NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F101285

Metagenome / Metatranscriptome Family F101285

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F101285
Family Type Metagenome / Metatranscriptome
Number of Sequences 102
Average Sequence Length 65 residues
Representative Sequence ATKLVNLVGSNYVMGLAFGRDGKLYATDAFPNSGLYRIDTKTGFETAIAALPFGSSSDLVLMNPGG
Number of Associated Samples 81
Number of Associated Scaffolds 102

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 2.97 %
% of genes near scaffold ends (potentially truncated) 94.12 %
% of genes from short scaffolds (< 2000 bps) 90.20 %
Associated GOLD sequencing projects 75
AlphaFold2 3D model prediction Yes
3D model pTM-score0.51

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (63.725 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil
(54.902 % of family members)
Environment Ontology (ENVO) Unclassified
(76.471 % of family members)
Earth Microbiome Project Ontology (EMPO) Unclassified
(50.000 % of family members)



 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      


 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 7.45%    β-sheet: 24.47%    Coil/Unstructured: 68.09%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  
pTM-score: 0.51
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.


 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 102 Family Scaffolds
PF00374NiFeSe_Hases 2.94
PF01609DDE_Tnp_1 1.96
PF01494FAD_binding_3 1.96
PF00211Guanylate_cyc 1.96
PF07883Cupin_2 1.96
PF00226DnaJ 0.98
PF00561Abhydrolase_1 0.98
PF07366SnoaL 0.98
PF01527HTH_Tnp_1 0.98
PF13378MR_MLE_C 0.98
PF10935DUF2637 0.98
PF13683rve_3 0.98
PF13424TPR_12 0.98
PF03575Peptidase_S51 0.98
PF07676PD40 0.98
PF13655RVT_N 0.98
PF00313CSD 0.98
PF12728HTH_17 0.98
PF02371Transposase_20 0.98
PF13701DDE_Tnp_1_4 0.98
PF13620CarboxypepD_reg 0.98
PF15919HicB_lk_antitox 0.98
PF06267DUF1028 0.98
PF13276HTH_21 0.98
PF02585PIG-L 0.98

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 102 Family Scaffolds
COG06542-polyprenyl-6-methoxyphenol hydroxylase and related FAD-dependent oxidoreductasesEnergy production and conversion [C] 3.92
COG0374Ni,Fe-hydrogenase I large subunitEnergy production and conversion [C] 2.94
COG3259Coenzyme F420-reducing hydrogenase, alpha subunitEnergy production and conversion [C] 2.94
COG0578Glycerol-3-phosphate dehydrogenaseEnergy production and conversion [C] 1.96
COG0644Dehydrogenase (flavoprotein)Energy production and conversion [C] 1.96
COG0665Glycine/D-amino acid oxidase (deaminating)Amino acid transport and metabolism [E] 1.96
COG2114Adenylate cyclase, class 3Signal transduction mechanisms [T] 1.96
COG3039Transposase and inactivated derivatives, IS5 familyMobilome: prophages, transposons [X] 1.96
COG3293TransposaseMobilome: prophages, transposons [X] 1.96
COG3385IS4 transposase InsGMobilome: prophages, transposons [X] 1.96
COG5421TransposaseMobilome: prophages, transposons [X] 1.96
COG5433Predicted transposase YbfD/YdcC associated with H repeatsMobilome: prophages, transposons [X] 1.96
COG5659SRSO17 transposaseMobilome: prophages, transposons [X] 1.96
COG2120N-acetylglucosaminyl deacetylase, LmbE familyCarbohydrate transport and metabolism [G] 0.98
COG3342Uncharacterized conserved protein, Ntn-hydrolase superfamilyGeneral function prediction only [R] 0.98
COG3547TransposaseMobilome: prophages, transposons [X] 0.98


 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms63.73 %
UnclassifiedrootN/A36.27 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
3300003373|JGI25407J50210_10152801Not Available568Open in IMG/M
3300005332|Ga0066388_107234594Not Available558Open in IMG/M
3300005541|Ga0070733_10760954All Organisms → cellular organisms → Bacteria650Open in IMG/M
3300006031|Ga0066651_10239776All Organisms → cellular organisms → Bacteria961Open in IMG/M
3300006057|Ga0075026_100344416All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Ktedonobacteria → Ktedonobacterales → Ktedonobacteraceae → Ktedonobacter825Open in IMG/M
3300006354|Ga0075021_10271970Not Available1046Open in IMG/M
3300006800|Ga0066660_10825630Not Available755Open in IMG/M
3300010379|Ga0136449_104333416Not Available524Open in IMG/M
3300012203|Ga0137399_10895549All Organisms → cellular organisms → Bacteria747Open in IMG/M
3300015371|Ga0132258_12160731All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1398Open in IMG/M
3300016270|Ga0182036_10743688All Organisms → cellular organisms → Bacteria → Terrabacteria group796Open in IMG/M
3300016294|Ga0182041_10278008Not Available1377Open in IMG/M
3300016341|Ga0182035_11265227All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia660Open in IMG/M
3300016341|Ga0182035_11528940All Organisms → cellular organisms → Bacteria601Open in IMG/M
3300016341|Ga0182035_12101230Not Available513Open in IMG/M
3300016357|Ga0182032_10465434Not Available1034Open in IMG/M
3300016357|Ga0182032_11824383All Organisms → cellular organisms → Bacteria532Open in IMG/M
3300016371|Ga0182034_12023986All Organisms → cellular organisms → Bacteria509Open in IMG/M
3300016387|Ga0182040_11153165Not Available651Open in IMG/M
3300016387|Ga0182040_11568422All Organisms → cellular organisms → Bacteria560Open in IMG/M
3300016422|Ga0182039_10800894Not Available836Open in IMG/M
3300016422|Ga0182039_11055907Not Available730Open in IMG/M
3300016422|Ga0182039_11304116Not Available658Open in IMG/M
3300016445|Ga0182038_10876857All Organisms → cellular organisms → Bacteria790Open in IMG/M
3300017942|Ga0187808_10527443Not Available549Open in IMG/M
3300017966|Ga0187776_10851995All Organisms → cellular organisms → Bacteria658Open in IMG/M
3300018468|Ga0066662_12803341Not Available517Open in IMG/M
3300018482|Ga0066669_11855386All Organisms → cellular organisms → Bacteria559Open in IMG/M
3300020581|Ga0210399_10332725All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Streptomyces1268Open in IMG/M
3300021178|Ga0210408_10078455All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii2588Open in IMG/M
3300021178|Ga0210408_10801777All Organisms → cellular organisms → Bacteria737Open in IMG/M
3300021420|Ga0210394_11793852All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia512Open in IMG/M
3300021475|Ga0210392_10491510All Organisms → cellular organisms → Bacteria903Open in IMG/M
3300021478|Ga0210402_11893656Not Available522Open in IMG/M
3300025905|Ga0207685_10555460Not Available611Open in IMG/M
3300028047|Ga0209526_10526110All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium767Open in IMG/M
3300031094|Ga0308199_1042797All Organisms → cellular organisms → Bacteria861Open in IMG/M
3300031543|Ga0318516_10124966All Organisms → cellular organisms → Bacteria1468Open in IMG/M
3300031544|Ga0318534_10582183Not Available637Open in IMG/M
3300031544|Ga0318534_10855090All Organisms → cellular organisms → Bacteria510Open in IMG/M
3300031549|Ga0318571_10079266All Organisms → cellular organisms → Bacteria1039Open in IMG/M
3300031640|Ga0318555_10084442Not Available1657Open in IMG/M
3300031668|Ga0318542_10501088Not Available631Open in IMG/M
3300031679|Ga0318561_10281124All Organisms → cellular organisms → Bacteria909Open in IMG/M
3300031680|Ga0318574_10258657Not Available1008Open in IMG/M
3300031708|Ga0310686_100732702All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae4308Open in IMG/M
3300031719|Ga0306917_10955567Not Available670Open in IMG/M
3300031744|Ga0306918_10389315All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia1085Open in IMG/M
3300031747|Ga0318502_10588494Not Available670Open in IMG/M
3300031748|Ga0318492_10815640Not Available503Open in IMG/M
3300031764|Ga0318535_10233950Not Available822Open in IMG/M
3300031765|Ga0318554_10083763All Organisms → cellular organisms → Bacteria1781Open in IMG/M
3300031765|Ga0318554_10449373All Organisms → cellular organisms → Bacteria730Open in IMG/M
3300031768|Ga0318509_10331173All Organisms → cellular organisms → Bacteria852Open in IMG/M
3300031769|Ga0318526_10222885Not Available771Open in IMG/M
3300031771|Ga0318546_10060441All Organisms → cellular organisms → Bacteria2389Open in IMG/M
3300031778|Ga0318498_10367835Not Available641Open in IMG/M
3300031782|Ga0318552_10554929All Organisms → cellular organisms → Bacteria586Open in IMG/M
3300031793|Ga0318548_10211046All Organisms → cellular organisms → Bacteria953Open in IMG/M
3300031796|Ga0318576_10549308All Organisms → cellular organisms → Bacteria544Open in IMG/M
3300031797|Ga0318550_10235042All Organisms → cellular organisms → Bacteria888Open in IMG/M
3300031798|Ga0318523_10096892All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii1444Open in IMG/M
3300031799|Ga0318565_10540618All Organisms → cellular organisms → Bacteria561Open in IMG/M
3300031821|Ga0318567_10375387All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → Pseudonocardiaceae → Gandjariella → Gandjariella thermophila805Open in IMG/M
3300031846|Ga0318512_10430641Not Available665Open in IMG/M
3300031859|Ga0318527_10498586All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia519Open in IMG/M
3300031879|Ga0306919_10106428All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales → Mycobacteriaceae → Mycobacterium1983Open in IMG/M
3300031879|Ga0306919_11159555All Organisms → cellular organisms → Bacteria588Open in IMG/M
3300031893|Ga0318536_10201950All Organisms → cellular organisms → Bacteria → Terrabacteria group1012Open in IMG/M
3300031894|Ga0318522_10070591All Organisms → cellular organisms → Bacteria1263Open in IMG/M
3300031894|Ga0318522_10197041All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia762Open in IMG/M
3300031912|Ga0306921_10132220All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia2913Open in IMG/M
3300031912|Ga0306921_11684494Not Available686Open in IMG/M
3300031945|Ga0310913_10375256All Organisms → cellular organisms → Bacteria1008Open in IMG/M
3300031946|Ga0310910_10211918Not Available1505Open in IMG/M
3300031946|Ga0310910_10464810All Organisms → cellular organisms → Bacteria1004Open in IMG/M
3300031947|Ga0310909_10072280All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia2713Open in IMG/M
3300031947|Ga0310909_10722485All Organisms → cellular organisms → Bacteria827Open in IMG/M
3300031954|Ga0306926_10858869Not Available1090Open in IMG/M
3300031954|Ga0306926_12089014All Organisms → cellular organisms → Bacteria634Open in IMG/M
3300031959|Ga0318530_10461755Not Available527Open in IMG/M
3300032008|Ga0318562_10310825All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → unclassified Actinobacteria → Actinobacteria bacterium 21-73-9916Open in IMG/M
3300032009|Ga0318563_10300586All Organisms → cellular organisms → Bacteria868Open in IMG/M
3300032035|Ga0310911_10804646Not Available543Open in IMG/M
3300032043|Ga0318556_10607554All Organisms → cellular organisms → Bacteria570Open in IMG/M
3300032052|Ga0318506_10014732All Organisms → cellular organisms → Bacteria2727Open in IMG/M
3300032055|Ga0318575_10231447All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii931Open in IMG/M
3300032063|Ga0318504_10324000All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii731Open in IMG/M
3300032066|Ga0318514_10125584All Organisms → cellular organisms → Bacteria1318Open in IMG/M
3300032076|Ga0306924_10087422All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Methylococcales → Methylococcaceae3504Open in IMG/M
3300032076|Ga0306924_12490989Not Available519Open in IMG/M
3300032089|Ga0318525_10325134All Organisms → cellular organisms → Bacteria790Open in IMG/M
3300032090|Ga0318518_10328127All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia785Open in IMG/M
3300032094|Ga0318540_10041642All Organisms → cellular organisms → Bacteria2032Open in IMG/M
3300032094|Ga0318540_10570976Not Available545Open in IMG/M
3300032261|Ga0306920_100220895All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia2827Open in IMG/M
3300032261|Ga0306920_100871020All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia1318Open in IMG/M
3300032261|Ga0306920_101536268All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii949Open in IMG/M
3300032261|Ga0306920_102747876Not Available671Open in IMG/M
3300033289|Ga0310914_11173488Not Available669Open in IMG/M
3300033289|Ga0310914_11542164All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia568Open in IMG/M



 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil54.90%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil27.45%
WatershedsEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds1.96%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil1.96%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Soil1.96%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil1.96%
Freshwater SedimentEnvironmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment0.98%
Vadose Zone SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil0.98%
Surface SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil0.98%
Peatlands SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil0.98%
Tropical PeatlandEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland0.98%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil0.98%
Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil0.98%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere0.98%
Arabidopsis RhizosphereHost-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere0.98%
Tabebuia Heterophylla RhizosphereHost-Associated → Plants → Roots → Rhizosphere → Unclassified → Tabebuia Heterophylla Rhizosphere0.98%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
3300003373Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1Host-AssociatedOpen in IMG/M
3300005332Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly)EnvironmentalOpen in IMG/M
3300005541Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen05_05102014_R1EnvironmentalOpen in IMG/M
3300006031Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Angelo_100EnvironmentalOpen in IMG/M
3300006057Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Straight Creek_MetaG_SC_2012EnvironmentalOpen in IMG/M
3300006354Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2012EnvironmentalOpen in IMG/M
3300006800Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_109EnvironmentalOpen in IMG/M
3300010379Sb_50d combined assemblyEnvironmentalOpen in IMG/M
3300012203Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz3.16 metaGEnvironmentalOpen in IMG/M
3300015371Combined assembly of cpr5 and col0 rhizosphere and soilHost-AssociatedOpen in IMG/M
3300016270Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080EnvironmentalOpen in IMG/M
3300016294Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178EnvironmentalOpen in IMG/M
3300016341Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170EnvironmentalOpen in IMG/M
3300016357Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.000EnvironmentalOpen in IMG/M
3300016371Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.172EnvironmentalOpen in IMG/M
3300016387Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176EnvironmentalOpen in IMG/M
3300016422Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111EnvironmentalOpen in IMG/M
3300016445Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108EnvironmentalOpen in IMG/M
3300017942Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW_3EnvironmentalOpen in IMG/M
3300017966Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_BV02_MP12_20_MGEnvironmentalOpen in IMG/M
3300018468Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_111EnvironmentalOpen in IMG/M
3300018482Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_118EnvironmentalOpen in IMG/M
3300020581Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-MEnvironmentalOpen in IMG/M
3300021178Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-4-MEnvironmentalOpen in IMG/M
3300021420Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-12-MEnvironmentalOpen in IMG/M
3300021475Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-30-OEnvironmentalOpen in IMG/M
3300021478Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-MEnvironmentalOpen in IMG/M
3300025905Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300028047Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM2H0_M1 (SPAdes)EnvironmentalOpen in IMG/M
3300031094Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_203 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300031543Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f20EnvironmentalOpen in IMG/M
3300031544Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.117b4f26EnvironmentalOpen in IMG/M
3300031549Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f24EnvironmentalOpen in IMG/M
3300031640Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f23EnvironmentalOpen in IMG/M
3300031668Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.168b4f23EnvironmentalOpen in IMG/M
3300031679Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f23EnvironmentalOpen in IMG/M
3300031680Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f22EnvironmentalOpen in IMG/M
3300031708FICUS49499 Metagenome Czech Republic combined assemblyEnvironmentalOpen in IMG/M
3300031719Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.000 (v2)EnvironmentalOpen in IMG/M
3300031724Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.174b1f20EnvironmentalOpen in IMG/M
3300031744Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.00H (v2)EnvironmentalOpen in IMG/M
3300031747Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.174b1f22EnvironmentalOpen in IMG/M
3300031748Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.108b1f22EnvironmentalOpen in IMG/M
3300031764Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.117b4f27EnvironmentalOpen in IMG/M
3300031765Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f22EnvironmentalOpen in IMG/M
3300031768Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f22EnvironmentalOpen in IMG/M
3300031769Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f24EnvironmentalOpen in IMG/M
3300031771Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f19EnvironmentalOpen in IMG/M
3300031778Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.109b1f24EnvironmentalOpen in IMG/M
3300031782Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f20EnvironmentalOpen in IMG/M
3300031793Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f21EnvironmentalOpen in IMG/M
3300031796Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f24EnvironmentalOpen in IMG/M
3300031797Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f23EnvironmentalOpen in IMG/M
3300031798Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f19EnvironmentalOpen in IMG/M
3300031799Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.066b5f21EnvironmentalOpen in IMG/M
3300031821Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f20EnvironmentalOpen in IMG/M
3300031846Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.171b2f19EnvironmentalOpen in IMG/M
3300031859Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f25EnvironmentalOpen in IMG/M
3300031879Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.172 (v2)EnvironmentalOpen in IMG/M
3300031893Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.117b4f28EnvironmentalOpen in IMG/M
3300031894Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f18EnvironmentalOpen in IMG/M
3300031912Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080 (v2)EnvironmentalOpen in IMG/M
3300031945Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.OX082EnvironmentalOpen in IMG/M
3300031946Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.HF172EnvironmentalOpen in IMG/M
3300031947Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.T000HEnvironmentalOpen in IMG/M
3300031954Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178 (v2)EnvironmentalOpen in IMG/M
3300031959Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f24EnvironmentalOpen in IMG/M
3300032008Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.066b5f18EnvironmentalOpen in IMG/M
3300032009Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.066b5f19EnvironmentalOpen in IMG/M
3300032035Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.HF170EnvironmentalOpen in IMG/M
3300032043Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f24EnvironmentalOpen in IMG/M
3300032052Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f19EnvironmentalOpen in IMG/M
3300032055Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f23EnvironmentalOpen in IMG/M
3300032063Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f17EnvironmentalOpen in IMG/M
3300032066Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f18EnvironmentalOpen in IMG/M
3300032076Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111 (v2)EnvironmentalOpen in IMG/M
3300032089Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f23EnvironmentalOpen in IMG/M
3300032090Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f22EnvironmentalOpen in IMG/M
3300032094Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.166b4f25EnvironmentalOpen in IMG/M
3300032261Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 (v2)EnvironmentalOpen in IMG/M
3300033289Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.AN108EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap



 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
JGI25407J50210_1015280113300003373Tabebuia Heterophylla RhizosphereVNLVGSNLVMGLAFGRSGKLFATDFMQNPGLYLIDMKTGFETAIAALPFGFSSGLELIPQRKARKTNRPG*
Ga0066388_10723459423300005332Tropical Forest SoilATKIVNLVGSMAVMGLAFGRDGKLYGTDFVQNPGLYRIDIKTGFETAIAALPFGFSSALELAD*
Ga0070733_1076095423300005541Surface SoilDPATGAATKLVNLVGSNSVMGLAFGRDGKLFATDFTQNPGLYQIDPETGFEKAIAALPFGFSSSLELANPDEENGN*
Ga0066651_1023977623300006031SoilIVDLVGSNSVMGLAFGRNGQLYASDFAPNPRLYRIEIETGVETAIAALPFGFSSGLELANPQEPRQ*
Ga0075026_10034441613300006057WatershedsKATRLVNLVGSNSVMGLAFGRDGKLYATDNPQNPGLYLLDANTGFETAIAAVPFGFSSDLVLVNPD*
Ga0075021_1027197013300006354WatershedsTTGKATRLVNLVGSNSVMGLAFGRDGLLYATDNPQNPGLYLLDAKTGFETAIAAVPFGFSSDLVLVNPD*
Ga0066660_1082563023300006800SoilTATKLFNLVGSTSVMGLAFGRDGKLYATDNPQNPGLYRIGTTTGFEAAIAALPFGFSSGLELINPGG*
Ga0136449_10433341613300010379Peatlands SoilNLVGSNYVMGLAFGRDGKLYATDDSQNPGLYRINTRTGFETAIAALPFGFSSGLELIGSGG*
Ga0137399_1089554923300012203Vadose Zone SoilDPATGAATKVVNLVGSNLVMGLAFGREGKLYATDFEEHPGLYLVTQTGLETAIAALPFGFSSALELANPVATH*
Ga0132258_1216073113300015371Arabidopsis RhizosphereAATKLFNLVGSNLVMGLAFGRDGKLYATDNFPNSGLYVIGAKTGFETAIAALPFGFSSDLVLMGSGG*
Ga0182036_1074368833300016270SoilATKLVNLVGSNLVMGLAFGRDGKLYATDNFPNSGMYVIDTTTGVETTIAALPFGFSSDLVLMNPDE
Ga0182041_1027800813300016294SoilVMGLAFGRDGKLYATDNFPNSGLYRIDTKTGLETAIAALPFGSSSDLVLMN
Ga0182035_1126522713300016341SoilLAFGRDGKLYATDNFQNSGLYVIGTKTGFETAIAALPFGFSSDLVLMD
Ga0182035_1152894013300016341SoilLVNLVGSNLVMGLAFGRDGKLYATDNFPNSGLYVIDAKTGFETAIAALPFGFSSDLVLMDSGG
Ga0182035_1210123013300016341SoilNLMMGLAFGRDGKLYGTDNFPNSGLYLIGAKTGFETAIAALPFGFSSDLVLMGSGG
Ga0182032_1046543413300016357SoilPLFNLTGPSNYVMGLAFGRDGKLYATDNFNPSGLYLIGTKTGAETTIAALPFGSSSDLVLMNPGE
Ga0182032_1182438313300016357SoilATKLVNLVGSNYVMGLAFGRDGKLYATDAFPNAGLYRIDTKTGFETAIAALPFGSSSDLVLMNSGG
Ga0182034_1202398613300016371SoilKATKLFNLVGSNTVMGLAFGPDGRLYATDFTQNPGLYRIDTKTGFETAIAALPFGFSSGLELIGSGR
Ga0182040_1115316513300016387SoilRINPATGTATKLVNLTGSNYVMGLAFGRDGKLYATDAFANPGLYRVGAATGLETAIAALPFGFSSGLELMNPGG
Ga0182040_1156842213300016387SoilVGSNYVMGLAFGRDGKLYGTDAFPNSGLYRIDPKTGFETAIAALPFGSSSDLVLMNPGG
Ga0182039_1080089423300016422SoilGKATKLVNLVGSNYVMGLAFGRDGTLYATDAFANPGLYRVGAATGLETAIAALPFGFSSGLELMNPGG
Ga0182039_1105590723300016422SoilVGSNLVMGLAFGRNGKLYATDNFPNSGMYVIDDNTGFETAIAALPFGFSSDLVLMN
Ga0182039_1130411623300016422SoilYRINLATGTATKLVNLVGSNYVMGLAFGRDGKLYATDAFPNSGLYRIDTTTGLETTIAALPFGSSSDLVLMNPGG
Ga0182038_1087685713300016445SoilGSNLVMGLAFGRDGKLYATDNFPNSGLYVIDAKTGFETAIAALPFGFSSDLVLMDSGG
Ga0187808_1052744313300017942Freshwater SedimentVNLVGSNTVMGLAFGRDGKLYATDFVQNPGLYRIDTATGFETAIAALPFGFSSGLELTG
Ga0187776_1085199513300017966Tropical PeatlandMGLAFGRDGKLYATDNFPSSGLYLIDPKTGFETAIAALPFGSSSDLVLMDPGGSAASSPG
Ga0066662_1280334113300018468Grasslands SoilTGTATKLFNLVGSTSVMGLAFGRDGKLYATDNPQNPGLYRIGTTTGFEAAIAALPFGFSSGLELINPGG
Ga0066669_1185538613300018482Grasslands SoilYRIDPTTGAATKLFNLVGSNLVMGLAFGRDGKLYATDNFPNSGLYVIDTKTGFETAIAALPFGFSSDLVLMGSGG
Ga0210399_1033272533300020581SoilATKLFNLVGSNLVMGLAFGRDGKLYATDNFPNSGLYRIDTKTGFETAIAALPFGFSSDLVLMNQGR
Ga0210408_1007845513300021178SoilLAFGRDGKLYATDNFPNSGLYVIDTKTGFETAIAALPFGFSSDLVLMGSSG
Ga0210408_1080177723300021178SoilLFNLVGSNLVMGLAFGRDGKLYATDNFPNSGLYVIDTKTGFETAIAALPFGFSSDLVLMGSGG
Ga0210394_1179385223300021420SoilMGLAFGRNGKLYATDNFPDSGLYVIDTKTGFETAIAALPFGFSSDLVLMNQGR
Ga0210392_1049151033300021475SoilRIDPATGAATKLFNLVGSNLVMGLAFGRDGKLYATDNFPDSGLYVIDTKTGFETAIAALPFGFSSDLVLMGSGG
Ga0210402_1189365613300021478SoilATKLFNLVGSNLVMGLAFGRNGKLYATDNFPDSGLYVIDTKTGFETAIAALPFGFSSDLVLMNQGR
Ga0207685_1055546023300025905Corn, Switchgrass And Miscanthus RhizosphereMGLAFGRDGKLYATDNFPNSGLYVIDTKTGFETAIAALPFGFSSDLVLMGSGG
Ga0209526_1052611013300028047Forest SoilPETGKATKIANLVGSNSVMGLAFGRQGKLYATDFAQNPGLYLIDIKTGFETAIAALPFGFSSSLELANPDHEIGN
Ga0308199_104279723300031094SoilGAATKIVNLVGSNSVMGLAFGREGKLYATDFAQKPGLYLIDIKTGFETAIAALPFGFSSGLELANPSLPESDGDQ
Ga0318516_1012496613300031543SoilLYRINLATGTATKLVNLVGSNYVMGLAFGRDGKLYATDAFPNSGLYRIDTKTGFETAIAALPFGSSSDLVLMNPRG
Ga0318534_1058218323300031544SoilFGRNGKLYATDNFNPSGLYVIDTKTGAETTIAALPFGFSSDLVLMNPGE
Ga0318534_1085509013300031544SoilLYRINPATGTATKLANLVGSNYVMGLAFGRDGKLYATDAFPNSGLYRIDTKTGFETAIAALPFGSSSDLVLMNPGG
Ga0318571_1007926623300031549SoilMGLAFGRDGKLYATDNFNPSGLYVIDTKTGAETTIAALPFGFSSDLVLMNPDE
Ga0318555_1008444223300031640SoilYRINLATGTATKLVNLVGSNYVMGLAFGRDGKLYATDAFPNSGLYRIDTKTGFETAIAALPFGSSSDLVLMNPGG
Ga0318542_1050108823300031668SoilVNLVGSNLVMGLAFGRNGKLYATDNFPNSGMYVIDDNTGFETAIAALPFGFSSDLVLMN
Ga0318561_1028112413300031679SoilVNLVGSNYVMGLAFGRDGKLYATDAFPNSGLYRIDTKTGFETAIAALPFGSSSDLVLMNPGG
Ga0318574_1025865713300031680SoilKLVNLVGSNYVMGVAFGRDGKLYATDAFPNSGLYRIDTKTGFETAIAALPFGSSSDLVLMNPGG
Ga0310686_10073270273300031708SoilFNLVGSNLVMGLAFGRDGKLYATDNFPNSGLYVIDTKTGFETAIAALPFGFSSDLVLVD
Ga0306917_1095556713300031719SoilMGLAFGRNGKLYATDNFNPSGLYVIDTKTGAETTIAALPFGSSSDLVLMNPGE
Ga0318500_1031192423300031724SoilDPATGTATKLVNLVGSNTVMGLAFGRDGKLYGTDFVQNPGLYRIDPATGFQTAIAALPFGFSSGLELMN
Ga0306918_1038931513300031744SoilNLATGTATKLVNLVGSNYVMGLAFGRDGKLYATDAFPNSGLYRIDTKTGFETAIAALPFGSSSDLVLMNPGG
Ga0318502_1058849413300031747SoilLFNLTGPSNYVMGLAFGRDGKLYATDNFNPSGLYVIGTKTGAETTIAALPFGFSSDLVLMNPGE
Ga0318492_1081564013300031748SoilAILYRINLATGTATKLVNLVGSNYVMGVAFGRDGKLYATDAFPNSGLYRIDTKTGFETAIAALPFGSSSDLVLMNPGG
Ga0318535_1023395013300031764SoilLVGSNYVMGVAFGRDGKLYATDAFPNSGLYRIDTKTGFETAIAALPFGSSSDLVLMNPGG
Ga0318554_1008376323300031765SoilNLVGSNYVMGLAFGRDGKLYATDAFPNSGLYRIDTKTGFETAIAALPFGSSSDLVLMNPG
Ga0318554_1044937313300031765SoilILYRINAATGTATKLVNLVGSNYVMGLAFGRDGKLYATDAFPNSGLYRIDTKTGFETAIAALPFGSSSDLVLMNPGG
Ga0318509_1033117313300031768SoilLYRINLATGTATKLVNLVGSNYVMGLAFGRDGKLYATDAFPNAGLYRIDTKTGFETAIAALPFGSSSDLVLMNPRG
Ga0318526_1022288513300031769SoilLVNLVGSNYVMGVAFGRDGKLYATDAFPNSGLYRIDTKTGFETAIAALPFGSSSDLVLMNPGG
Ga0318546_1006044113300031771SoilLLMGLAFGRDGKLYATDNFPNSGLYVIDAKTGFETAIAALPFGFSSDLELMN
Ga0318498_1036783523300031778SoilLVGSNLVMGLAFGRNGKLYATDNFPNSGMYVIDDNTGFETAIAALPFGFSSDLVLMN
Ga0318552_1055492913300031782SoilLATGTATKLVNLVGSNYVMGLAFGRDGKLYATDAFPNSGLYRIDTKTGFETAIAALPFGSSSDLVLMNPRG
Ga0318548_1021104613300031793SoilTATKLVNLVGSNYVMGLAFGRDGKLYATDAFPNSGLYRIDTKTGFETAIAALPFGSSSDLVLMNPGG
Ga0318576_1054930823300031796SoilTKLVNLIGSNLVMGLAFGRDGKLYATDNFPNSGLYVIDAKTGFETAIAALPFGFSSDLELMN
Ga0318550_1023504213300031797SoilINLATGTATKLVNLVGSNYVMGLAFGRDGKLYATDAFPNSGLYRIDTKTGFETAIAALPFGSSSDLVLMNPGG
Ga0318523_1009689213300031798SoilVMGLAFGRNGKLYATDNFPNSGLYVIDTKTGFETAIAALPFGFSSDLVLMN
Ga0318565_1054061813300031799SoilLATGTATKLVNLVGSNYVMGLAFGRDGKLYATDAFPNAGLYRIDTKTGFETAIAALPFGSSSDLVLMNPDG
Ga0318567_1037538713300031821SoilMGLAFGRNGKLYATDNFNPSGLYVIDTKTGAETTIAALPFGFSSDLVLMNPGE
Ga0318512_1043064113300031846SoilTGTATKLVNLTGSNYVMGLAFGRDGKLYATDAFANPGLYRVGATTGLETAIAALPFGFSSGLELMNPSG
Ga0318527_1049858623300031859SoilTKLFDLTGPSNYLMGLAFGRDGKLYATDNFNPSGLYVIDTKTGAETTIAALPFGFSSDLVLMSPDE
Ga0306919_1010642813300031879SoilILYRINAATGTATKLVNLVGSNYVMGLAFGRDGKLYATDAFPNAGLYRIDTKTGFETAIAALPFGSSSDLVLMNPRG
Ga0306919_1115955513300031879SoilTGKATKLFNLVGSNTVMGLAFGPDGKLYATDFTQNPGLYRIDTKTGFETAIAALPFGFSSGLELIGSGR
Ga0318536_1020195023300031893SoilLVMGLAFGRNGKLYGTDNFPNSGLYLIDAKTGFETAIAALPFGFSSDLVLMNQRG
Ga0318522_1007059123300031894SoilVNLVGSNYVMGLAFGRDGRLYATDAFPNSGLYRIDTKTGFETAIAALPFGSSSDLVLMNPGG
Ga0318522_1019704123300031894SoilLVGSNYVMGLAFGRDGKLYATDAFPNSGLYRIDTKTGFETAIAALPFGSSSDLVLMNPGG
Ga0306921_1013222043300031912SoilNYVMGLAFGRDGKLYATDNFNPSGLYVIGTKTGAETTIAALPFGSSSDLVLMNPDE
Ga0306921_1168449413300031912SoilTKLVNLVGSNLVMGLAFGRNGKLYGTDNFPNSGLYLIDAKTGFETAIAALPFGFSSDLVLMNQRG
Ga0310913_1037525613300031945SoilLYRIDPAKGTATKLVNLVGSNYVMGLAFGRDGKLYGTDAFPNSGLYRIDPKTGFETAIAALPFGSSSDLVLMNPGG
Ga0310910_1021191823300031946SoilRTGQAAPLFNLTGPSNYVMGLAFGRDGKLYATDNFNPSGLYVIGTKTGAETTIAALPFGSSSDLVLMNPGE
Ga0310910_1046481023300031946SoilIDPAKGTATKLVNLVGSNYVMGLAFGRDGKLYGTDAFPNSGLYRIDPKTGFETAIAALPFGSSSDLVLMNPGG
Ga0310909_1007228013300031947SoilIGSNLVMGLAFGRDGKLYATDNFPNSGLYVIDAKTGFETAIAALPFGFSSDLELMN
Ga0310909_1072248513300031947SoilGTATKLVNLVGSNYVMGLAFGRDGKLYGTDAFPNSGLYRIDPKTGFETAIAALPFGSSSDLVLMNPRG
Ga0306926_1085886913300031954SoilATGKATKLVNLVGSNYVMGLAFGRDGKLYGTDAFANPGLYRVGATTGLQTAIAALPFGFPAAWN
Ga0306926_1208901413300031954SoilAATGTATKLVNLVGSNYVMGLAFGRDGKLYATDAFPNSGLYRIDTKTGFETAIAALPFGSSSDLVLMNPGG
Ga0318530_1046175513300031959SoilIDPATGTAAKLFNLVGSNLVMGLAFGRNGKLYATDNFPNSGLYVIDTKTGFETAIAALPFGFSSDLVLMN
Ga0318562_1031082513300032008SoilATGTATPLFNLTGPSNYVMGLAFGRDGKLYATDNFNPSGLYVIDTKTGAETTIAALPFGFSSDLVLMNPDE
Ga0318563_1030058613300032009SoilATKLVNLVGSNYVMGLAFGRDGKLYATDAFPNSGLYRIDTKTGFETAIAALPFGSSSDLVLMNPGG
Ga0310911_1080464613300032035SoilGLAFGRNGKLYATDNFPNSGLYVIDTKTGFETAIAALPFGFSSDLVLMS
Ga0318556_1060755413300032043SoilLVGSNYVMGLAFGRDGKLYATDAFPNAGLYRIDTKTGFETAIAALPFGSSSDLVLMNPDG
Ga0318506_1001473233300032052SoilVNLVGSNYVMGLAFGRDGKLYATDAFPNAGLYRIDTKTGFETAIAALPFGSSSDLVLMNPRG
Ga0318575_1023144723300032055SoilFNLVGSNLVMGLAFGRNGKLYATDNFPNSGLYVIDTKTGFETAIAALPFGFSSDLVLMN
Ga0318504_1032400023300032063SoilPATGTATKLVNLVGSNTVMGLAFGRDGKLYATDFVQNPGLYRIDPATGFQTAIAALPFGSSSGLELTG
Ga0318514_1012558423300032066SoilTNLVGSNLVMGLAFGRDGKLYATDNFPNSGLYVIDAKTGFETAIAALPFGFSSDLVLMDSGG
Ga0306924_1008742233300032076SoilTGTATKLVNLVGSNYVMGLAFGRDGKLYATDAFPNSGLYRIDTKTGFETAIAALPFGSSSDLVLMNPGG
Ga0306924_1249098913300032076SoilTGTATKLVNLVGSNLMMGLAFGRNGKLYGTDNFPNSGLYLIDAKTGFETAIAALPFGFSSDLVLMN
Ga0318525_1032513423300032089SoilRINPATGTATKLANLVGSNYVMGLAFGRDGKLYATDAFPNSGLYRIDTKTGFETAIAALPFGSSSDLVLMNPGG
Ga0318518_1032812723300032090SoilYRVNPATGTATKLVNLVGSNYVMGLAFGRDGRLYATDAFPNSGLYRIDTKTGFETAIAALPFGSSSDLVLMNPGG
Ga0318540_1004164213300032094SoilSNLVMGLAFGRDGKLYATDNFPNSGLYRIDTKTGFETAIAALPFGSSSDLVLMNPGG
Ga0318540_1057097613300032094SoilLYHIDPTTGTATKLVNLVGSNYVMGLAFGRDGKLYGTDNFANPGLYRIDPTTGLETAIAALPFGYSSDLVSMN
Ga0306920_10022089513300032261SoilLATGQAAPLFNLTGPSNYVMGLAFGRDGKLYATDNFNPSGLYLIGTKTGAETTIAALPFGSSSDLVLMNPGE
Ga0306920_10087102033300032261SoilTKLVNLVGSNLVMGLAFGRDGKLYATDNFPNSGLYVIDAKTGFETAIAALPFGFSSDLELMN
Ga0306920_10153626823300032261SoilRIDPATGTAAKLFNLVGSNLVMGLAFGRNGKLYATDNFPNSGLYVIDTKTGFETAIAALPFGFSSDLVLMN
Ga0306920_10274787613300032261SoilATKLVNLVGSNLVMGLAFGRDGKLYGTDNFADPGLYRIDPTTGFETAIAALPFGYSSDLVSVN
Ga0310914_1117348823300033289SoilGTAMKLFNLVGSNLVMGLAFGRDGKLYGTDNFANSGLYVIGTRTGFETAIAALPFGFSSDLVLMN
Ga0310914_1154216423300033289SoilLFDLTGPSNYLMGLAFGRDGKLYATDNFNPSGLYVIDTKTGAETTIAALPFGFSSDLVLMSPDE


 ⦗Top⦘


© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.