chloroflexi incertae sedis → SAR202 cluster → SAR202 cluster bacterium3369Open in IMG/M
3300009481|Ga0114932_10135374All Organisms → cellular organisms → Bacteria1521Open in IMG/M
3300009481|Ga0114932_10185405All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Chloroflexi incertae sedis → SAR202 cluster → SAR202 cluster bacterium1269Open in IMG/M
3300009481|Ga0114932_10278829All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Chloroflexi incertae sedis → SAR202 cluster → SAR202 cluster bacterium1004Open in IMG/M
3300009543|Ga0115099_10206313All Organisms → Viruses → Predicted Viral1292Open in IMG/M
3300009543|Ga0115099_10682738All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Chloroflexi incertae sedis → SAR202 cluster → SAR202 cluster bacterium658Open in IMG/M
3300009543|Ga0115099_10714186All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Chloroflexi incertae sedis → SAR202 cluster → SAR202 cluster bacterium664Open in IMG/M
3300009593|Ga0115011_10285371All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Chloroflexi incertae sedis → SAR202 cluster → SAR202 cluster bacterium1250Open in IMG/M
3300009593|Ga0115011_10476445All Organisms → cellular organisms → Bacteria986Open in IMG/M
3300009608|Ga0115100_11207706All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Chloroflexi incertae sedis → SAR202 cluster → SAR202 cluster bacterium607Open in IMG/M
3300009679|Ga0115105_11281826All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Chloroflexi incertae sedis → SAR202 cluster → SAR202 cluster bacterium655Open in IMG/M
3300010149|Ga0098049_1188535All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Chloroflexi incertae sedis → SAR202 cluster → SAR202 cluster bacterium633Open in IMG/M
3300010150|Ga0098056_1123898All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Chloroflexi incertae sedis → SAR202 cluster → SAR202 cluster bacterium877Open in IMG/M
3300011303|Ga0138405_1101684All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Chloroflexi incertae sedis → SAR202 cluster → SAR202 cluster bacterium561Open in IMG/M
3300012952|Ga0163180_10004964All Organisms → cellular organisms → Bacteria7390Open in IMG/M
3300012952|Ga0163180_10009789All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Chloroflexi incertae sedis → SAR202 cluster → SAR202 cluster bacterium5338Open in IMG/M
3300012952|Ga0163180_10531516All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Chloroflexi incertae sedis → SAR202 cluster → SAR202 cluster bacterium884Open in IMG/M
3300012953|Ga0163179_11919937All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Chloroflexi incertae sedis → SAR202 cluster → SAR202 cluster bacterium543Open in IMG/M
3300012954|Ga0163111_11096050All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Chloroflexi incertae sedis → SAR202 cluster → SAR202 cluster bacterium773Open in IMG/M
3300017720|Ga0181383_1033532All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Chloroflexi incertae sedis → SAR202 cluster → SAR202 cluster bacterium1383Open in IMG/M
3300017720|Ga0181383_1058249All Organisms → Viruses → Predicted Viral1037Open in IMG/M
3300017746|Ga0181389_1081596All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Chloroflexi incertae sedis → SAR202 cluster → SAR202 cluster bacterium907Open in IMG/M
3300017768|Ga0187220_1152814All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Chloroflexi incertae sedis → SAR202 cluster → SAR202 cluster bacterium697Open in IMG/M
3300017773|Ga0181386_1195491All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Chloroflexi incertae sedis → SAR202 cluster → SAR202 cluster bacterium609Open in IMG/M
3300017773|Ga0181386_1240549All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Chloroflexi incertae sedis → SAR202 cluster → SAR202 cluster bacterium537Open in IMG/M
3300017779|Ga0181395_1219072All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Chloroflexi incertae sedis → SAR202 cluster → SAR202 cluster bacterium587Open in IMG/M
3300017951|Ga0181577_10041188Not Available3318Open in IMG/M
3300017985|Ga0181576_10892312All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Chloroflexi incertae sedis → SAR202 cluster → SAR202 cluster bacterium521Open in IMG/M
3300020251|Ga0211700_1017432All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Chloroflexi incertae sedis → SAR202 cluster → SAR202 cluster bacterium804Open in IMG/M
3300020312|Ga0211542_1023798All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Chloroflexi incertae sedis → SAR202 cluster → SAR202 cluster bacterium1262Open in IMG/M
3300020348|Ga0211600_1009847Not Available3045Open in IMG/M
3300020348|Ga0211600_1042848All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Chloroflexi incertae sedis → SAR202 cluster → SAR202 cluster bacterium1118Open in IMG/M
3300020353|Ga0211613_1004374Not Available3247Open in IMG/M
3300020403|Ga0211532_10170983All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Chloroflexi incertae sedis → SAR202 cluster → SAR202 cluster bacterium881Open in IMG/M
3300020409|Ga0211472_10110878All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Chloroflexi incertae sedis → SAR202 cluster → SAR202 cluster bacterium1086Open in IMG/M
3300020410|Ga0211699_10086709All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Chloroflexi incertae sedis → SAR202 cluster → SAR202 cluster bacterium1159Open in IMG/M
3300020410|Ga0211699_10092747All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Chloroflexi incertae sedis → SAR202 cluster → SAR202 cluster bacterium1119Open in IMG/M
3300020411|Ga0211587_10409479All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Chloroflexi incertae sedis → SAR202 cluster → SAR202 cluster bacterium549Open in IMG/M
3300020417|Ga0211528_10207362All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Chloroflexi incertae sedis → SAR202 cluster → SAR202 cluster bacterium751Open in IMG/M
3300020438|Ga0211576_10000717All Organisms → cellular organisms → Bacteria27289Open in IMG/M
3300020438|Ga0211576_10215619All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Chloroflexi incertae sedis → SAR202 cluster → SAR202 cluster bacterium1018Open in IMG/M
3300020439|Ga0211558_10186682All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Chloroflexi incertae sedis → SAR202 cluster → SAR202 cluster bacterium992Open in IMG/M
3300020442|Ga0211559_10002374All Organisms → cellular organisms → Bacteria10787Open in IMG/M
3300020442|Ga0211559_10025417All Organisms → Viruses → Predicted Viral2976Open in IMG/M
3300020442|Ga0211559_10118083All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Chloroflexi incertae sedis → SAR202 cluster → SAR202 cluster bacterium1272Open in IMG/M
3300020442|Ga0211559_10272541All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Chloroflexi incertae sedis → SAR202 cluster → SAR202 cluster bacterium791Open in IMG/M
3300020442|Ga0211559_10283932All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Chloroflexi incertae sedis → SAR202 cluster → SAR202 cluster bacterium773Open in IMG/M
3300020451|Ga0211473_10000979All Organisms → cellular organisms → Bacteria14744Open in IMG/M
3300020452|Ga0211545_10134927All Organisms → cellular organisms → Bacteria1152Open in IMG/M
3300020454|Ga0211548_10145056All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Chloroflexi incertae sedis → SAR202 cluster → SAR202 cluster bacterium1144Open in IMG/M
3300020457|Ga0211643_10196108All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Chloroflexi incertae sedis → SAR202 cluster → SAR202 cluster bacterium993Open in IMG/M
3300020460|Ga0211486_10101865All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Chloroflexi incertae sedis → SAR202 cluster → SAR202 cluster bacterium1287Open in IMG/M
3300020461|Ga0211535_10444392All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Chloroflexi incertae sedis → SAR202 cluster → SAR202 cluster bacterium591Open in IMG/M
3300020470|Ga0211543_10047457All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Chloroflexi incertae sedis → SAR202 cluster → SAR202 cluster bacterium2282Open in IMG/M
3300020470|Ga0211543_10263048All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Chloroflexi incertae sedis → SAR202 cluster → SAR202 cluster bacterium843Open in IMG/M
3300020470|Ga0211543_10275970All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Chloroflexi incertae sedis → SAR202 cluster → SAR202 cluster bacterium820Open in IMG/M
3300020470|Ga0211543_10610644All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Chloroflexi incertae sedis → SAR202 cluster → SAR202 cluster bacterium511Open in IMG/M
3300020474|Ga0211547_10008970All Organisms → cellular organisms → Bacteria5848Open in IMG/M
3300020474|Ga0211547_10147848All Organisms → Viruses → Predicted Viral1218Open in IMG/M
3300020474|Ga0211547_10302815All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Chloroflexi incertae sedis → SAR202 cluster → SAR202 cluster bacterium811Open in IMG/M
3300020475|Ga0211541_10274139All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Chloroflexi incertae sedis → SAR202 cluster → SAR202 cluster bacterium825Open in IMG/M
3300024344|Ga0209992_10005130All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Chloroflexi incertae sedis → SAR202 cluster → SAR202 cluster bacterium9856Open in IMG/M
3300024344|Ga0209992_10020450All Organisms → Viruses → Predicted Viral3594Open in IMG/M
3300024344|Ga0209992_10039169All Organisms → Viruses → Predicted Viral2341Open in IMG/M
3300024344|Ga0209992_10115886All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Chloroflexi incertae sedis → SAR202 cluster → SAR202 cluster bacterium1189Open in IMG/M
3300025084|Ga0208298_1101815All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Chloroflexi incertae sedis → SAR202 cluster → SAR202 cluster bacterium520Open in IMG/M
3300025103|Ga0208013_1112243All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Chloroflexi incertae sedis → SAR202 cluster → SAR202 cluster bacterium678Open in IMG/M
3300025128|Ga0208919_1107772All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Chloroflexi incertae sedis → SAR202 cluster → SAR202 cluster bacterium892Open in IMG/M
3300025128|Ga0208919_1170211All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Chloroflexi incertae sedis → SAR202 cluster → SAR202 cluster bacterium666Open in IMG/M
3300025138|Ga0209634_1201701All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Chloroflexi incertae sedis → SAR202 cluster → SAR202 cluster bacterium760Open in IMG/M
3300025151|Ga0209645_1001375All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Chloroflexi incertae sedis → SAR202 cluster → SAR202 cluster bacterium12227Open in IMG/M
3300027779|Ga0209709_10062107Not Available2100Open in IMG/M
3300027801|Ga0209091_10012746Not Available5755Open in IMG/M
3300027906|Ga0209404_10022635All Organisms → Viruses → Predicted Viral3461Open in IMG/M
3300029293|Ga0135211_1003513All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Chloroflexi incertae sedis → SAR202 cluster → SAR202 cluster bacterium1139Open in IMG/M
3300029293|Ga0135211_1007488All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Chloroflexi incertae sedis → SAR202 cluster → SAR202 cluster bacterium943Open in IMG/M
3300029293|Ga0135211_1019000All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Chloroflexi incertae sedis → SAR202 cluster → SAR202 cluster bacterium748Open in IMG/M
3300029319|Ga0183748_1011284Not Available3678Open in IMG/M
3300029319|Ga0183748_1044193All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Chloroflexi incertae sedis → SAR202 cluster → SAR202 cluster bacterium1313Open in IMG/M
3300029319|Ga0183748_1045734All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Chloroflexi incertae sedis → SAR202 cluster → SAR202 cluster bacterium1277Open in IMG/M
3300029787|Ga0183757_1003320All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Chloroflexi incertae sedis → SAR202 cluster → SAR202 cluster bacterium5921Open in IMG/M
3300031580|Ga0308132_1109666All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Chloroflexi incertae sedis → SAR202 cluster → SAR202 cluster bacterium567Open in IMG/M
3300031774|Ga0315331_10298473All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Chloroflexi incertae sedis → SAR202 cluster → SAR202 cluster bacterium1188Open in IMG/M
3300032151|Ga0302127_10214288All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Chloroflexi incertae sedis → SAR202 cluster → SAR202 cluster bacterium844Open in IMG/M



 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
MarineEnvironmental → Aquatic → Marine → Unclassified → Unclassified → Marine41.18%
MarineEnvironmental → Aquatic → Marine → Oceanic → Unclassified → Marine26.47%
Deep SubsurfaceEnvironmental → Aquatic → Marine → Volcanic → Unclassified → Deep Subsurface7.84%
SeawaterEnvironmental → Aquatic → Marine → Strait → Unclassified → Seawater6.86%
SeawaterEnvironmental → Aquatic → Marine → Oceanic → Unclassified → Seawater3.92%
MarineEnvironmental → Aquatic → Marine → Oceanic → Photic Zone → Marine2.94%
Marine HarborEnvironmental → Aquatic → Marine → Harbor → Unclassified → Marine Harbor2.94%
Salt MarshEnvironmental → Aquatic → Marine → Intertidal Zone → Salt Marsh → Salt Marsh1.96%
Marine WaterEnvironmental → Aquatic → Marine → Oceanic → Unclassified → Marine Water0.98%
Surface SeawaterEnvironmental → Aquatic → Marine → Oceanic → Photic Zone → Surface Seawater0.98%
Marine Surface WaterEnvironmental → Aquatic → Marine → Coastal → Unclassified → Marine Surface Water0.98%
SeawaterEnvironmental → Aquatic → Marine → Intertidal Zone → Unclassified → Seawater0.98%
Marine SedimentEnvironmental → Aquatic → Marine → Hydrothermal Vents → Sediment → Marine Sediment0.98%
Volcanic Co2 Seep SeawaterEnvironmental → Aquatic → Marine → Volcanic → Unclassified → Volcanic Co2 Seep Seawater0.98%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
3300002231Marine sediment microbial communities from Santorini caldera mats, Greece - red matEnvironmentalOpen in IMG/M
3300005057Marine water microbial communities from the East Sea, Korea with extracellular vesicles - East-Sea-0.2umEnvironmentalOpen in IMG/M
3300005433Marine microbial and viral communities from oxygen minimum zone, Eastern Pacific Ocean - ETNP201306PF45BEnvironmentalOpen in IMG/M
3300005837Exploring phylogenetic diversity in Port Hacking ocean in Sydney, Australia - Port Hacking PH4 TJ4-TJ18EnvironmentalOpen in IMG/M
3300006332Marine microbial communities from North Pacific Subtropical Gyre, Station ALOHA - HOT238_1_0200mEnvironmentalOpen in IMG/M
3300006565Marine microbial communities from North Pacific Subtropical Gyre, Station ALOHA - HOT231_2_0125mEnvironmentalOpen in IMG/M
3300006735Marine viral communities from the Subarctic Pacific Ocean - 5B_ETSP_OMZ_AT15132_CsCl metaGEnvironmentalOpen in IMG/M
3300006789Marine viral communities from the Subarctic Pacific Ocean - 16_ETSP_OMZ_AT15313 metaGEnvironmentalOpen in IMG/M
3300006793Marine viral communities from the Subarctic Pacific Ocean - 17_ETSP_OMZ_AT15314 metaGEnvironmentalOpen in IMG/M
3300006921Marine viral communities from the Subarctic Pacific Ocean - 21_ETSP_OMZ_AT15319 metaGEnvironmentalOpen in IMG/M
3300006929Marine viral communities from the Subarctic Pacific Ocean - 4_ETSP_OMZ_AT15127 metaGEnvironmentalOpen in IMG/M
3300007116Seawater microbiome, Papua New Guinea CO2 seep, Upa-Upasina 'bubble' site, waterEBis3EnvironmentalOpen in IMG/M
3300007963Marine viral communities from the Subarctic Pacific Ocean - 4_ETSP_OMZ_AT15127 metaG (version 2)EnvironmentalOpen in IMG/M
3300009420Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB2_152EnvironmentalOpen in IMG/M
3300009425Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB4_136EnvironmentalOpen in IMG/M
3300009481Deep subsurface microbial communities from Kolumbo volcano to uncover new lineages of life (NeLLi) - 2SBTROV12_ACTIVE470 metaGEnvironmentalOpen in IMG/M
3300009543Marine eukaryotic communities from Pacific Ocean to study complex ecological interactions - MBTS_20Mar14_M2_3um Metatranscriptome (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300009593Marine eukaryotic phytoplankton communities from Atlantic Ocean - Tropical Atlantic ANT8 MetagenomeEnvironmentalOpen in IMG/M
3300009608Marine eukaryotic communities from Pacific Ocean to study complex ecological interactions - MBTS_2Apr14_M1_3um Metatranscriptome (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300009679Marine eukaryotic communities from Pacific Ocean to study complex ecological interactions - CN13ID_155_C17_100m_0.8um Metatranscriptome (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300010149Marine viral communities from the Subarctic Pacific Ocean - 13B_ETSP_OMZ_AT15268_CsCl metaGEnvironmentalOpen in IMG/M
3300010150Marine viral communities from the Subarctic Pacific Ocean - 17B_ETSP_OMZ_AT15314_CsCl metaGEnvironmentalOpen in IMG/M
3300011303Seawater microbial communities from Saanich Inlet, British Columbia, Canada - KN S21 DCM_B metaT (Metagenome Metatranscriptome) (version 2)EnvironmentalOpen in IMG/M
3300012952Marine eukaryotic phytoplankton communities from the Atlantic Ocean - Atlantic ANT 4 MetagenomeEnvironmentalOpen in IMG/M
3300012953Marine eukaryotic phytoplankton communities from the Atlantic Ocean - Atlantic ANT 2 MetagenomeEnvironmentalOpen in IMG/M
3300012954Marine microbial communities from the Costa Rica Dome - CRUD Field 142mm St18 metaGEnvironmentalOpen in IMG/M
3300017720Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 6 SPOT_SRF_2009-12-23EnvironmentalOpen in IMG/M
3300017746Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 12 SPOT_SRF_2010-06-29EnvironmentalOpen in IMG/M
3300017768Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 6 SPOT_SRF_2009-12-23 (version 2)EnvironmentalOpen in IMG/M
3300017773Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 9 SPOT_SRF_2010-03-24EnvironmentalOpen in IMG/M
3300017779Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 18 SPOT_SRF_2010-12-16EnvironmentalOpen in IMG/M
3300017951Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 101413BT metaG (megahit assembly)EnvironmentalOpen in IMG/M
3300017985Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 101412BT metaG (megahit assembly)EnvironmentalOpen in IMG/M
3300020251Marine microbial communities from Tara Oceans - TARA_B100000519 (ERX555940-ERR599040)EnvironmentalOpen in IMG/M
3300020312Marine microbial communities from Tara Oceans - TARA_B100000287 (ERX556125-ERR598977)EnvironmentalOpen in IMG/M
3300020348Marine microbial communities from Tara Oceans - TARA_B100000676 (ERX556089-ERR599161)EnvironmentalOpen in IMG/M
3300020353Marine microbial communities from Tara Oceans - TARA_B100000686 (ERX556093-ERR598998)EnvironmentalOpen in IMG/M
3300020403Marine microbial communities from Tara Oceans - TARA_B100000085 (ERX556015-ERR599145)EnvironmentalOpen in IMG/M
3300020409Marine microbial communities from Tara Oceans - TARA_A100001403 (ERX555912-ERR599106)EnvironmentalOpen in IMG/M
3300020410Marine microbial communities from Tara Oceans - TARA_B100000519 (ERX555959-ERR599148)EnvironmentalOpen in IMG/M
3300020411Marine microbial communities from Tara Oceans - TARA_B100000131 (ERX556098-ERR599130)EnvironmentalOpen in IMG/M
3300020417Marine microbial communities from Tara Oceans - TARA_B100000073 (ERX556034-ERR599082)EnvironmentalOpen in IMG/M
3300020438Marine microbial communities from Tara Oceans - TARA_B100001094 (ERX555907-ERR598942)EnvironmentalOpen in IMG/M
3300020439Marine microbial communities from Tara Oceans - TARA_B100001939 (ERX556062-ERR599029)EnvironmentalOpen in IMG/M
3300020442Marine microbial communities from Tara Oceans - TARA_B100002019 (ERX556121-ERR599162)EnvironmentalOpen in IMG/M
3300020451Marine microbial communities from Tara Oceans - TARA_B100001778 (ERX555927-ERR598996)EnvironmentalOpen in IMG/M
3300020452Marine microbial communities from Tara Oceans - TARA_B100001173 (ERX556054-ERR599078)EnvironmentalOpen in IMG/M
3300020454Marine microbial communities from Tara Oceans - TARA_B100001769 (ERX556037-ERR599170)EnvironmentalOpen in IMG/M
3300020457Marine microbial communities from Tara Oceans - TARA_B100001113 (ERX555941-ERR599014)EnvironmentalOpen in IMG/M
3300020460Marine microbial communities from Tara Oceans - TARA_A100001037 (ERX555931-ERR599097)EnvironmentalOpen in IMG/M
3300020461Marine microbial communities from Tara Oceans - TARA_B100000401 (ERX556127-ERR599150)EnvironmentalOpen in IMG/M
3300020470Marine microbial communities from Tara Oceans - TARA_B100000287 (ERX555976-ERR599053)EnvironmentalOpen in IMG/M
3300020474Marine prokaryotic communities collected during Tara Oceans survey from station TARA_151 - TARA_B100001564 (ERX555957-ERR598976)EnvironmentalOpen in IMG/M
3300020475Marine microbial communities from Tara Oceans - TARA_B100002029 (ERX555951-ERR599001)EnvironmentalOpen in IMG/M
3300024344Deep subsurface microbial communities from Kolumbo volcano to uncover new lineages of life (NeLLi) - 2SBTROV12_ACTIVE470 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025084Marine viral communities from the Subarctic Pacific Ocean - 14B_ETSP_OMZ_AT15311_CsCl metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025103Marine viral communities from the Subarctic Pacific Ocean - 16_ETSP_OMZ_AT15313 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025128Marine viral communities from the Subarctic Pacific Ocean - 4_ETSP_OMZ_AT15127 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025138Marine viral communities from the Pacific Ocean - LP-40 (SPAdes)EnvironmentalOpen in IMG/M
3300025151Marine viral communities from the Pacific Ocean - ETNP_6_30 (SPAdes)EnvironmentalOpen in IMG/M
3300027779Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB4_136 (SPAdes)EnvironmentalOpen in IMG/M
3300027801Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB8_128 (SPAdes)EnvironmentalOpen in IMG/M
3300027906Marine eukaryotic phytoplankton communities from Atlantic Ocean - Tropical Atlantic ANT8 Metagenome (SPAdes)EnvironmentalOpen in IMG/M
3300029293Marine harbor viral communities from the Indian Ocean - SCH2EnvironmentalOpen in IMG/M
3300029319Marine viral communities collected during Tara Oceans survey from station TARA_032 - TARA_A100001516EnvironmentalOpen in IMG/M
3300029787Marine viral communities collected during Tara Oceans survey from station TARA_018 - TARA_A100000172EnvironmentalOpen in IMG/M
3300031580Metatranscriptome of marine microbial communities from Western Arctic Ocean, Canada - CB21_1111_SCM (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300031774Ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M1 60m 34915EnvironmentalOpen in IMG/M
3300032151Marine microbial communities from Western Arctic Ocean, Canada - CB4_SCMEnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap



 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
KVRMV2_10167320313300002231Marine SedimentSLMKISQKVEFGQISHTYLSSWKSDNEVELHNGDDVVLFTMTEEVMAQLHKKLGDKLTQIASERLEEAKSLSEGETESE*
Ga0068511_107980523300005057Marine WaterMKISQTVDFGQISHTYLSSWKSDNEVELYAGDDKVVFTMSEEVMKQLHKKLGDKLTELAASRIEEAHKLTQEESSEDE*
Ga0066830_1010680613300005433MarineMKISKKIEVGQIDHTYLSSWKSDNEVELHKDDDVVVFTMTEEVMAQLHKKLGDKLTQLATERLEAAKELAQEESSDDE*
Ga0078893_1211231353300005837Marine Surface WaterMKISKKIEIGQIDHTYMSSWKDDNEVELYKGDDTVVFTMSEDVMKQLHKKLGDKLTAIANERLEEAKQLAQGDAEDE*
Ga0068500_1103750133300006332MarineMQISQTVDFGQISHTYMSTWKDNNEVELYAGEDKVVFTMSEEVMKQLHKKLGDKLTELAAARLEDAQKLTLDGETENE*
Ga0068500_111414923300006332MarineMKISQTIEVGQVNTTYVSSWKSDNEVELYAGDDKVVFTMSEEVMKQLHKKLGEKLTQIADERLDEAQQMMKEESSEDE*
Ga0100228_103674033300006565MarineMKISQTVDFGQISHTYLSTWKSDNEVELYAGEDKVVFTMSEETMKQLHKKLGEKLTQIAADRVEDAHKLAQEESSDDE*
Ga0098038_110226223300006735MarineMEIHKKIVVGQIDHTYLSSWKSDNEVELHRGNDVVMFTMTEDVMEQLHKKLGDKLTKLAAERLEAAQQLAQEEPSEDE*
Ga0098054_101680543300006789MarineMKISQTIEVGQITSTYLSTWKSDNEVELHAGEDKVVFTMSEEVMKQLHKKLGDKLTSLAAERIEEAMKVAQEEQSEDE*
Ga0098054_125823923300006789MarineMEIHKKIVVGQIDHTYLSSWKSDNEVELHRGNDVVMFTMTEDVMEQLHKKLGDKLTTLAAERLEAAQQLAQEEPSEDE*
Ga0098055_125762713300006793MarineMKISQTVDFGQISHTYLSTWKSDNEVELYAGEDKVVFTMSEETMKQLHKKLGEKLTSIAADRIEEAHKLAQEEPELDE*
Ga0098060_112613413300006921MarineHTYLSSWKSDNEVELHKGNDIVMFTMTEEVMTQLHKKLGDKLTKIAAERLEQARELAQEESSEDE*
Ga0098060_119501623300006921MarineMKISQTVEFGQVDSTYLSTWKSDNEIELRNGEDKVVFTVSEEVMKQLHKKLGDKLTDIAQKRLQEAQQLAEESSEDE*
Ga0098036_104589023300006929MarineMKISQTVDFGQVSHSYVSSWKSDNEVELFEGENKVVFTMSEEVMSQLHKKLGEKLTQISDERIAEAKSLSEGATEGE*
Ga0101667_105165913300007116Volcanic Co2 Seep SeawaterMKISKKIEIGQIDHTYMSSWKDDNEVELYKGDDTVVFTMSEDVMKQLHKKLGDKLTELAAARLEDAH
Ga0110931_113242723300007963MarineMEIHKKIVVGRIDHTYLSSWKSDNEVELHKGNDVVMFTMTEEVMEQLHKKLGDKLTQIANERLEAAKELAQEESSEDE*
Ga0114994_1003840023300009420MarineMKISQTVDFGQVDQTYLSGWKADNEIEIRRGEDKVIFTMSEEVMKQLHKKLGVKLTSNAAERLAQAKELAQEQSEDE*
Ga0114997_1061153723300009425MarineMKISQTVDFGQVENTFVSTWKSDNEIELRKGEDKVIFTMSEEVMKQLHKRLGDKLTSVAAERLAQAKELAQEQSEDE*
Ga0114932_1003409723300009481Deep SubsurfaceMKISQKIEVGQIDHTYVSSWKSDNEVELHKDDDVVVFTMTEEVMTQLHKKLGEKLTSIATERLEAAQSLSEGETEVE*
Ga0114932_1013537433300009481Deep SubsurfaceMEIHKKIVFGRIDHTYLSSWKSDNEVELHKGNDVVMFTMTEEVMGQLHKKLGDKLTQIANERLEAAQQLTQEESSEDE*
Ga0114932_1018540523300009481Deep SubsurfaceMKISQKVEFGQISHTYLSSWKSDNEVELHNGDDVVLFTMTEEVMAQLHKKLGDKLTQIASERLEEAKSLSEGETESE*
Ga0114932_1027882923300009481Deep SubsurfaceMKISQTVDFGQISHTYLSTWKSDNEVELHAGENKVVFTMSEEVMAQLHKKLGDKLTSIAAERLEAAQQLAQEESSEDE*
Ga0115099_1020631323300009543MarineMEIHKKIVVGQIDHTYLSSWKSDNEVELHKGNDVVMFQMSEEVMEQLHKKLGDKLTKLAAERLEAAQKLAEEQEGEVLEDE*
Ga0115099_1068273813300009543MarineMEIHKKIVVGQIDHTYLSSWKSDNEVELHKGNDVVMFTMTEEVMQQLHKKLGDKLTQIANERLEAAKELAQEESSEDE*
Ga0115099_1071418623300009543MarineMEIHKKIVVGQIDHTYLSSWKSDNEVELHKGNDIVMFTMTEEVMTQLHKKLGDKLTKIAAERLEQARELAQEESSEDE*
Ga0115011_1028537133300009593MarineMEIHKKIVFGRIDHTYLSSWKSDNEVELHKGNDVVMFTMTEEVMEQLHKKLGDKLTQIANERLEAAQQLAQEESSEDE*
Ga0115011_1047644533300009593MarineMKISQTVDFGQISHTYVSTWKSDNEVELYAGEDKVVFTMSEETMKQLHKKLGEKLTNIAADRIEEAHKLAQEEQSEDE*
Ga0115100_1120770613300009608MarineLMEIHKKIVVGQIDHTYLSSWKSDNEVELHKGNDIVMFTMTEEVMTQLHKKLGDKLTKIAAERLEQARELAQEESSEDE*
Ga0115105_1128182623300009679MarineMKISQTVDFGQISHTYMSTWKDNNEVELFKDEDKIVFTMSEETMKQFHKKLGDKLTELAASRIEEAHKIAQEELSEDE*
Ga0098049_118853523300010149MarineMKISQTIEVGQITSTYLSTWKSDNEVELHAGEDKVVFTMSEEVMKQLHKKLGDKLTSLAAERIEEAMKVAQE
Ga0098056_112389813300010150MarineLMEIHKKIVVGQIDHTYLSSWKSDNEVELHRGNDVVMFTMTEDVMEQLHKKLGDKLTKLAAERLEAAQQLAQEEPSEDE*
Ga0138405_110168423300011303MarineMKISQRIEVGQIGHTYVSSWKSDNEVELHAGDDVVTFSMTEDVMTQLHKKLGDKLTQIASERLEEAKSLAQEEPSEDE*
Ga0163180_1000496483300012952SeawaterMKISQTVDFGQISHTYVSTWKSDNEVELYAGEDKVVFTMSEEVMKQLHKKLGDKLTELAASRVEEAHKVAQEESSEDE*
Ga0163180_10009789123300012952SeawaterMKISKKIEVGQIDHTYMSTWKDDNEVELFKGDDCVVFTMSEEVMKQLHKKLGDKLTELAAARIEDAHKLAQQESSDDE*
Ga0163180_1053151633300012952SeawaterMEIHKKIVVGQIDHTYLSSWKSDNEVELHKGNDVVMFQMSEEVMEQLHKKLGDKLTKLAAERLEAAQQLAQEEVSEDE
Ga0163179_1191993723300012953SeawaterMKISQTVDFGQISHTYLSSWKSDNEVELHAGEDKVVFTMSEEVMAQLHKKLGDKLTSIAAERLEAAQQLAQEESSEDE*
Ga0163111_1109605013300012954Surface SeawaterGQISHTYLSTWKSDNEVELYAGEDKVVFTMSEETMKQLHKKLGEKLTSIAADRIEEAHKLAQEEPELDD*
Ga0181383_103353233300017720SeawaterMEIHKKIVVGQIDHTYLSSWKSDNEVELHKGNDVVMFTMTEEVMQQLHKKLGDKLTQIANERLEAAKELAQEESSEDE
Ga0181383_105824923300017720SeawaterMEIHKKIVVGQIDHTYLSSWKSDNEVELHRGNDVVMFTMTEDVMQQLHKKLGDKLTQIANERLEAA
Ga0181389_108159623300017746SeawaterMKISQTVEFGQVDSTYLSTWKSDNEIELRSGEDKVVFTMSEEVMKLLHKKLGDKLTSIAAERLEQARELAQEESSEDE
Ga0187220_115281413300017768SeawaterMEIHKKIVVGQIDHTYLSSWKSDNEVELHRGNDVVMFTMTEDVMQQLHKKLGDKLTQIANERLEAAKELAQEESSE
Ga0181386_119549123300017773SeawaterMEIHKKIVVGQIDHTYLSSWKSDNEVELHRGNDVVMFTMTEDVMQQLHKKLGDKLTQIANERLEAAKELAQEESSEDE
Ga0181386_124054933300017773SeawaterMEIHKKIVVGQIDHTYLSSWKSDNEVELHKGNDVVMFTMTEEVMEQLHKKLGDKLTKLAAERLEAAQKLAEEQEGEVLEDE
Ga0181395_121907223300017779SeawaterMEIHKKIVVGQIDHTYLSSWKSDNEVELHKGNDIVMFTMTEEVMTQLHKKLGDKLTKIAAERLEQ
Ga0181577_1004118843300017951Salt MarshMKISQKIEVGQIDHTYLSSWKSDNEVELHKGDDVVVFTMTEEVMTQLHKKLGDKLTNIANERIEAAKQLAQEESSSDE
Ga0181576_1089231223300017985Salt MarshMKISQKIEVGQIDHTYLSSWKSDNEVELHKGDDVVVFTMTEEVMTQLHKKLGDKLTNIANERIEAAKQLAQEESS
Ga0211700_101743213300020251MarineMKISKKIELGQIDHTYLSSWKSDNEVELHKNDDVVVFTMTEEVMAQLHKKLGEKLTSLAADRIEEAHKLAQEESSEDE
Ga0211542_102379833300020312MarineMKISQTVDFGQISHTYMSTWKDDNEVELYAGEDKVVFTMSEEVMKQLHKKLGDKLTELAAARLEDAQKIAQEESSEDE
Ga0211600_100984743300020348MarineMKISQTIEVGQITTTYISSWKSDNEVELYAGDDKVVFTMSEEVMKQLHKKLGDRLTELAASRIEEAHKLAQEESSSDE
Ga0211600_104284833300020348MarineMKISQTIEVGQITAAYVSSWKSDNEVELYAGDDKLVFSMSEEVMKQLHKKLGDKLTQNAHERLEEAKQLAQEESSDDE
Ga0211613_100437443300020353MarineMKISQKVEFGQIDHTYLSSWKSDNEVELHNGDDVVLFTMTEEVMAQLHKKLGDKLTQIASERLEEAKQLADGESESE
Ga0211532_1017098333300020403MarineMKISQKVELGQIDHTYVSSWSSSNEVELHKGDNSVTFSMSEDCLISFHKKLGDKLTNIAAERLEAAKELAKKESSDDE
Ga0211472_1011087823300020409MarineMKISKKIEIGQIDHTYMSSWKDDNEVELYKGDDTVVFTMSEDVMKQLHKKLGDKLTELAAARLEDAHKLAQQESSDDE
Ga0211699_1008670923300020410MarineMKISQKIEVGQIDHTYLSSWKSDNEVELHKDDDVVVFTMTEEVMKQLHKKLGEKLTSLAADRIEEAHKLAQEESSEDE
Ga0211699_1009274713300020410MarineMKISQKIEVGQIDHTYLSSWKSDNEVELHKNDDVVVFTMTEEVMAQLHKKLGDKLTQIAAERLEEAKSLSEGETAVE
Ga0211587_1040947913300020411MarineMKISQTIEVGQINTTYVSSWKSDNEVELYAGDDKVVFTMSEEVMKQLHKKLGDKLTEIAASRIEEAHKLAQEE
Ga0211528_1020736223300020417MarineMKISQTVDFGQVSHTYLSTWKSDNEVELYAGEDKVVFTMSEDTMKQLHKKLGEKLTQLAADRIEEAHKVAQEESSEDE
Ga0211576_10000717363300020438MarineMEIHKKIVVGQIDHTYLSSWKSDNEVELHKGNDIVMFTMTEEVMTQLHKKLGDKLTKIAAERLEQARELAQEESSEDE
Ga0211576_1021561913300020438MarineMEIHKKIVVGQIDHTYLSSWKSDNEVELHKGNDVVMFQMSEEVMEQLHKKLGDKLTKLAAERLEAAQKLAEEQEGEVLEDE
Ga0211558_1018668233300020439MarineMKISKRIEVGQIGHTYVSSWKSDNEVELHAGDDVVTFSMTEEVMAQLHKKLGDKLTQLAHERFEAAKELLP
Ga0211559_10002374223300020442MarineMKISQKVEFGQIDHTYLSSWKSDNEVELHKGDDVVMFTMTEEVMAQLHKKLGDKLTQIAAERLEAAKELAQKESEDE
Ga0211559_1002541763300020442MarineMKISQKIEVGQIDHTYVSSWKSDNEVELHKGDDTVVFSMTEETMTQLHKKLGDKLTAIANERLEEAKQLAQGDVEDE
Ga0211559_1011808323300020442MarineMKISQKVEFGQISHTYVSSWKSDNEVELHNGDDVVLFTMTEEVMEQLHKKLGDKLTQLATERLEAAKELAHKEPSEDE
Ga0211559_1027254133300020442MarineMKISQTIEVGQIDHTYMSSWKNDNEVELYAGDDKVVFTMSEEVMKQLHKKLGDKLTEVAASRIEEAHKLALQESPEDE
Ga0211559_1028393223300020442MarineMKISQKIEVGQIDHTYVSSWKSDNEVELHKGDDTVVFTMSEEVMTQLHKKLGDKLTQIATERLEAAQSLSEGETSE
Ga0211473_10000979283300020451MarineVLGLRATATSQHFKESLMEIHKKIVFGRIDHTYLSSWKSDNEVELHKGNDVVMFTMTEEVMKQLHKKLGDKLTQIANERLEAAQQLAQEESSEDE
Ga0211545_1013492733300020452MarineTYLSSWKSDNEVELHKGNDVVMFTMTEEVMKQLHKKLGDKLTQIANERLEAAQQLAQEESSEDE
Ga0211548_1014505633300020454MarineMEIHKKIVFGRIDHTYLSSWKSDNEVELHKGNDVVMFTMTEEVMKQLHKKLGDKLTQIANERLEAAQQLAQEESSEDE
Ga0211643_1019610823300020457MarineMKISQTVDFGQISHTYLSTWKSDNEVELYAGEDKVVFTMSEETMKQLHKKLGEKLTSIAADRIEEAHKLAQEEPELDE
Ga0211486_1010186523300020460MarineMKISQKVEFGQISHTYLSSWKSDNEVELHNGDDVVLFTMTEEVMAQLHKKLGDKLTQIASERLEEAKQLADGESESE
Ga0211535_1044439223300020461MarineMKISQTVDFGQISHTYVSTWKSDNEVELYAGEDKVVFTMSEEVMKQLHKKLGDKLTELAASRVEEAHKLSQEESSDDE
Ga0211543_1004745753300020470MarineMKISQTIEVGQINTTYVSSWKSDNEVELYAGDDKVVFTMSEEVMKQLHKKLGDKLTEIAASRIEEAHKLAQEESSSDE
Ga0211543_1026304823300020470MarineMKISQTIEVGQINTTYVSSWKSDNEVELYAGDDKVVFTMSEEVMKQLHKKLGEKLTQLASERFEAAKELLPQEELSEDE
Ga0211543_1027597013300020470MarineMKISKKIEFGQIDHTYLSSWKSDNEVELHKDDDVIMFTMTEEVMAQLHKKLGDKLTQLATERLEAAKQL
Ga0211543_1061064423300020470MarineMKISQTVDFGQISHTYMSTWKDDNEVELYAGEDKVVFTMSEEVMKQLHKKLGDKLTELAAARLEDAQKIAQQESSEDE
Ga0211547_1000897093300020474MarineMKISQTVDFGQISHTYMSTWKDNNEVELFKDEDKIVFTMSEETMKQFHKKLGDKLTELAASRIEEAHKIAQEELSEDE
Ga0211547_1014784833300020474MarineMKISQTVDFGQISHSYVSTWKSDNEVELFEGENKVVFTMSEEVMSQLHKKLGEKLTQIAAERIAEAKSLSEGETEVE
Ga0211547_1030281523300020474MarineMKISQKVEFGQISHTYLSSWKSDNEVELHSGDDVVLFTMTEEVMAQLHKKLGDKLTQIASERLEEAKSLSEGETESE
Ga0211541_1027413913300020475MarineMKISQTVDFGQISHSYVSTWKSDNEVELFEGENKVVFTMSEEVMSQLHKKLGEKLTQIAAERIAEA
Ga0209992_1000513023300024344Deep SubsurfaceMKISQKIEVGQIDHTYVSSWKSDNEVELHKDDDVVVFTMTEEVMTQLHKKLGEKLTSIATERLEAAQSLSEGETEVE
Ga0209992_1002045033300024344Deep SubsurfaceMKISQKVEFGQISHTYLSSWKSDNEVELHNGDDVVLFTMTEEVMAQLHKKLGDKLTQIASERLEEAKSLSEGETESE
Ga0209992_1003916923300024344Deep SubsurfaceMEIHKKIVVGQIDHTYLSSWKSDNEVELHRGNDVVMFTMTEDVMEQLHKKLGDKLTKLAAERLEAAQQLAQEEPSEDE
Ga0209992_1011588623300024344Deep SubsurfaceMKISQTVDFGQISHTYLSTWKSDNEVELHAGENKVVFTMSEEVMAQLHKKLGDKLTSIAAERLEAAQQLAQEESSEDE
Ga0208298_110181523300025084MarineMKISQTIEVGQITSTYLSTWKSDNEVELHAGEDKVVFTMSEEVMKQLHKKLGDKLTQIANERLEAAKELAQEESSEDE
Ga0208013_111224323300025103MarineMKISQTIEVGQITSTYLSTWKSDNEVELHAGEDKVVFTMSEEVMKQLHKKLGDKLTSLAAERIEEAMKVAQEEQSEDE
Ga0208919_110777223300025128MarineMKISQTVEFGQVDSTYLSTWKSDNEIELRNGEDKVVFTVSEEVMKQLHKKLGDKLTDIAQKRLQEAQQLAEESSEDE
Ga0208919_117021113300025128MarineMKISQTVDFGQVSHSYVSSWKSDNEVELFEGENKVVFTMSEEVMSQLHKKLGEKLTQISDERIAEAKSLSEGATEGE
Ga0209634_120170113300025138MarineMQISQTVSFGQVENTFVSTWKSDNEIELRKGEDKVVFTMSEEVMKQLHKRLGDKLTSIAAERLAQAKELTQEQSENE
Ga0209645_1001375143300025151MarineMKISKKIEVGQIDHTYLSSWKSDNEVELHKDDDVVVFTMTEEVMAQLHKKLGDKLTQLATERLEAAKELAQEESSDDE
Ga0209709_1006210723300027779MarineMKISQTVDFGQVDQTYLSGWKADNEIEIRRGEDKVIFTMSEEVMKQLHKKLGVKLTSNAAERLAQAKELAQEQSEDE
Ga0209091_1001274683300027801MarineMKISQTVDFGQVENTFVSTWKSDNEIELRKGEDKVIFTMSEEVMKQLHKRLGDKLTSVAAERLAQAKELAQEQSEDE
Ga0209404_1002263523300027906MarineMKISQTVDFGQISHTYVSTWKSDNEVELYAGEDKVVFTMSEETMKQLHKKLGEKLTNIAADRIEEAHKLAQEEQSEDE
Ga0135211_100351333300029293Marine HarborMKISQKIEVGQIDHTYVSSWKSDNEVELHAGDDVVTFSMTEDVMTQLHKKLGDKLTQIASERLEEAKQLAQEESSDDE
Ga0135211_100748823300029293Marine HarborMKISQTIEVGQITTTYVSSWKSDNEVELYAGDDKVVFTMSEEVMKQLHKKLGDKLTELAAARIEEAHKLAQEESSEDE
Ga0135211_101900033300029293Marine HarborMKISQKVEFGQIDHTYLSSWKSDNEVELHKGDDVVMFTMTEEVMAQLHKKLGDKLTQIAAERLEAAKQLAQEESSDDE
Ga0183748_101128463300029319MarineMKISQTVDFGQISHSYVSTWKSDNEVELYAGEDKVVFTMSEEVMKQLHKKLGDKLTELAASRVEEAHKLAQEESSEDE
Ga0183748_104419323300029319MarineMKISQKIEVGQIDHTYLSSWKSDNELELHKGDDVVVFTMTEEVMTQLHKKLGDKLTQIAAERLEAAKQLAQEESSDDE
Ga0183748_104573423300029319MarineMKISKKIEVGQIDHTYLSSWKSENEVELHKDDDVVVFTMTEEVMAQLHKKLGDKLTQLATERLEAAKELAQEESSDDE
Ga0183757_100332043300029787MarineMKISQTVDFGQISHTYLSTWKSDNEVELHAGENKVVFTMSEEVMAQLHKKLGDKLTSLAAERLEAAQQLAQEESSEDE
Ga0308132_110966633300031580MarineMKISQTVDFGQVDQTYLSGWKADNEIEIRRGEDKVIFTMSEEVMKQLHKRLGDKLTSVAAERLAQAKELAQEQSEDE
Ga0315331_1029847323300031774SeawaterMEIHKKIVVGQIDHTYLSSWKSDNEIELHKGNDVVMFTMTEDVMEQLHKKLGDKLTKLAAERLEAAQQLAQEESSEDE
Ga0302127_1021428813300032151MarineMKISQTVDFGQVDQTYLSGWKADNEIEIRRGEDKVIFTMSEEVMKQLHKRLGDKLTSVAAERLAQAKELAQ


 ⦗Top⦘


© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.