| Basic Information | |
|---|---|
| Family ID | F101289 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 102 |
| Average Sequence Length | 48 residues |
| Representative Sequence | IDTTVAVSARATHRDDARAFIRYLLRPESNKVWKPKGLERFE |
| Number of Associated Samples | 92 |
| Number of Associated Scaffolds | 102 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Unclassified |
| % of genes with valid RBS motifs | 0.00 % |
| % of genes near scaffold ends (potentially truncated) | 0.00 % |
| % of genes from short scaffolds (< 2000 bps) | 0.00 % |
| Associated GOLD sequencing projects | 89 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.40 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Unclassified (100.000 % of family members) |
| NCBI Taxonomy ID | N/A |
| Taxonomy | N/A |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere (8.823 % of family members) |
| Environment Ontology (ENVO) | Unclassified (31.373 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Host-associated → Plant → Plant rhizosphere (45.098 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 51.43% β-sheet: 0.00% Coil/Unstructured: 48.57% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.40 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 102 Family Scaffolds |
|---|---|---|
| PF07859 | Abhydrolase_3 | 6.86 |
| PF04229 | GrpB | 5.88 |
| PF00903 | Glyoxalase | 2.94 |
| PF01738 | DLH | 2.94 |
| PF13180 | PDZ_2 | 2.94 |
| PF13360 | PQQ_2 | 2.94 |
| PF00027 | cNMP_binding | 1.96 |
| PF00285 | Citrate_synt | 0.98 |
| PF07586 | HXXSHH | 0.98 |
| PF13271 | DUF4062 | 0.98 |
| PF02321 | OEP | 0.98 |
| PF00480 | ROK | 0.98 |
| PF04214 | DUF411 | 0.98 |
| PF02518 | HATPase_c | 0.98 |
| PF13487 | HD_5 | 0.98 |
| PF13531 | SBP_bac_11 | 0.98 |
| PF07690 | MFS_1 | 0.98 |
| PF01070 | FMN_dh | 0.98 |
| PF13442 | Cytochrome_CBB3 | 0.98 |
| PF02577 | BFN_dom | 0.98 |
| PF06439 | 3keto-disac_hyd | 0.98 |
| PF01850 | PIN | 0.98 |
| PF13420 | Acetyltransf_4 | 0.98 |
| PF12706 | Lactamase_B_2 | 0.98 |
| PF04972 | BON | 0.98 |
| PF12770 | CHAT | 0.98 |
| PF08309 | LVIVD | 0.98 |
| PF13620 | CarboxypepD_reg | 0.98 |
| PF00892 | EamA | 0.98 |
| PF02775 | TPP_enzyme_C | 0.98 |
| PF03795 | YCII | 0.98 |
| PF01436 | NHL | 0.98 |
| PF13616 | Rotamase_3 | 0.98 |
| PF01063 | Aminotran_4 | 0.98 |
| PF13564 | DoxX_2 | 0.98 |
| COG ID | Name | Functional Category | % Frequency in 102 Family Scaffolds |
|---|---|---|---|
| COG0657 | Acetyl esterase/lipase | Lipid transport and metabolism [I] | 6.86 |
| COG2320 | GrpB domain, predicted nucleotidyltransferase, UPF0157 family | General function prediction only [R] | 5.88 |
| COG0115 | Branched-chain amino acid aminotransferase/4-amino-4-deoxychorismate lyase | Amino acid transport and metabolism [E] | 1.96 |
| COG1538 | Outer membrane protein TolC | Cell wall/membrane/envelope biogenesis [M] | 1.96 |
| COG1940 | Sugar kinase of the NBD/HSP70 family, may contain an N-terminal HTH domain | Transcription [K] | 1.96 |
| COG0069 | Glutamate synthase domain 2 | Amino acid transport and metabolism [E] | 0.98 |
| COG0372 | Citrate synthase | Energy production and conversion [C] | 0.98 |
| COG1259 | Bifunctional DNase/RNase | General function prediction only [R] | 0.98 |
| COG1304 | FMN-dependent dehydrogenase, includes L-lactate dehydrogenase and type II isopentenyl diphosphate isomerase | Energy production and conversion [C] | 0.98 |
| COG2350 | YciI superfamily enzyme, includes 5-CHQ dehydrochlorinase, contains active-site pHis | Secondary metabolites biosynthesis, transport and catabolism [Q] | 0.98 |
| COG3019 | Uncharacterized metal-binding protein, DUF411 family | Function unknown [S] | 0.98 |
| COG5276 | Uncharacterized secreted protein, contains LVIVD repeats, choice-of-anchor domain | Function unknown [S] | 0.98 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| Unclassified | root | N/A | 100.00 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 8.82% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 8.82% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 7.84% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 6.86% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 4.90% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 3.92% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 3.92% |
| Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 2.94% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 2.94% |
| Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 2.94% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 2.94% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 2.94% |
| Watersheds | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Watersheds | 1.96% |
| Bog Forest Soil | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil | 1.96% |
| Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 1.96% |
| Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 1.96% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 1.96% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 1.96% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Uranium Contaminated → Soil | 1.96% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 1.96% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 1.96% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 1.96% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 1.96% |
| Bog | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog | 0.98% |
| Polar Desert Sand | Environmental → Aquatic → Freshwater → Ice → Unclassified → Polar Desert Sand | 0.98% |
| Soil | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Soil | 0.98% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 0.98% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 0.98% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 0.98% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 0.98% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 0.98% |
| Corn Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere | 0.98% |
| Switchgrass Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere | 0.98% |
| Bog | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Bog | 0.98% |
| Avena Fatua Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Avena Fatua Rhizosphere | 0.98% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 0.98% |
| Populus Endosphere | Host-Associated → Plants → Roots → Bulk Soil → Unclassified → Populus Endosphere | 0.98% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.98% |
| Rhizosphere Soil | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Rhizosphere Soil | 0.98% |
| Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Rhizosphere | 0.98% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Arabidopsis Rhizosphere | 0.98% |
| Avena Fatua Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Avena Fatua Rhizosphere | 0.98% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300000891 | Soil microbial communities from Great Prairies - Wisconsin, Continuous corn soil | Environmental | Open in IMG/M |
| 3300000956 | Soil microbial communities from Great Prairies - Kansas, Native Prairie soil | Environmental | Open in IMG/M |
| 3300004080 | Coassembly of ECP04_OM1, ECP04_OM2, ECP04_OM3 | Environmental | Open in IMG/M |
| 3300004082 | Coassembly of ECP03_0M1, ECP03_OM2, ECP03_OM3 | Environmental | Open in IMG/M |
| 3300004479 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of All WPAs | Environmental | Open in IMG/M |
| 3300005167 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_121 | Environmental | Open in IMG/M |
| 3300005178 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_137 | Environmental | Open in IMG/M |
| 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Environmental | Open in IMG/M |
| 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Host-Associated | Open in IMG/M |
| 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Environmental | Open in IMG/M |
| 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Environmental | Open in IMG/M |
| 3300005534 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen07_05102014_R1 | Environmental | Open in IMG/M |
| 3300005538 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen03_05102014_R1 | Environmental | Open in IMG/M |
| 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Environmental | Open in IMG/M |
| 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Environmental | Open in IMG/M |
| 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Host-Associated | Open in IMG/M |
| 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Host-Associated | Open in IMG/M |
| 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Host-Associated | Open in IMG/M |
| 3300005764 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2) | Environmental | Open in IMG/M |
| 3300006046 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_101 | Environmental | Open in IMG/M |
| 3300006052 | Freshwater sediment microbial communities from North America - Little Laurel Run_MetaG_LLR_2013 | Environmental | Open in IMG/M |
| 3300006353 | Populus root and rhizosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Host-Associated | Open in IMG/M |
| 3300006797 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_108 | Environmental | Open in IMG/M |
| 3300006800 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_109 | Environmental | Open in IMG/M |
| 3300006846 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Host-Associated | Open in IMG/M |
| 3300006847 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Host-Associated | Open in IMG/M |
| 3300006852 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Host-Associated | Open in IMG/M |
| 3300006871 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Host-Associated | Open in IMG/M |
| 3300006914 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Host-Associated | Open in IMG/M |
| 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Environmental | Open in IMG/M |
| 3300009012 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_159 | Environmental | Open in IMG/M |
| 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Host-Associated | Open in IMG/M |
| 3300009147 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) | Host-Associated | Open in IMG/M |
| 3300009162 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD2 | Host-Associated | Open in IMG/M |
| 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Host-Associated | Open in IMG/M |
| 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Host-Associated | Open in IMG/M |
| 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Host-Associated | Open in IMG/M |
| 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Host-Associated | Open in IMG/M |
| 3300010304 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_5_09182015 | Environmental | Open in IMG/M |
| 3300010336 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_5_09082015 | Environmental | Open in IMG/M |
| 3300010399 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-3 | Environmental | Open in IMG/M |
| 3300010403 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-3 | Environmental | Open in IMG/M |
| 3300011441 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMGT513_2 | Environmental | Open in IMG/M |
| 3300012043 | Polar desert sand microbial communities from Dry Valleys, Antarctica - metaG UQ601 (22.06) | Environmental | Open in IMG/M |
| 3300012212 | Combined assembly of Hopland grassland soil | Host-Associated | Open in IMG/M |
| 3300012363 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4A metaG | Environmental | Open in IMG/M |
| 3300012469 | Combined assembly of Soil carbon rhizosphere | Host-Associated | Open in IMG/M |
| 3300012532 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_80_16 metaG | Environmental | Open in IMG/M |
| 3300012922 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czobulk1.16 metaG | Environmental | Open in IMG/M |
| 3300012927 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012930 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_2_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012948 | Tropical forest soil microbial communities from Panama - MetaG Plot_14 | Environmental | Open in IMG/M |
| 3300012971 | Tropical forest soil microbial communities from Panama - MetaG Plot_1 | Environmental | Open in IMG/M |
| 3300012985 | Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_246_MG | Environmental | Open in IMG/M |
| 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Host-Associated | Open in IMG/M |
| 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Host-Associated | Open in IMG/M |
| 3300014168 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin17_10_metaG | Environmental | Open in IMG/M |
| 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Host-Associated | Open in IMG/M |
| 3300015052 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_16fungal (PacBio error correction) | Environmental | Open in IMG/M |
| 3300015372 | Soil combined assembly | Host-Associated | Open in IMG/M |
| 3300018031 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3-1_200_b1 | Environmental | Open in IMG/M |
| 3300018054 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_30_b1 | Environmental | Open in IMG/M |
| 3300018076 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_60_coex | Environmental | Open in IMG/M |
| 3300018429 | Populus adjacent soil microbial communities from riparian zone of Shoshone River, Wyoming, USA - 504 T | Environmental | Open in IMG/M |
| 3300018431 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_104 | Environmental | Open in IMG/M |
| 3300018432 | Populus adjacent soil microbial communities from riparian zone of Yellowstone River, Montana, USA - 550 T | Environmental | Open in IMG/M |
| 3300018482 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_118 | Environmental | Open in IMG/M |
| 3300019885 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L1m2 | Environmental | Open in IMG/M |
| 3300021432 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-M | Environmental | Open in IMG/M |
| 3300021861 | Metatranscriptome of freshwater sediment microbial communities from post-fracked creek in Pennsylvania, United States - ABR_2016 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026532 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_153 (SPAdes) | Environmental | Open in IMG/M |
| 3300027651 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM3H0_M2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027869 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen03_05102014_R1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027903 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_2 (SPAdes) | Environmental | Open in IMG/M |
| 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300028814 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_183 | Environmental | Open in IMG/M |
| 3300028881 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_116 | Environmental | Open in IMG/M |
| 3300029883 | I_Bog_E2 coassembly | Environmental | Open in IMG/M |
| 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Host-Associated | Open in IMG/M |
| 3300031708 | FICUS49499 Metagenome Czech Republic combined assembly | Environmental | Open in IMG/M |
| 3300031718 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_05 | Environmental | Open in IMG/M |
| 3300031847 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C48D4 | Environmental | Open in IMG/M |
| 3300032074 | Soil microbial communities from UC Gill Tract Community Farm, Albany, California, United States - DLSLS.P.R1 | Environmental | Open in IMG/M |
| 3300032205 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_05 | Environmental | Open in IMG/M |
| 3300032828 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.4 | Environmental | Open in IMG/M |
| 3300033407 | Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT140D175 | Environmental | Open in IMG/M |
| 3300033417 | Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT142D155 | Environmental | Open in IMG/M |
| 3300034819 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 | Host-Associated | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| JGI10214J12806_106723012 | 3300000891 | Soil | LPYKEIELVGPLPKELGAWIDTTVAVSARAMHREDAQAFIRYLLRPESNKVWKPKGLERFE* |
| JGI10216J12902_1143681692 | 3300000956 | Soil | SRSTHADDARAFIQYMLRPESNKVWKPRGMERFE* |
| JGI10216J12902_1191423792 | 3300000956 | Soil | PKEFGLWIDTMLAVSSRATHPDDAKALIRYLLRPESNKVWKPRGMERFE* |
| Ga0062385_100410613 | 3300004080 | Bog Forest Soil | RELAAWIDMSAAVSSRGAHREDGLAFLKYLLRPESTTVWKTKGLDRFN* |
| Ga0062384_1006262181 | 3300004082 | Bog Forest Soil | WIDMSAAVSSRGAHREDGLAFLKYLLRPESTTVWKTKGLDRFN* |
| Ga0062595_1008683241 | 3300004479 | Soil | EIELVGPLPAELGAWIDSGVAVSARATHAADARALIQYLLRPESNKVWKPRGLERFE* |
| Ga0066672_108959491 | 3300005167 | Soil | DMSTAVSARAMHRDDGLAFIKYLLRPESNTVWKTKGLERFN* |
| Ga0066688_105119541 | 3300005178 | Soil | SQILPYKEIELVGPLPPELRAWLDLAFAVSTRAMHREDARSLMQYLLRPDSNNVWKPRGLERFE* |
| Ga0070680_1015570831 | 3300005336 | Corn Rhizosphere | ILPYKQIELVGPLPRELGAWIDMATAISARAQHREDAAAFSKYLLTPESNTVWKTKGLERY* |
| Ga0068868_1024342332 | 3300005338 | Miscanthus Rhizosphere | AWIDTTIAVSSRATHAEDARAFIKYLLRPESSKVWKPKGLERFE* |
| Ga0070705_1004713691 | 3300005440 | Corn, Switchgrass And Miscanthus Rhizosphere | TTIAVSSRATHAEDARAFIKYLLRPESSKVWKPKGLERFE* |
| Ga0070707_1012100312 | 3300005468 | Corn, Switchgrass And Miscanthus Rhizosphere | GPLPKELGAWIDTTIAVSARATHRDDALAYIRHLLRPESNKVWKPKGLERFE* |
| Ga0070735_105571061 | 3300005534 | Surface Soil | AAWIDMSTAISARAEHRGDASAFSKYLLRPESNAVWKAKGLERFD* |
| Ga0070731_106159702 | 3300005538 | Surface Soil | VSARTVHRDDAVAFVKYILRPEAKPIWQAKGLERFQ* |
| Ga0070686_1007760231 | 3300005544 | Switchgrass Rhizosphere | YKEIELVGPLPAELGAWIDSGVAVSARATHAADARALIQYLLRPESNKVWKPRGLERFE* |
| Ga0070696_1002628282 | 3300005546 | Corn, Switchgrass And Miscanthus Rhizosphere | AELGAWIDTGVAVSARAAHADDARAFIRYLLRPESNKVWKPRGLERFE* |
| Ga0070665_1018719031 | 3300005548 | Switchgrass Rhizosphere | DSGVAVSARATHAEDARALIRYLLRPESNKVWKPRGLERFE* |
| Ga0068855_1014484102 | 3300005563 | Corn Rhizosphere | LPRELGAWIDMATAISARAQHREDAAAFSKYLLTPESNTVWKTKGLERY* |
| Ga0068861_1020763981 | 3300005719 | Switchgrass Rhizosphere | YKEIELVGPLPKELGAWIDTTVAVSARAMRREDARAFIQYLLRPESAKVWKPKGLERFE* |
| Ga0066903_1082012932 | 3300005764 | Tropical Forest Soil | DMSAAVSARTTHRDDAAAFIKYILGAEATRIWKAKGLERFN* |
| Ga0066652_1008492001 | 3300006046 | Soil | VSVRGEHRDAALAFIKYMLRPESDTVWKTKGLERFK* |
| Ga0075029_1005479271 | 3300006052 | Watersheds | RELAAWIDMSTAVSARAEHRGDAAAFEKYLLRPESTTVWKAKGLERFN* |
| Ga0075029_1013378152 | 3300006052 | Watersheds | LPRELGAWIDMSTAVSARAIHRDEAVAFLKYLVRPESNKWWKAKGLERFN* |
| Ga0075370_102419122 | 3300006353 | Populus Endosphere | SSRATHPDDAKALIRYLLRPESNKVWKPRGMERFE* |
| Ga0066659_100398281 | 3300006797 | Soil | IHPYKGRELVAPPPAELGAWIDTAVAVSARATHTDDARWFIRYLLRPESVAVWKPRGLERFE* |
| Ga0066660_113348691 | 3300006800 | Soil | ELRAWLDLAFAVSTRAMHREDARSLMQYLLRPDSNNVWKPRGLERFE* |
| Ga0075430_1008320531 | 3300006846 | Populus Rhizosphere | PAELGAWIDTTIAVSARATRPDDARALIRYLLRPESDKVWKPRGLERFQ* |
| Ga0075431_1002063401 | 3300006847 | Populus Rhizosphere | SQILPYKEIELVGPLPKELGAWIDTMVAVSARATHPDDAKALIRHLLRPESNKVWKPRGLLRLE* |
| Ga0075433_113612051 | 3300006852 | Populus Rhizosphere | GPLPAELGAWIDLAVAVSARATHADDARAFMRYLLRPESNNVWKPKGLERFE* |
| Ga0075434_1020485001 | 3300006871 | Populus Rhizosphere | LTYTESQNRLPRELAAWIDMSTAVSARAAHRDDALAFIRYLLRPESDKVWQTKGLERFK* |
| Ga0075436_1002876262 | 3300006914 | Populus Rhizosphere | ELGAWIDMSIAVSARAMHRGDALAFIRYLLRAESNAAWKAKGLERFN* |
| Ga0099794_104075382 | 3300007265 | Vadose Zone Soil | IDTTVAVSARATHRDDVLAYIRHLLRPESNKVWKPKGLERFE* |
| Ga0066710_1043618832 | 3300009012 | Grasslands Soil | VGPLPAELGAWIDSAVAVSARATHADDARALIRYLLRPESNGVWKPRGLERFQ |
| Ga0105240_104655683 | 3300009093 | Corn Rhizosphere | AAWIDMSTAVSARAEHRSDAAAFEKYLLRPESTTVWKMKGLERFN* |
| Ga0114129_103112364 | 3300009147 | Populus Rhizosphere | GPLPAELGAWIDLAVAVSARSTHADDARALIRYLLRPESNKVWKPRGLERFE* |
| Ga0114129_113295152 | 3300009147 | Populus Rhizosphere | ELGVWIDSAVAVSARATHADDARALIRYLLRPESNKVWKPRGLERFE* |
| Ga0075423_126657711 | 3300009162 | Populus Rhizosphere | IDRAVAVSARATHANDARAFIRYLLRPESNKVWKPRGLERFE* |
| Ga0075423_131387711 | 3300009162 | Populus Rhizosphere | TIAVSTRAAHAEDARAFIKYLLRPESTKVWKPKGLERFE* |
| Ga0105241_113917991 | 3300009174 | Corn Rhizosphere | AAWIDMSTAVSARAEHRGDAAAFEKYLLRPESNTAWKTKGLERFN* |
| Ga0105237_100415785 | 3300009545 | Corn Rhizosphere | TAVSARAEHRADAAAFEKYLLRPESTTIWKTKGLERFN* |
| Ga0105238_100254165 | 3300009551 | Corn Rhizosphere | GPLPRELGAWIDMATAISARAEHREDAAAFSKYLLTPESNTVWKTKGLERY* |
| Ga0105249_120699461 | 3300009553 | Switchgrass Rhizosphere | LAAWIDMSTAVSARALHRDDALAFIKYLLRPESNTVWKAKGLERFN* |
| Ga0105249_126104591 | 3300009553 | Switchgrass Rhizosphere | PYKEIELVGPLPKELGAWIDTTIAVSARATHPDDARAFIRYLLRPESNTVWKPKGLERFE |
| Ga0134088_103121501 | 3300010304 | Grasslands Soil | TAVAVSARATHTDDARWLIRYLLRPESVAVWKPRGLERFE* |
| Ga0134088_103731531 | 3300010304 | Grasslands Soil | SQILPYKEIELVGPLPAELGAWIDSAVAVSARATHAADASAFIRYLLRPESNKVWKPRGLERFE* |
| Ga0134071_101982763 | 3300010336 | Grasslands Soil | ELVGPLPAELGAWIDAGIAVSARATHADDARALIRYLLRPESNKVWKPRGLERFE* |
| Ga0134127_125258041 | 3300010399 | Terrestrial Soil | AELGAWIDSGIAVSTRATHAADARALIQYLLRPESNKVWKPRGLERFE* |
| Ga0134123_135836761 | 3300010403 | Terrestrial Soil | ATGTTIAVSTRATHAEDARAFIKYLLRPESAKVWKPKGLERFE* |
| Ga0137452_12294531 | 3300011441 | Soil | TMVAVSSRATHPDDARALIRYLLRPESNKVWKPRGMERFE* |
| Ga0136631_102024663 | 3300012043 | Polar Desert Sand | GAWIDTTVAVSSRAAHPDDAKAFIRYLLRPESNKVWKPRGLERFE* |
| Ga0150985_1150520702 | 3300012212 | Avena Fatua Rhizosphere | APLPRELAAWIDMSTAASARAMHRDDALAFIKYLPRPESDTAWKAKGLERFK* |
| Ga0137390_106933342 | 3300012363 | Vadose Zone Soil | VSARAMHRDDARAFIKYLLRPESNAAWKAKGLERFN* |
| Ga0150984_1227512611 | 3300012469 | Avena Fatua Rhizosphere | PYKEIELVGPLPAELKAWIDSGIAISIRTMRRDDARAFIQYLLRPDSNKVWKPKGLERFE |
| Ga0137373_107967211 | 3300012532 | Vadose Zone Soil | KEIELVGPLPAELGAWIDSAVAVSARATHADDARAFIRYLLRPESNKVWKPKGLERFE* |
| Ga0137394_103772421 | 3300012922 | Vadose Zone Soil | AWIDSAVAVSARATHADDARALIRYLLRPESNKVWKPRGLERFE* |
| Ga0137416_110953662 | 3300012927 | Vadose Zone Soil | LPAELGAWIDSAVAVSARATHADDARAFIRYLLRPESNKVWKPRGLERFE* |
| Ga0137407_113186521 | 3300012930 | Vadose Zone Soil | ELRAWIDSGVAVSARAAHPDDARAFIRYLLRPESNKVWKPKGLERFE* |
| Ga0126375_106097422 | 3300012948 | Tropical Forest Soil | KEIELVGPLPAELGAWIDTAVAVSARATHADDARALIRYLLRPESNKVWKPRGLERFE* |
| Ga0126369_132889361 | 3300012971 | Tropical Forest Soil | AWIDMSTAVSSRAMHREDALKFIRYLVRPESDGVWKAKGLERFK* |
| Ga0164308_113385531 | 3300012985 | Soil | AWIDSGVAVSARATHAEDARALIRYLLRPESNKVWKPQGLERFE* |
| Ga0157378_110462433 | 3300013297 | Miscanthus Rhizosphere | LPRELAAWIDMSTAVSARAEHRADAAAFEKYLLRPESTTVWKTKGLERFN* |
| Ga0157375_138158101 | 3300013308 | Miscanthus Rhizosphere | KEIELVGPLPAELGAWIDSGIAVSTRATHAADARALIQYLLRPESNKVWKPRGLERFE* |
| Ga0181534_109503541 | 3300014168 | Bog | ELIGPLPRELGAWIDMSTAVSARAMHRDDALAFIKYLLRPESNAAWKAKALERFN* |
| Ga0157379_105024123 | 3300014968 | Switchgrass Rhizosphere | DMSTAVSARAEHRADAAAFEKYLLRPESTTIWKTKGLERFN* |
| Ga0137411_11994841 | 3300015052 | Vadose Zone Soil | YKEIELVGPLPKALGAWIDTTVAVSARATHRDDALAYIRHLLRPESNKVWKPKGLERFE* |
| Ga0132256_1012906231 | 3300015372 | Arabidopsis Rhizosphere | TMVAVSARATHPDDAKALIRYLLRPESNKVWKPRGLLRLE* |
| Ga0184634_101390852 | 3300018031 | Groundwater Sediment | PKELGAWIDTMVAVPARATHPDDAKALIRYLLRPESNKVWKPRGLLRLE |
| Ga0184621_100896641 | 3300018054 | Groundwater Sediment | GPLPKELGAWIDTTVAVSARATHRDDARAFIRYLLRPESNKVWKPKGLERFE |
| Ga0184609_104180481 | 3300018076 | Groundwater Sediment | IDTTVAVSARATHRDDARAFIRYLLRPESNKVWKPKGLERFE |
| Ga0190272_130136282 | 3300018429 | Soil | VSSRSTKPDDAKALIRYLLRPESNKVWKPRGMERFE |
| Ga0066655_100289723 | 3300018431 | Grasslands Soil | ILPYKEIELVGPLPAELGAWIDTAVAVSARATHTDDARWFIRYLLRPESVAVWKPRGLERFE |
| Ga0190275_122582422 | 3300018432 | Soil | SARAPHPDDARRFIQYLLRPESNKVWKPRGLERFE |
| Ga0066669_105691871 | 3300018482 | Grasslands Soil | GPLPAELGAWIDSAVAVSARATHADDARAFIRYLLRPESNKVWKPRGLERFE |
| Ga0066669_111999341 | 3300018482 | Grasslands Soil | IELVGPLPAELHAWIDSGIAVSARATHPDDARAFIRYVLRPESNKVWKPKGLERFE |
| Ga0193747_10345921 | 3300019885 | Soil | IDLAVAVSARATHADDARALIRYLLRPESNKVWKPKGLERFE |
| Ga0210384_116281701 | 3300021432 | Soil | WIDMSLAVSARAAHREDALAFLKYLLRPDSTAVWKSKGLERFN |
| Ga0213853_108829032 | 3300021861 | Watersheds | LAAWIDMSTAVSVRAMHRDDALAFIKYLLRPESNAVWKAKGLERFN |
| Ga0213853_112991292 | 3300021861 | Watersheds | GAWIDMSTAVSARAIHRDEAVAFLKYLVRPESNKWWKAKGLERFD |
| Ga0207671_105280211 | 3300025914 | Corn Rhizosphere | TAVSARAEHRADAAAFEKYLLRPESTTIWKTKGLERFN |
| Ga0207711_115013372 | 3300025941 | Switchgrass Rhizosphere | TIAVSARATHPDDARAFIRYLLRPESNTVWKPKGLERFE |
| Ga0207698_123237911 | 3300026142 | Corn Rhizosphere | IDMSTAVSARATHREDAQAFIKYLLRPESNPVWKGKGLERFN |
| Ga0209160_11567142 | 3300026532 | Soil | WIDTAVAVSARATHTDDARWFIRYLLRPESVAVWKPRGLERFE |
| Ga0209217_10930911 | 3300027651 | Forest Soil | EIELVGPLPRELGAWIDSAIAVSARTTRRDDARAFMQYLLRPESNKVWKPKGLERFE |
| Ga0209579_104096691 | 3300027869 | Surface Soil | VSARTVHRDDAVAFVKYILRPEAKPIWQAKGLERFQ |
| Ga0209488_106925433 | 3300027903 | Vadose Zone Soil | ELRAWIDSGVAVSARATHADDARAFIRYLLRPESNTVWKPRGLERFE |
| Ga0268266_101639191 | 3300028379 | Switchgrass Rhizosphere | RELAAWIDMSTAVSARAEHRADAAAFEKYLLRPESTTVWKTKGLERFN |
| Ga0268264_108117203 | 3300028381 | Switchgrass Rhizosphere | ELAAWIDMSTAVSARAEHRADAAAFEKYLLRPESTTVWKTKGLERFN |
| Ga0307302_104350001 | 3300028814 | Soil | AVSSRATHAEDARAFIKYLLRPESGKVWKPKGLERFE |
| Ga0307277_102173611 | 3300028881 | Soil | DTTVAVSARATHREDARAFIRYILRPESNKVWKPKGLERFE |
| Ga0311327_105123971 | 3300029883 | Bog | QAICEILPHKEIELVGTLPRELGAWIDMSTAVSARAMHRGDALAFIQHLLRPESNAVWKAKALERFH |
| Ga0265313_102276142 | 3300031595 | Rhizosphere | ELAAWIDMSTAVSARAEHRGDAAAFEKYLLRSESTAVWKSKGLERFN |
| Ga0310686_1149453192 | 3300031708 | Soil | AVSARTVHRDDAVAFVKYILRPEAKPIWQAKGLERFQ |
| Ga0307474_102625251 | 3300031718 | Hardwood Forest Soil | WIDMSTAVSARTVHRDDAVAFVKYILRPEAKPIWQAKGLERFQ |
| Ga0307474_105150542 | 3300031718 | Hardwood Forest Soil | APLPRELGAWIDMSVAVSARAMHRDDALSFIKYLLRPESNTAWKTKGLERFN |
| Ga0310907_104905971 | 3300031847 | Soil | QTISQILPYKEIELVGPLPAELGAWIDSGIAVSDRATHADDARTLITYLLRPESNKVWKPRGLERFE |
| Ga0308173_121873472 | 3300032074 | Soil | LPRELAAWIDMSTAVSARAMHRDDAQAFIRYLLRPESNPVWKGKGLERFN |
| Ga0307472_1008025822 | 3300032205 | Hardwood Forest Soil | VGPLPPELGAWIDSGIAVSARTMRRDDARAFMQYLLRPESNKVWKPKGLERFE |
| Ga0307472_1018309771 | 3300032205 | Hardwood Forest Soil | ELGVWIDSGVAVSARATHADDARALIRYLLRPESNKVWKPRGLERFE |
| Ga0335080_112868711 | 3300032828 | Soil | RELAAWIDMSTAVSARAMHREDAAAFIRYLLRPESNSVWKTKGLERFP |
| Ga0214472_116571122 | 3300033407 | Soil | LGAWIDMSTAVSARATHADDALAFIKYLLRPESNAVWKAKGLERFQ |
| Ga0214471_105021842 | 3300033417 | Soil | STAVSARATHADDALAFIKYLLRPESNAVWKAKGLERFQ |
| Ga0373958_0062506_2_145 | 3300034819 | Rhizosphere Soil | ELGAWIDSGIAVSARATHADDARALIKYLLRPESNKVWKPRGLERFE |
| ⦗Top⦘ |