| Basic Information | |
|---|---|
| Family ID | F101286 |
| Family Type | Metagenome |
| Number of Sequences | 102 |
| Average Sequence Length | 45 residues |
| Representative Sequence | CDAVVVVSWGVDLGLRDEAAREFPRLTTLQAYYPAVVLER |
| Number of Associated Samples | 92 |
| Number of Associated Scaffolds | 102 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | No |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 0.98 % |
| % of genes near scaffold ends (potentially truncated) | 99.02 % |
| % of genes from short scaffolds (< 2000 bps) | 91.18 % |
| Associated GOLD sequencing projects | 84 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.41 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (99.020 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil (22.549 % of family members) |
| Environment Ontology (ENVO) | Unclassified (31.373 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (53.922 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 14.71% β-sheet: 25.00% Coil/Unstructured: 60.29% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.41 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 102 Family Scaffolds |
|---|---|---|
| PF01329 | Pterin_4a | 79.41 |
| PF01370 | Epimerase | 1.96 |
| PF03060 | NMO | 0.98 |
| PF13468 | Glyoxalase_3 | 0.98 |
| PF01402 | RHH_1 | 0.98 |
| PF12697 | Abhydrolase_6 | 0.98 |
| PF07690 | MFS_1 | 0.98 |
| PF00196 | GerE | 0.98 |
| PF01152 | Bac_globin | 0.98 |
| PF13847 | Methyltransf_31 | 0.98 |
| PF13560 | HTH_31 | 0.98 |
| PF00953 | Glycos_transf_4 | 0.98 |
| PF03476 | MOSC_N | 0.98 |
| PF13520 | AA_permease_2 | 0.98 |
| PF00440 | TetR_N | 0.98 |
| COG ID | Name | Functional Category | % Frequency in 102 Family Scaffolds |
|---|---|---|---|
| COG2154 | Pterin-4a-carbinolamine dehydratase | Coenzyme transport and metabolism [H] | 79.41 |
| COG0472 | UDP-N-acetylmuramyl pentapeptide phosphotransferase/UDP-N-acetylglucosamine-1-phosphate transferase | Cell wall/membrane/envelope biogenesis [M] | 0.98 |
| COG0516 | IMP dehydrogenase/GMP reductase | Nucleotide transport and metabolism [F] | 0.98 |
| COG2070 | NAD(P)H-dependent flavin oxidoreductase YrpB, nitropropane dioxygenase family | General function prediction only [R] | 0.98 |
| COG2346 | Truncated hemoglobin YjbI | Inorganic ion transport and metabolism [P] | 0.98 |
| COG3217 | N-hydroxylaminopurine reductase subunit YcbX, contains MOSC domain | Defense mechanisms [V] | 0.98 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 99.02 % |
| Unclassified | root | N/A | 0.98 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300001661|JGI12053J15887_10023813 | All Organisms → cellular organisms → Bacteria | 3430 | Open in IMG/M |
| 3300002560|JGI25383J37093_10077717 | All Organisms → cellular organisms → Bacteria | 1013 | Open in IMG/M |
| 3300002561|JGI25384J37096_10170368 | All Organisms → cellular organisms → Bacteria | 666 | Open in IMG/M |
| 3300002562|JGI25382J37095_10167237 | All Organisms → cellular organisms → Bacteria | 692 | Open in IMG/M |
| 3300002916|JGI25389J43894_1086564 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 555 | Open in IMG/M |
| 3300005174|Ga0066680_10561554 | All Organisms → cellular organisms → Bacteria | 717 | Open in IMG/M |
| 3300005174|Ga0066680_10865702 | All Organisms → cellular organisms → Bacteria | 538 | Open in IMG/M |
| 3300005179|Ga0066684_10381915 | All Organisms → cellular organisms → Bacteria | 944 | Open in IMG/M |
| 3300005180|Ga0066685_10195314 | All Organisms → cellular organisms → Bacteria | 1387 | Open in IMG/M |
| 3300005187|Ga0066675_10282026 | All Organisms → cellular organisms → Bacteria | 1197 | Open in IMG/M |
| 3300005332|Ga0066388_101273142 | All Organisms → cellular organisms → Bacteria | 1265 | Open in IMG/M |
| 3300005332|Ga0066388_103774241 | Not Available | 773 | Open in IMG/M |
| 3300005406|Ga0070703_10076060 | All Organisms → cellular organisms → Bacteria | 1132 | Open in IMG/M |
| 3300005440|Ga0070705_100972889 | All Organisms → cellular organisms → Bacteria | 687 | Open in IMG/M |
| 3300005454|Ga0066687_10013371 | All Organisms → cellular organisms → Bacteria | 3250 | Open in IMG/M |
| 3300005454|Ga0066687_10444601 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 758 | Open in IMG/M |
| 3300005518|Ga0070699_100804143 | All Organisms → cellular organisms → Bacteria | 860 | Open in IMG/M |
| 3300005540|Ga0066697_10307223 | All Organisms → cellular organisms → Bacteria | 931 | Open in IMG/M |
| 3300005546|Ga0070696_101674261 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 548 | Open in IMG/M |
| 3300005560|Ga0066670_10187093 | All Organisms → cellular organisms → Bacteria | 1237 | Open in IMG/M |
| 3300005568|Ga0066703_10011089 | All Organisms → cellular organisms → Bacteria | 4344 | Open in IMG/M |
| 3300005569|Ga0066705_10041406 | All Organisms → cellular organisms → Bacteria | 2542 | Open in IMG/M |
| 3300005980|Ga0066798_10200322 | All Organisms → cellular organisms → Bacteria | 542 | Open in IMG/M |
| 3300006031|Ga0066651_10707110 | All Organisms → cellular organisms → Bacteria | 541 | Open in IMG/M |
| 3300006046|Ga0066652_102082849 | All Organisms → cellular organisms → Bacteria | 503 | Open in IMG/M |
| 3300006047|Ga0075024_100487236 | All Organisms → cellular organisms → Bacteria | 644 | Open in IMG/M |
| 3300006050|Ga0075028_100856357 | All Organisms → cellular organisms → Bacteria | 557 | Open in IMG/M |
| 3300006354|Ga0075021_10265906 | All Organisms → cellular organisms → Bacteria | 1058 | Open in IMG/M |
| 3300006804|Ga0079221_11314019 | All Organisms → cellular organisms → Bacteria | 570 | Open in IMG/M |
| 3300006903|Ga0075426_10592396 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 827 | Open in IMG/M |
| 3300006914|Ga0075436_100518145 | All Organisms → cellular organisms → Bacteria | 873 | Open in IMG/M |
| 3300007258|Ga0099793_10390455 | All Organisms → cellular organisms → Bacteria | 683 | Open in IMG/M |
| 3300009089|Ga0099828_11016894 | All Organisms → cellular organisms → Bacteria | 738 | Open in IMG/M |
| 3300009143|Ga0099792_11069529 | All Organisms → cellular organisms → Bacteria | 542 | Open in IMG/M |
| 3300009162|Ga0075423_10494961 | All Organisms → cellular organisms → Bacteria | 1285 | Open in IMG/M |
| 3300009662|Ga0105856_1327878 | All Organisms → cellular organisms → Bacteria | 519 | Open in IMG/M |
| 3300010303|Ga0134082_10545966 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 510 | Open in IMG/M |
| 3300010322|Ga0134084_10273932 | All Organisms → cellular organisms → Bacteria | 618 | Open in IMG/M |
| 3300010361|Ga0126378_12352065 | All Organisms → cellular organisms → Bacteria | 608 | Open in IMG/M |
| 3300011271|Ga0137393_10074932 | All Organisms → cellular organisms → Bacteria | 2709 | Open in IMG/M |
| 3300011271|Ga0137393_10536677 | All Organisms → cellular organisms → Bacteria | 1003 | Open in IMG/M |
| 3300012096|Ga0137389_10569417 | All Organisms → cellular organisms → Bacteria | 973 | Open in IMG/M |
| 3300012198|Ga0137364_10141097 | All Organisms → cellular organisms → Bacteria | 1734 | Open in IMG/M |
| 3300012203|Ga0137399_11699272 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 520 | Open in IMG/M |
| 3300012206|Ga0137380_10897383 | All Organisms → cellular organisms → Bacteria | 761 | Open in IMG/M |
| 3300012206|Ga0137380_11307488 | All Organisms → cellular organisms → Bacteria | 610 | Open in IMG/M |
| 3300012206|Ga0137380_11396127 | All Organisms → cellular organisms → Bacteria | 585 | Open in IMG/M |
| 3300012208|Ga0137376_10200941 | All Organisms → cellular organisms → Bacteria | 1724 | Open in IMG/M |
| 3300012208|Ga0137376_11164618 | All Organisms → cellular organisms → Bacteria | 659 | Open in IMG/M |
| 3300012211|Ga0137377_10574390 | All Organisms → cellular organisms → Bacteria | 1065 | Open in IMG/M |
| 3300012285|Ga0137370_10609599 | All Organisms → cellular organisms → Bacteria | 675 | Open in IMG/M |
| 3300012359|Ga0137385_10204057 | All Organisms → cellular organisms → Bacteria | 1725 | Open in IMG/M |
| 3300012362|Ga0137361_10888402 | All Organisms → cellular organisms → Bacteria | 808 | Open in IMG/M |
| 3300012685|Ga0137397_10908249 | All Organisms → cellular organisms → Bacteria | 653 | Open in IMG/M |
| 3300012917|Ga0137395_10295902 | All Organisms → cellular organisms → Bacteria | 1146 | Open in IMG/M |
| 3300012922|Ga0137394_10394989 | All Organisms → cellular organisms → Bacteria | 1179 | Open in IMG/M |
| 3300012922|Ga0137394_10509200 | All Organisms → cellular organisms → Bacteria | 1022 | Open in IMG/M |
| 3300012986|Ga0164304_11163079 | All Organisms → cellular organisms → Bacteria | 621 | Open in IMG/M |
| 3300013768|Ga0120155_1095157 | All Organisms → cellular organisms → Bacteria | 836 | Open in IMG/M |
| 3300014031|Ga0120173_1001768 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 3011 | Open in IMG/M |
| 3300014056|Ga0120125_1149398 | All Organisms → cellular organisms → Bacteria | 568 | Open in IMG/M |
| 3300014157|Ga0134078_10072736 | All Organisms → cellular organisms → Bacteria | 1237 | Open in IMG/M |
| 3300015373|Ga0132257_101994611 | All Organisms → cellular organisms → Bacteria | 748 | Open in IMG/M |
| 3300018071|Ga0184618_10451401 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 541 | Open in IMG/M |
| 3300018468|Ga0066662_11387846 | All Organisms → cellular organisms → Bacteria | 726 | Open in IMG/M |
| 3300019883|Ga0193725_1044928 | All Organisms → cellular organisms → Bacteria | 1143 | Open in IMG/M |
| 3300020004|Ga0193755_1057529 | All Organisms → cellular organisms → Bacteria | 1265 | Open in IMG/M |
| 3300020008|Ga0193757_1025461 | All Organisms → cellular organisms → Bacteria | 589 | Open in IMG/M |
| 3300021080|Ga0210382_10013950 | All Organisms → cellular organisms → Bacteria | 2798 | Open in IMG/M |
| 3300021479|Ga0210410_11000923 | All Organisms → cellular organisms → Bacteria | 725 | Open in IMG/M |
| 3300024290|Ga0247667_1025807 | All Organisms → cellular organisms → Bacteria | 1127 | Open in IMG/M |
| 3300025505|Ga0207929_1076827 | All Organisms → cellular organisms → Bacteria | 630 | Open in IMG/M |
| 3300025579|Ga0207927_1099363 | All Organisms → cellular organisms → Bacteria | 661 | Open in IMG/M |
| 3300025885|Ga0207653_10123638 | All Organisms → cellular organisms → Bacteria | 934 | Open in IMG/M |
| 3300025910|Ga0207684_10391254 | All Organisms → cellular organisms → Bacteria | 1195 | Open in IMG/M |
| 3300026300|Ga0209027_1306344 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 512 | Open in IMG/M |
| 3300026301|Ga0209238_1108836 | All Organisms → cellular organisms → Bacteria | 930 | Open in IMG/M |
| 3300026313|Ga0209761_1070080 | All Organisms → cellular organisms → Bacteria | 1863 | Open in IMG/M |
| 3300026320|Ga0209131_1313880 | All Organisms → cellular organisms → Bacteria | 583 | Open in IMG/M |
| 3300026332|Ga0209803_1178876 | All Organisms → cellular organisms → Bacteria | 800 | Open in IMG/M |
| 3300026332|Ga0209803_1310294 | All Organisms → cellular organisms → Bacteria | 542 | Open in IMG/M |
| 3300026335|Ga0209804_1329667 | All Organisms → cellular organisms → Bacteria | 514 | Open in IMG/M |
| 3300026507|Ga0257165_1057189 | All Organisms → cellular organisms → Bacteria | 705 | Open in IMG/M |
| 3300026527|Ga0209059_1210854 | All Organisms → cellular organisms → Bacteria | 654 | Open in IMG/M |
| 3300026529|Ga0209806_1219572 | All Organisms → cellular organisms → Bacteria | 649 | Open in IMG/M |
| 3300026537|Ga0209157_1162205 | All Organisms → cellular organisms → Bacteria | 991 | Open in IMG/M |
| 3300026540|Ga0209376_1381500 | All Organisms → cellular organisms → Bacteria | 528 | Open in IMG/M |
| 3300027565|Ga0209219_1131973 | All Organisms → cellular organisms → Bacteria | 607 | Open in IMG/M |
| 3300027643|Ga0209076_1079130 | All Organisms → cellular organisms → Bacteria | 935 | Open in IMG/M |
| 3300027669|Ga0208981_1067571 | All Organisms → cellular organisms → Bacteria | 911 | Open in IMG/M |
| 3300027669|Ga0208981_1165269 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 560 | Open in IMG/M |
| 3300027681|Ga0208991_1187498 | All Organisms → cellular organisms → Bacteria | 603 | Open in IMG/M |
| 3300027765|Ga0209073_10106270 | All Organisms → cellular organisms → Bacteria | 996 | Open in IMG/M |
| 3300027894|Ga0209068_10126282 | All Organisms → cellular organisms → Bacteria | 1368 | Open in IMG/M |
| 3300027915|Ga0209069_10578157 | All Organisms → cellular organisms → Bacteria | 644 | Open in IMG/M |
| 3300028536|Ga0137415_11258699 | All Organisms → cellular organisms → Bacteria | 556 | Open in IMG/M |
| 3300028807|Ga0307305_10189298 | All Organisms → cellular organisms → Bacteria | 947 | Open in IMG/M |
| 3300028819|Ga0307296_10025743 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 3105 | Open in IMG/M |
| 3300031754|Ga0307475_10784714 | All Organisms → cellular organisms → Bacteria | 757 | Open in IMG/M |
| 3300032063|Ga0318504_10418670 | All Organisms → cellular organisms → Bacteria | 639 | Open in IMG/M |
| 3300032180|Ga0307471_100456281 | All Organisms → cellular organisms → Bacteria | 1418 | Open in IMG/M |
| 3300033233|Ga0334722_10031610 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Solirubrobacteraceae → Solirubrobacter → unclassified Solirubrobacter → Solirubrobacter sp. | 4360 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 22.55% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 19.61% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 8.82% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 5.88% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 5.88% |
| Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 4.90% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 4.90% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 3.92% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 2.94% |
| Permafrost | Environmental → Terrestrial → Soil → Unclassified → Permafrost → Permafrost | 2.94% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 2.94% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 1.96% |
| Arctic Peat Soil | Environmental → Terrestrial → Soil → Unclassified → Permafrost → Arctic Peat Soil | 1.96% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 1.96% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 1.96% |
| Groundwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Groundwater Sediment | 0.98% |
| Sediment | Environmental → Aquatic → Freshwater → Lake → Sediment → Sediment | 0.98% |
| Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 0.98% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 0.98% |
| Permafrost Soil | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Permafrost Soil | 0.98% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Soil | 0.98% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 0.98% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300001661 | Mediterranean Blodgett CA OM1_O3 (Mediterranean Blodgett coassembly) | Environmental | Open in IMG/M |
| 3300002560 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 09_25_2013_1_20cm | Environmental | Open in IMG/M |
| 3300002561 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 09_25_2013_1_40cm | Environmental | Open in IMG/M |
| 3300002562 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 08_20_2013_1_40cm | Environmental | Open in IMG/M |
| 3300002916 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 10_02_2013_1_20cm | Environmental | Open in IMG/M |
| 3300005174 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_129 | Environmental | Open in IMG/M |
| 3300005179 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_133 | Environmental | Open in IMG/M |
| 3300005180 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_134 | Environmental | Open in IMG/M |
| 3300005187 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_124 | Environmental | Open in IMG/M |
| 3300005332 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300005406 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG | Environmental | Open in IMG/M |
| 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Environmental | Open in IMG/M |
| 3300005454 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_136 | Environmental | Open in IMG/M |
| 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Environmental | Open in IMG/M |
| 3300005540 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_146 | Environmental | Open in IMG/M |
| 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Environmental | Open in IMG/M |
| 3300005560 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_119 | Environmental | Open in IMG/M |
| 3300005568 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_152 | Environmental | Open in IMG/M |
| 3300005569 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_154 | Environmental | Open in IMG/M |
| 3300005980 | Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Permafrost soil leachate replicate DNA2013-203 | Environmental | Open in IMG/M |
| 3300006031 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Angelo_100 | Environmental | Open in IMG/M |
| 3300006046 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_101 | Environmental | Open in IMG/M |
| 3300006047 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Straight Creek_MetaG_SC_2013 | Environmental | Open in IMG/M |
| 3300006050 | Freshwater sediment microbial communities from Pennsylvania, USA - Little Laurel Run_MetaG_LLR_2014 | Environmental | Open in IMG/M |
| 3300006354 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2012 | Environmental | Open in IMG/M |
| 3300006804 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS200 | Environmental | Open in IMG/M |
| 3300006903 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD5 | Host-Associated | Open in IMG/M |
| 3300006914 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Host-Associated | Open in IMG/M |
| 3300007258 | Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_3 | Environmental | Open in IMG/M |
| 3300009089 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H1.8 metaG | Environmental | Open in IMG/M |
| 3300009143 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_2 | Environmental | Open in IMG/M |
| 3300009162 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD2 | Host-Associated | Open in IMG/M |
| 3300009662 | Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil DNA_2013-060 | Environmental | Open in IMG/M |
| 3300010303 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_5_09182015 | Environmental | Open in IMG/M |
| 3300010322 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Glu_20cm_2_24_1 metaG | Environmental | Open in IMG/M |
| 3300010361 | Tropical forest soil microbial communities from Panama - MetaG Plot_23 | Environmental | Open in IMG/M |
| 3300011271 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4B metaG | Environmental | Open in IMG/M |
| 3300012096 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4B metaG | Environmental | Open in IMG/M |
| 3300012198 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_20_16 metaG | Environmental | Open in IMG/M |
| 3300012203 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz3.16 metaG | Environmental | Open in IMG/M |
| 3300012206 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_100_16 metaG | Environmental | Open in IMG/M |
| 3300012208 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_20_16 metaG | Environmental | Open in IMG/M |
| 3300012211 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_40_16 metaG | Environmental | Open in IMG/M |
| 3300012285 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_20_16 metaG | Environmental | Open in IMG/M |
| 3300012359 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_80_16 metaG | Environmental | Open in IMG/M |
| 3300012362 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_80_16 metaG | Environmental | Open in IMG/M |
| 3300012685 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz1.16 metaG | Environmental | Open in IMG/M |
| 3300012917 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czobulk2.16 metaG | Environmental | Open in IMG/M |
| 3300012922 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czobulk1.16 metaG | Environmental | Open in IMG/M |
| 3300012986 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_217_MG | Environmental | Open in IMG/M |
| 3300013768 | Permafrost microbial communities from Nunavut, Canada - A35_65cm_0M | Environmental | Open in IMG/M |
| 3300014031 | Permafrost microbial communities from Nunavut, Canada - A35_80cm_0.25M | Environmental | Open in IMG/M |
| 3300014056 | Permafrost microbial communities from Nunavut, Canada - A20_5cm_0M | Environmental | Open in IMG/M |
| 3300014157 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Met_20cm_2_24_1 metaG | Environmental | Open in IMG/M |
| 3300015373 | Combined assembly of cpr5 rhizosphere | Host-Associated | Open in IMG/M |
| 3300018071 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_30_b1 | Environmental | Open in IMG/M |
| 3300018468 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_111 | Environmental | Open in IMG/M |
| 3300019883 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? H2a2 | Environmental | Open in IMG/M |
| 3300020004 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? H1a2 | Environmental | Open in IMG/M |
| 3300020008 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? H1m2 | Environmental | Open in IMG/M |
| 3300021080 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_60_coex redo | Environmental | Open in IMG/M |
| 3300021479 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-4-M | Environmental | Open in IMG/M |
| 3300024290 | Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK08 | Environmental | Open in IMG/M |
| 3300025505 | Arctic peat soil from Barrow, Alaska - NGEE Surface sample 53-1 deep-072012 (SPAdes) | Environmental | Open in IMG/M |
| 3300025579 | Arctic peat soil from Barrow, Alaska - NGEE Surface sample 210-2 deep-072012 (SPAdes) | Environmental | Open in IMG/M |
| 3300025885 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300026300 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 09_27_2013_1_20cm (SPAdes) | Environmental | Open in IMG/M |
| 3300026301 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 10_02_2013_1_20cm (SPAdes) | Environmental | Open in IMG/M |
| 3300026313 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 09_25_2013_1_40cm (SPAdes) | Environmental | Open in IMG/M |
| 3300026320 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_40cm (SPAdes) | Environmental | Open in IMG/M |
| 3300026332 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_138 (SPAdes) | Environmental | Open in IMG/M |
| 3300026335 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_139 (SPAdes) | Environmental | Open in IMG/M |
| 3300026507 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - CO-12-B | Environmental | Open in IMG/M |
| 3300026527 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_151 (SPAdes) | Environmental | Open in IMG/M |
| 3300026529 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_152 (SPAdes) | Environmental | Open in IMG/M |
| 3300026537 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_135 (SPAdes) | Environmental | Open in IMG/M |
| 3300026540 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_134 (SPAdes) | Environmental | Open in IMG/M |
| 3300027565 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM1_M1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027643 | Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027669 | Forest soil microbial communities from El Dorado National Forest, California, USA - Mediterranean Blodgett CA OM1_M1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027681 | Forest soil microbial communities from El Dorado National Forest, California, USA - Mediterranean Blodgett CA OM3_M2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027765 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS100 (SPAdes) | Environmental | Open in IMG/M |
| 3300027894 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2012 (SPAdes) | Environmental | Open in IMG/M |
| 3300027915 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Straight Creek_MetaG_SC_2013 (SPAdes) | Environmental | Open in IMG/M |
| 3300028536 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300028807 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_186 | Environmental | Open in IMG/M |
| 3300028819 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_153 | Environmental | Open in IMG/M |
| 3300031754 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_515 | Environmental | Open in IMG/M |
| 3300032063 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f17 | Environmental | Open in IMG/M |
| 3300032180 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515 | Environmental | Open in IMG/M |
| 3300033233 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - C3_bottom | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| JGI12053J15887_1002381310 | 3300001661 | Forest Soil | ASCDTVVVVSWNVDLALRDLAAQEFPRATALQANYPAVVLEK* |
| JGI25383J37093_100777175 | 3300002560 | Grasslands Soil | VVTRPDQLADCDAVVVVSWGVDLGLRDEAAREFPKLTTLDAYYPAVVLVR* |
| JGI25384J37096_101703683 | 3300002561 | Grasslands Soil | DFTVISTPDQLNECDMVVVVSWNVDLPLRDLAAQKFPRGTALPASYPAVVLER* |
| JGI25382J37095_101672371 | 3300002562 | Grasslands Soil | TDFTVISTPDQLNECDMVVVVSWNVDLPLRDLAAQKFPRGTALPASYPAVVLER* |
| JGI25389J43894_10865642 | 3300002916 | Grasslands Soil | VTSPDQLAACDEILVVSWGVDLXXRXRAAQEFPRLSTLEAYYPAVVLRR* |
| Ga0066680_105615543 | 3300005174 | Soil | TVISTPDQLNECDMVVVVSWNVDLPLRDLAAQKFPRGTALPASYPAVVLER* |
| Ga0066680_108657023 | 3300005174 | Soil | VTRPEQLHDCDAVVVVSWGVDLGLRDEAAREFPRLTTLQAYYPAVVLER* |
| Ga0066684_103819151 | 3300005179 | Soil | CDAVVVVSWGVDLALRDQAAQEFPRLTTLEAYYPAVVLER* |
| Ga0066685_101953141 | 3300005180 | Soil | DCDAVVVVSWGVDLGLRDEAAREFPRLTTLQAYYPAVVLER* |
| Ga0066675_102820266 | 3300005187 | Soil | VVTRPEQLHDCDAVVVVSWGVDLGLRDEAAREFPRLTTLQAYYPAVVLER* |
| Ga0066388_1012731423 | 3300005332 | Tropical Forest Soil | TVITRPEQLAACDAVVVVSWGVDLGLRDEAAREFPRLTTLPAYYPAVVLER* |
| Ga0066388_1037742411 | 3300005332 | Tropical Forest Soil | SGFAVVTDPSQLGGCDAVVVVSWGVDLPLRDEAARQLPKLTTLPAYYPAVVLER* |
| Ga0070703_100760601 | 3300005406 | Corn, Switchgrass And Miscanthus Rhizosphere | RADQLPGCDAVVVVSWGVDLGLRDEAARQFPRLRTLEAYYPAVVLER* |
| Ga0070705_1009728893 | 3300005440 | Corn, Switchgrass And Miscanthus Rhizosphere | DQLADCDAVVVVSWNVDLPLRDLAAAQFPSATALQAYYPGVVLER* |
| Ga0066687_100133718 | 3300005454 | Soil | VVTRADQLSDCDAVVVVSWGVDLALRDQAARQFPRLRTLAAYYPAVVLER* |
| Ga0066687_104446012 | 3300005454 | Soil | VVTSPDQLASCDEIVLVSWGVDPGLRDRAAQEFPRRSRLEAAYPAVVLRR* |
| Ga0070699_1008041431 | 3300005518 | Corn, Switchgrass And Miscanthus Rhizosphere | GCDVVVVVSWGVDLALRDQAAEEFPRWTTLQAYYPAVVLER* |
| Ga0066697_103072235 | 3300005540 | Soil | GGCDAVVVVSWGVDLALRDEAAREFPSLTTLPAYYPAVVLRR* |
| Ga0070696_1016742613 | 3300005546 | Corn, Switchgrass And Miscanthus Rhizosphere | VVTSSDQLAQCDAVVVVSWGVDLALRDEAARQFPKLRTLDAYYPAVVLER* |
| Ga0066670_101870931 | 3300005560 | Soil | FDVVTNADQLEHCDVVVVVSWGVDLGLRDEAARRFPGLTTLPAYYPAVVLRR* |
| Ga0066703_100110891 | 3300005568 | Soil | QLADCDAVVVVSWGVDLGLRDEAAREFPKLTTLDAYYPAVVLAR* |
| Ga0066705_100414067 | 3300005569 | Soil | TEFTVVTRPEQLAGCDAVVVVSWGVDLGLRDEAARQFPKLTILDAYYPAVVLVR* |
| Ga0066798_102003223 | 3300005980 | Soil | AVVVVSWAVDLQLRDLAAQEFPRATLLQASYPAVVLER* |
| Ga0066651_107071101 | 3300006031 | Soil | CDAVVVVSWGVDLGLRDEAAREFPRLTTLQAYYPAVVLER* |
| Ga0066652_1020828493 | 3300006046 | Soil | CDAVVVVSWGVDLGLRDEAAREFPKVTTLDAYYPAVVLVR* |
| Ga0075024_1004872361 | 3300006047 | Watersheds | CTVVVVVSWNVDLTLRDLAAQEFPRRTALPAYYPAVVLER* |
| Ga0075028_1008563571 | 3300006050 | Watersheds | LAACDAVVVVSWNVDITLRNEAAREFPTATVLPAYYPAVVLEK* |
| Ga0075021_102659065 | 3300006354 | Watersheds | QLAECDAVVIVSWNVDLAVRGEAAGEFPRATALQAYYPAVVLER* |
| Ga0079221_113140191 | 3300006804 | Agricultural Soil | LAGCDAVVVVSWGVDLALRDEAARQFPSLTTLPAYYPAVVLRR* |
| Ga0075426_105923961 | 3300006903 | Populus Rhizosphere | DAVVVVSWGVDLPLRDEAARRFPSLTTLPAYYPAVVLRRQG* |
| Ga0075436_1005181454 | 3300006914 | Populus Rhizosphere | DQLDRCDAVVVVSWGVDLPLRDEAARRFPSLTTLPAYYPAVVLRREG* |
| Ga0099793_103904551 | 3300007258 | Vadose Zone Soil | LSGCDAVVVVSWNVDLEIRDLAAQQFPRRTILEAYYPAVVLER* |
| Ga0099828_110168943 | 3300009089 | Vadose Zone Soil | VMSADQLTGCDAVVVVSWGVDLALRDEAARQFPSLTTLPAYYPAVVLRR* |
| Ga0099792_110695293 | 3300009143 | Vadose Zone Soil | CDAVVVVSWNVDLALRDAAAQQFPRRTILPAYYPGVVLER* |
| Ga0075423_104949615 | 3300009162 | Populus Rhizosphere | AGCDAVVVVSWGIDLGLRDQASQEFPRLTTLPAYYPAVVLER* |
| Ga0105856_13278781 | 3300009662 | Permafrost Soil | AVVVVSWNVDLALRDAAALEFPRRTILQAYYPAVVLEH* |
| Ga0134082_105459662 | 3300010303 | Grasslands Soil | GFTVVTSPDQLAACDEIVVVSWGVDLGLRDRAALEFPRLSTLEAYYPAVVLRR* |
| Ga0134084_102739321 | 3300010322 | Grasslands Soil | RPDQLAQCDAVVVVSWGVDLGLRDEAARQLPKLRTLDAYYPAVVLER* |
| Ga0126378_123520652 | 3300010361 | Tropical Forest Soil | KFVVVTRPDQLAACDAVVVVSWGVDLGLRAEAAREFPRVTTLPAYYPAVVLER* |
| Ga0137393_100749329 | 3300011271 | Vadose Zone Soil | VVVVSWNVDLTLRDLAAREFLRRTALPAYYPAVVLER* |
| Ga0137393_105366771 | 3300011271 | Vadose Zone Soil | DFKVVTSADQLAGCDAVVVVSWGVDLALRDEAARQFPGLTTLPAYYPAVVLRR* |
| Ga0137389_105694171 | 3300012096 | Vadose Zone Soil | FAIVSSPDQLNGCDAVVVVSWNVDLALRNLAAQEFPRATKLAAGYPAVVLER* |
| Ga0137364_101410976 | 3300012198 | Vadose Zone Soil | ADCDAVVVVSWGVDLGLRDEAAREFPKLTTLDAYYPAVVLVR* |
| Ga0137399_116992721 | 3300012203 | Vadose Zone Soil | FKVVSTANELSGCDAVVVVSWNVDLGIRDLAAQQFPRRTILQAYYPAVVLER* |
| Ga0137380_108973831 | 3300012206 | Vadose Zone Soil | RPEQLKDCDAVVVVSWGVDLALRDQAAQEFPRLTTLEAYYPAVVLER* |
| Ga0137380_113074881 | 3300012206 | Vadose Zone Soil | VVVVSWGVDLALRDEAARQLPKLRTLDAYYPAVVLER* |
| Ga0137380_113961271 | 3300012206 | Vadose Zone Soil | FAVVTRPDQLAGCDAVVVVSWGVDLGLRDQAAQAFPRLTTLQAYYPAVVLER* |
| Ga0137376_102009411 | 3300012208 | Vadose Zone Soil | RPEQLADCDAVVVVSWGVDLGLRDEAAREFPKLTTLDAYYPAVVLVR* |
| Ga0137376_111646181 | 3300012208 | Vadose Zone Soil | VVSWNVDLALRDQAAAEFPRATALQAYYPGVVLER* |
| Ga0137377_105743904 | 3300012211 | Vadose Zone Soil | CDAVVVVSWGVDLGLRDEAAREFPKLTTLDAYYPAVVLVR* |
| Ga0137370_106095993 | 3300012285 | Vadose Zone Soil | GCDAVLVVRWGLDFAVRDGVARQFSILTTLPAYYPAVVLRR* |
| Ga0137385_102040571 | 3300012359 | Vadose Zone Soil | DQLDQCDLVVVVSWNVDLALRDQAAQEFPRRTLLPAYYPAVVLER* |
| Ga0137361_108884023 | 3300012362 | Vadose Zone Soil | VVVVSWNVDLPLRDLAAQQFPRRTLLPASYPAVVLGR* |
| Ga0137397_109082493 | 3300012685 | Vadose Zone Soil | GCDAIVVVSWGVDLELRDQAAQEFPRLTTLQAYYPAVVLER* |
| Ga0137395_102959021 | 3300012917 | Vadose Zone Soil | GDLAGCDEVVVVSWNVDLPLRDLAAQQFPRRTLLPASYPAVVLGR* |
| Ga0137394_103949895 | 3300012922 | Vadose Zone Soil | TNADELSRCDALVVVSWNVDLPLRDLAAQQFPRGTLLPAYYPAVVLER* |
| Ga0137394_105092001 | 3300012922 | Vadose Zone Soil | FRVVSTAKELSGCDAVVVVRWNVDLGIRDLAAQQFPRRTILQAYYPAVVLER* |
| Ga0164304_111630793 | 3300012986 | Soil | VVSWNVDLPLRDLAAEQFPKGKLLPAYYPAVVLER* |
| Ga0120155_10951571 | 3300013768 | Permafrost | QVVVVSWNVDLALRDLAAAEFPRRTILPAYYNGVVLER* |
| Ga0120173_10017681 | 3300014031 | Permafrost | DAVVVVSWNVDLALQDQAAQQFPRRTVLPAYYPAVVLER* |
| Ga0120125_11493982 | 3300014056 | Permafrost | AGDLNGCDAVVVVSWNVDLALRDLAAAEFPRRTILPAYYNGVVLER* |
| Ga0134078_100727364 | 3300014157 | Grasslands Soil | VTRPEQLADCDAVVVVSWGVDLGLRDQAAQEFPRLTTLPAYYPTVVLKR* |
| Ga0132257_1019946112 | 3300015373 | Arabidopsis Rhizosphere | DCDAVVVVSWAVDLALRDEAARQFPRLRTLDAYYPAVVLER* |
| Ga0184618_104514012 | 3300018071 | Groundwater Sediment | KVVSSAGDLDGCDAVVVVSWNVDLELRDLAAQQFPRRTVLPAFYPAVVLEP |
| Ga0066662_113878462 | 3300018468 | Grasslands Soil | DAVVVVSWGVDLALRDQAAQEFPRLTTLEAYYPAVVLER |
| Ga0193725_10449281 | 3300019883 | Soil | KCDAVVVVSWNVDLPLRDLAAQQFSRGTLLPAYYPAVVLER |
| Ga0193755_10575292 | 3300020004 | Soil | VVSTPEQLADCDGVVVVSWNVDLALRDLAAAQFPRATALQAYYPGVVLER |
| Ga0193757_10254611 | 3300020008 | Soil | GCSAVVVVSWNVDLALRDQAAAEFPRATALQAYYPGVVLER |
| Ga0210382_100139508 | 3300021080 | Groundwater Sediment | TTDFSVVSTPDQLAGCDAVVVVSWNVDLPLRDLAAEQFPRATALQAYYPGVVLER |
| Ga0210410_110009233 | 3300021479 | Soil | PADLAACDAVVVVSWNVDLALRDLAAQEFPHATVLGAYYPAVVLER |
| Ga0247667_10258071 | 3300024290 | Soil | AVVVVSWNVDLALRDQAAREFPRATALGASYPAVVLER |
| Ga0207929_10768271 | 3300025505 | Arctic Peat Soil | SPEDLNGCDAVVVVSWNVDLALRDLAAEQFPRRTILPAYYNGVLLER |
| Ga0207927_10993633 | 3300025579 | Arctic Peat Soil | AVVVVSWNVDLALRAAAAEQFPRTTVLHAYYPAVVLER |
| Ga0207653_101236381 | 3300025885 | Corn, Switchgrass And Miscanthus Rhizosphere | VVVVSWGVDLALRDEAARQFPSLTTLPAYYPAVVLER |
| Ga0207684_103912541 | 3300025910 | Corn, Switchgrass And Miscanthus Rhizosphere | VVTAADQLAGCDAVVVVSWNVDLELRDLAAQEFPRRTLLPASYPAVVLGR |
| Ga0209027_13063441 | 3300026300 | Grasslands Soil | TRPEQLAGCDAVVVVSWGVDLGLRDEAARQFPKLTILDAYYPAVVLVR |
| Ga0209238_11088364 | 3300026301 | Grasslands Soil | DCDAVVVVSWGVDLALRDQAARQFPRLRTLAAYYPAVVLER |
| Ga0209761_10700801 | 3300026313 | Grasslands Soil | DQLNECDMVVVVSWNVDLPLRDLAAQKFPRGTALPASYPAVVLER |
| Ga0209131_13138801 | 3300026320 | Grasslands Soil | KDFSVVATPEQLAACSAVVVVSWNVDLALRDQAAAEFPRATALQAYYPGVVLER |
| Ga0209803_11788761 | 3300026332 | Soil | VVSWGVDLGLRDEAAREFPRLTTLQAYYPAVVLER |
| Ga0209803_13102941 | 3300026332 | Soil | VVTRPEQLKDCDAVVVVSWGVDLALRDQAAQEFPRLTTLEAYYPAVVLER |
| Ga0209804_13296672 | 3300026335 | Soil | VVSWGVDLALRDQAAQEFPRLTTLEAYYPAVVLER |
| Ga0257165_10571893 | 3300026507 | Soil | GCDAVVVVSWNVDLALRNLAAQEFPRATTLGAGYPAVVLER |
| Ga0209059_12108543 | 3300026527 | Soil | TVVTRPEQLRDCDAVVVVSWGVDLALRDEAAREFPRLTRLEAYYPAVVLER |
| Ga0209806_12195723 | 3300026529 | Soil | PDQLADCDAVVVVSWGVDLGLRDEAAREFPKLTTLDAYYPAVVLAR |
| Ga0209157_11622051 | 3300026537 | Soil | LADCDAVVVVSWGVDLGLRDEAAREFPKLTTLDAYYPAVVLVR |
| Ga0209376_13815001 | 3300026540 | Soil | GCDAVVVVSWGVDLALRDEAAREFPSLTTLPAYYPAVVLRR |
| Ga0209219_11319733 | 3300027565 | Forest Soil | VVVVSWNVDLTLRDLAAQAFPRRTLLPAYYPAVVLGR |
| Ga0209076_10791305 | 3300027643 | Vadose Zone Soil | QLAGCSAVVVVSWNVDLALREQAAAEFQRATALQAYYPGVLLER |
| Ga0208981_10675711 | 3300027669 | Forest Soil | DQLASCDTVVVVSWNVDLALRDLAAQEFPRATALQANYPAVVLEK |
| Ga0208981_11652692 | 3300027669 | Forest Soil | KVVERADQLDACSGVVVVSWNVDLTLRDLAAQAFPRRTLLPAYYPAVVLGR |
| Ga0208991_11874982 | 3300027681 | Forest Soil | RSSPDQLASCDTVVVVSWNVDLALRDLAAQEFPRATALQANYPAVVLEK |
| Ga0209073_101062705 | 3300027765 | Agricultural Soil | SDFAVVTTPDQLAGCDVVVVVSWGVDLALRDQAAEEFPRWTTLQAYYPAVVLER |
| Ga0209068_101262821 | 3300027894 | Watersheds | TSADQLAECDAVVIVSWNVDLAVRGEAAGEFPRATALQAYYPAVVLER |
| Ga0209069_105781573 | 3300027915 | Watersheds | CTVVVVVSWNVDLTLRDLAAQEFPRRTALPAYYPAVVLER |
| Ga0137415_112586991 | 3300028536 | Vadose Zone Soil | VVTTAGELAGCDEVVVVSWNVDLALRDLAAQEFPRGTLLPAGYPAVVLGR |
| Ga0307305_101892981 | 3300028807 | Soil | AGDLDGCDAVVVVSWNVDLGLRDLAAQRFPRRTALRASYPAVVLEP |
| Ga0307296_100257431 | 3300028819 | Soil | VSSAGDLDGCDAVVVVSWNVDLGLRDLAAQRFPRRTALRASYPAVVLEP |
| Ga0307475_107847141 | 3300031754 | Hardwood Forest Soil | YSIVFNPDQLAACDAVVVVSWNVDLALRDLAAQEFTRATKLGASYPTIVLER |
| Ga0318504_104186701 | 3300032063 | Soil | VVSSPDQLAACDAVVVVSWNVDLALREEAARQFPRLRTLEAYYPAVVLER |
| Ga0307471_1004562811 | 3300032180 | Hardwood Forest Soil | PDQLSACDMVVVVSWNVDLPLRDLAAQEFPHGTLLPASYPAVVLER |
| Ga0334722_100316101 | 3300033233 | Sediment | VISSPEQLASCDAVVVVSWNVDLALRDEAARELPQATSLPAYYPAVVLKRQPPS |
| ⦗Top⦘ |