NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F101272

Metagenome / Metatranscriptome Family F101272

Go to section:
Overview Alignments Structure & Topology Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F101272
Family Type Metagenome / Metatranscriptome
Number of Sequences 102
Average Sequence Length 135 residues
Representative Sequence VPEVGVARRGSHGGLALAATAALALAAVALVYANTSSEWPGSALMSEGQRTTKLAWGGFTLAMQDEADKALRLCKVGLLGPNQHCATHVVSTDDTKWTHSDAGQPTWEESQMVLSRQSSVIPRGPDIGTPGDFGDRR
Number of Associated Samples 91
Number of Associated Scaffolds 102

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Eukaryota
% of genes with valid RBS motifs 15.69 %
% of genes near scaffold ends (potentially truncated) 84.31 %
% of genes from short scaffolds (< 2000 bps) 96.08 %
Associated GOLD sequencing projects 87
AlphaFold2 3D model prediction No

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Eukaryota (100.000 % of family members)
NCBI Taxonomy ID 2759
Taxonomy All Organisms → cellular organisms → Eukaryota

Most Common Ecosystem
GOLD Ecosystem Environmental → Aquatic → Marine → Oceanic → Unclassified → Seawater
(25.490 % of family members)
Environment Ontology (ENVO) Unclassified
(63.725 % of family members)
Earth Microbiome Project Ontology (EMPO) Free-living → Saline → Water (saline)
(46.078 % of family members)


 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      

 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: Yes Secondary Structure distribution: α-helix: 33.58%    β-sheet: 1.46%    Coil/Unstructured: 64.96%
Feature Viewer
Powered by Feature Viewer

 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms100.00 %
UnclassifiedrootN/A0.00 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
3300004769|Ga0007748_11296555All Organisms → cellular organisms → Eukaryota → Cryptophyceae809Open in IMG/M
3300004788|Ga0007742_10915618All Organisms → cellular organisms → Eukaryota → Cryptophyceae741Open in IMG/M
3300004790|Ga0007758_11056958All Organisms → cellular organisms → Eukaryota → Cryptophyceae659Open in IMG/M
3300004836|Ga0007759_11319696All Organisms → cellular organisms → Eukaryota → Cryptophyceae661Open in IMG/M
3300005420|Ga0068879_1386582All Organisms → cellular organisms → Eukaryota → Cryptophyceae556Open in IMG/M
3300005565|Ga0068885_1860571All Organisms → cellular organisms → Eukaryota → Cryptophyceae633Open in IMG/M
3300006355|Ga0075501_1230730All Organisms → cellular organisms → Eukaryota → Cryptophyceae518Open in IMG/M
3300006419|Ga0075496_1435326All Organisms → cellular organisms → Eukaryota → Cryptophyceae → Pyrenomonadales → Geminigeraceae → Guillardia → Guillardia theta → Guillardia theta CCMP2712512Open in IMG/M
3300006602|Ga0075484_1362362All Organisms → cellular organisms → Eukaryota → Cryptophyceae → Pyrenomonadales → Geminigeraceae → Guillardia → Guillardia theta → Guillardia theta CCMP2712523Open in IMG/M
3300007516|Ga0105050_10029986All Organisms → cellular organisms → Eukaryota → Cryptophyceae → Pyrenomonadales → Geminigeraceae4446Open in IMG/M
3300007519|Ga0105055_10094467All Organisms → cellular organisms → Eukaryota → Cryptophyceae → Pyrenomonadales → Geminigeraceae → Guillardia → Guillardia theta → Guillardia theta CCMP27123127Open in IMG/M
3300007522|Ga0105053_10331367All Organisms → cellular organisms → Eukaryota → Cryptophyceae → Pyrenomonadales → Geminigeraceae → Guillardia → Guillardia theta → Guillardia theta CCMP27121354Open in IMG/M
3300007722|Ga0105051_10347644All Organisms → cellular organisms → Eukaryota → Cryptophyceae → Pyrenomonadales → Geminigeraceae → Guillardia → Guillardia theta → Guillardia theta CCMP27121113Open in IMG/M
3300009263|Ga0103872_1038601All Organisms → cellular organisms → Eukaryota → Cryptophyceae → Pyrenomonadales → Geminigeraceae → Guillardia → Guillardia theta → Guillardia theta CCMP2712665Open in IMG/M
3300009543|Ga0115099_10301813All Organisms → cellular organisms → Eukaryota → Cryptophyceae → Pyrenomonadales → Geminigeraceae → Guillardia → Guillardia theta → Guillardia theta CCMP2712727Open in IMG/M
3300009543|Ga0115099_10645536All Organisms → cellular organisms → Eukaryota → Cryptophyceae → Pyrenomonadales → Geminigeraceae → Guillardia → Guillardia theta → Guillardia theta CCMP2712776Open in IMG/M
3300009543|Ga0115099_10790611All Organisms → cellular organisms → Eukaryota → Cryptophyceae717Open in IMG/M
3300009592|Ga0115101_1221591All Organisms → cellular organisms → Eukaryota → Cryptophyceae → Pyrenomonadales → Geminigeraceae → Guillardia → Guillardia theta → Guillardia theta CCMP2712788Open in IMG/M
3300009592|Ga0115101_1256658All Organisms → cellular organisms → Eukaryota → Cryptophyceae729Open in IMG/M
3300009606|Ga0115102_10964903All Organisms → cellular organisms → Eukaryota → Cryptophyceae → Pyrenomonadales → Geminigeraceae → Guillardia → Guillardia theta → Guillardia theta CCMP2712639Open in IMG/M
3300009608|Ga0115100_10848800All Organisms → cellular organisms → Eukaryota → Cryptophyceae533Open in IMG/M
3300012272|Ga0136586_1149691All Organisms → cellular organisms → Eukaryota → Cryptophyceae → Pyrenomonadales → Geminigeraceae → Guillardia → Guillardia theta → Guillardia theta CCMP2712573Open in IMG/M
3300012408|Ga0138265_1005935All Organisms → cellular organisms → Eukaryota → Cryptophyceae879Open in IMG/M
3300012414|Ga0138264_1027301All Organisms → cellular organisms → Eukaryota → Cryptophyceae875Open in IMG/M
3300012415|Ga0138263_1601537All Organisms → cellular organisms → Eukaryota → Cryptophyceae886Open in IMG/M
3300012416|Ga0138259_1593273All Organisms → cellular organisms → Eukaryota → Cryptophyceae → Pyrenomonadales → Geminigeraceae → Guillardia → Guillardia theta → Guillardia theta CCMP2712869Open in IMG/M
3300012418|Ga0138261_1172495All Organisms → cellular organisms → Eukaryota → Cryptophyceae888Open in IMG/M
3300012760|Ga0138273_1019740All Organisms → cellular organisms → Eukaryota → Cryptophyceae594Open in IMG/M
3300012767|Ga0138267_1169887All Organisms → cellular organisms → Eukaryota → Cryptophyceae → Pyrenomonadales → Geminigeraceae → Guillardia → Guillardia theta → Guillardia theta CCMP2712796Open in IMG/M
3300012782|Ga0138268_1725972All Organisms → cellular organisms → Eukaryota → Cryptophyceae879Open in IMG/M
3300012935|Ga0138257_1126017All Organisms → cellular organisms → Eukaryota → Cryptophyceae872Open in IMG/M
(restricted) 3300013132|Ga0172372_10988614All Organisms → cellular organisms → Eukaryota → Cryptophyceae → Pyrenomonadales → Geminigeraceae → Guillardia → Guillardia theta → Guillardia theta CCMP2712508Open in IMG/M
3300013295|Ga0170791_11702013All Organisms → cellular organisms → Eukaryota → Cryptophyceae687Open in IMG/M
3300016703|Ga0182088_1248229All Organisms → cellular organisms → Eukaryota → Cryptophyceae → Pyrenomonadales → Geminigeraceae → Guillardia → Guillardia theta → Guillardia theta CCMP2712599Open in IMG/M
3300016723|Ga0182085_1322127All Organisms → cellular organisms → Eukaryota → Cryptophyceae → Pyrenomonadales → Geminigeraceae → Guillardia → Guillardia theta → Guillardia theta CCMP2712581Open in IMG/M
3300016740|Ga0182096_1112871All Organisms → cellular organisms → Eukaryota → Cryptophyceae → Pyrenomonadales → Geminigeraceae → Guillardia → Guillardia theta → Guillardia theta CCMP2712542Open in IMG/M
3300017284|Ga0186171_1019619All Organisms → cellular organisms → Eukaryota → Cryptophyceae → Pyrenomonadales → Geminigeraceae → Guillardia → Guillardia theta → Guillardia theta CCMP2712962Open in IMG/M
3300018836|Ga0192870_1062963All Organisms → cellular organisms → Eukaryota → Cryptophyceae → Pyrenomonadales → Geminigeraceae → Guillardia → Guillardia theta → Guillardia theta CCMP2712634Open in IMG/M
3300018913|Ga0192868_10032159All Organisms → cellular organisms → Eukaryota → Cryptophyceae → Pyrenomonadales → Geminigeraceae → Guillardia → Guillardia theta → Guillardia theta CCMP2712753Open in IMG/M
3300018913|Ga0192868_10056912All Organisms → cellular organisms → Eukaryota → Cryptophyceae → Pyrenomonadales → Geminigeraceae → Guillardia → Guillardia theta → Guillardia theta CCMP2712612Open in IMG/M
3300019009|Ga0192880_10129364All Organisms → cellular organisms → Eukaryota → Cryptophyceae → Pyrenomonadales → Geminigeraceae → Guillardia → Guillardia theta → Guillardia theta CCMP2712638Open in IMG/M
3300019032|Ga0192869_10299507All Organisms → cellular organisms → Eukaryota → Cryptophyceae → Pyrenomonadales → Geminigeraceae → Guillardia → Guillardia theta → Guillardia theta CCMP2712701Open in IMG/M
3300019032|Ga0192869_10338276All Organisms → cellular organisms → Eukaryota → Cryptophyceae657Open in IMG/M
3300019095|Ga0188866_1020314All Organisms → cellular organisms → Eukaryota → Cryptophyceae → Pyrenomonadales → Geminigeraceae → Guillardia → Guillardia theta → Guillardia theta CCMP2712697Open in IMG/M
3300019149|Ga0188870_10090793All Organisms → cellular organisms → Eukaryota → Cryptophyceae739Open in IMG/M
3300019149|Ga0188870_10093021All Organisms → cellular organisms → Eukaryota → Cryptophyceae → Pyrenomonadales → Geminigeraceae → Guillardia → Guillardia theta → Guillardia theta CCMP2712728Open in IMG/M
3300021894|Ga0063099_1020974All Organisms → cellular organisms → Eukaryota → Cryptophyceae → Pyrenomonadales → Geminigeraceae → Guillardia → Guillardia theta → Guillardia theta CCMP2712509Open in IMG/M
3300021897|Ga0063873_1008211All Organisms → cellular organisms → Eukaryota → Cryptophyceae604Open in IMG/M
3300021902|Ga0063086_1036808All Organisms → cellular organisms → Eukaryota → Cryptophyceae → Pyrenomonadales → Geminigeraceae → Guillardia → Guillardia theta → Guillardia theta CCMP2712618Open in IMG/M
3300021903|Ga0063874_1007711All Organisms → cellular organisms → Eukaryota → Cryptophyceae602Open in IMG/M
3300021921|Ga0063870_1003210All Organisms → cellular organisms → Eukaryota → Cryptophyceae → Pyrenomonadales → Geminigeraceae → Guillardia → Guillardia theta → Guillardia theta CCMP2712532Open in IMG/M
3300021922|Ga0063869_1006753All Organisms → cellular organisms → Eukaryota → Cryptophyceae → Pyrenomonadales → Geminigeraceae → Guillardia → Guillardia theta → Guillardia theta CCMP2712517Open in IMG/M
3300021926|Ga0063871_1008973All Organisms → cellular organisms → Eukaryota → Cryptophyceae → Pyrenomonadales → Geminigeraceae → Guillardia → Guillardia theta → Guillardia theta CCMP2712535Open in IMG/M
3300021932|Ga0063872_1011299All Organisms → cellular organisms → Eukaryota → Cryptophyceae → Pyrenomonadales → Geminigeraceae → Guillardia → Guillardia theta → Guillardia theta CCMP2712567Open in IMG/M
3300021933|Ga0063756_1011240All Organisms → cellular organisms → Eukaryota → Cryptophyceae → Pyrenomonadales → Geminigeraceae → Guillardia → Guillardia theta → Guillardia theta CCMP2712563Open in IMG/M
3300021954|Ga0063755_1006913All Organisms → cellular organisms → Eukaryota → Cryptophyceae → Pyrenomonadales → Geminigeraceae → Guillardia → Guillardia theta → Guillardia theta CCMP2712579Open in IMG/M
3300027832|Ga0209491_10398427All Organisms → cellular organisms → Eukaryota → Cryptophyceae → Pyrenomonadales → Geminigeraceae → Guillardia → Guillardia theta → Guillardia theta CCMP2712979Open in IMG/M
3300027848|Ga0209390_10359800All Organisms → cellular organisms → Eukaryota → Cryptophyceae → Pyrenomonadales → Geminigeraceae → Guillardia → Guillardia theta → Guillardia theta CCMP27121084Open in IMG/M
3300027976|Ga0209702_10043532All Organisms → cellular organisms → Eukaryota → Cryptophyceae → Pyrenomonadales → Geminigeraceae2707Open in IMG/M
3300027983|Ga0209284_10095797All Organisms → cellular organisms → Eukaryota → Cryptophyceae → Pyrenomonadales → Geminigeraceae → Guillardia → Guillardia theta → Guillardia theta CCMP27121581Open in IMG/M
3300028134|Ga0256411_1266670All Organisms → cellular organisms → Eukaryota → Cryptophyceae → Pyrenomonadales → Geminigeraceae → Guillardia → Guillardia theta → Guillardia theta CCMP2712524Open in IMG/M
3300028137|Ga0256412_1200378All Organisms → cellular organisms → Eukaryota → Cryptophyceae737Open in IMG/M
3300028137|Ga0256412_1295793All Organisms → cellular organisms → Eukaryota → Cryptophyceae → Pyrenomonadales → Geminigeraceae → Guillardia → Guillardia theta → Guillardia theta CCMP2712596Open in IMG/M
3300028137|Ga0256412_1385786All Organisms → cellular organisms → Eukaryota → Cryptophyceae → Pyrenomonadales → Geminigeraceae → Guillardia → Guillardia theta → Guillardia theta CCMP2712514Open in IMG/M
3300028282|Ga0256413_1341318All Organisms → cellular organisms → Eukaryota → Cryptophyceae → Pyrenomonadales → Geminigeraceae → Guillardia → Guillardia theta → Guillardia theta CCMP2712525Open in IMG/M
3300030653|Ga0307402_10723890All Organisms → cellular organisms → Eukaryota → Cryptophyceae580Open in IMG/M
3300030671|Ga0307403_10614598All Organisms → cellular organisms → Eukaryota → Cryptophyceae589Open in IMG/M
3300030709|Ga0307400_10300116All Organisms → cellular organisms → Eukaryota → Cryptophyceae → Pyrenomonadales → Geminigeraceae → Guillardia → Guillardia theta → Guillardia theta CCMP27121019Open in IMG/M
3300031729|Ga0307391_10207545All Organisms → cellular organisms → Eukaryota → Cryptophyceae → Pyrenomonadales → Geminigeraceae → Guillardia → Guillardia theta → Guillardia theta CCMP27121031Open in IMG/M
3300031750|Ga0307389_10306611All Organisms → cellular organisms → Eukaryota → Cryptophyceae → Pyrenomonadales → Geminigeraceae → Guillardia → Guillardia theta → Guillardia theta CCMP2712980Open in IMG/M
3300031784|Ga0315899_10064363All Organisms → cellular organisms → Eukaryota → Cryptophyceae → Pyrenomonadales → Geminigeraceae → Guillardia → Guillardia theta → Guillardia theta CCMP27123811Open in IMG/M
3300031786|Ga0315908_10743795All Organisms → cellular organisms → Eukaryota → Cryptophyceae → Pyrenomonadales → Geminigeraceae → Guillardia → Guillardia theta → Guillardia theta CCMP2712805Open in IMG/M
3300032092|Ga0315905_10339166All Organisms → cellular organisms → Eukaryota → Cryptophyceae → Pyrenomonadales → Geminigeraceae → Guillardia → Guillardia theta → Guillardia theta CCMP27121430Open in IMG/M
3300032435|Ga0335398_10676691All Organisms → cellular organisms → Eukaryota → Cryptophyceae → Pyrenomonadales → Geminigeraceae → Guillardia → Guillardia theta → Guillardia theta CCMP2712673Open in IMG/M
3300032463|Ga0314684_10645194All Organisms → cellular organisms → Eukaryota → Cryptophyceae613Open in IMG/M
3300032463|Ga0314684_10739287All Organisms → cellular organisms → Eukaryota → Cryptophyceae563Open in IMG/M
3300032470|Ga0314670_10567064All Organisms → cellular organisms → Eukaryota → Cryptophyceae → Pyrenomonadales → Geminigeraceae → Guillardia → Guillardia theta → Guillardia theta CCMP2712589Open in IMG/M
3300032491|Ga0314675_10559496All Organisms → cellular organisms → Eukaryota → Cryptophyceae → Pyrenomonadales → Geminigeraceae → Guillardia → Guillardia theta → Guillardia theta CCMP2712562Open in IMG/M
3300032518|Ga0314689_10694826All Organisms → cellular organisms → Eukaryota → Cryptophyceae → Pyrenomonadales → Geminigeraceae → Guillardia → Guillardia theta → Guillardia theta CCMP2712522Open in IMG/M
3300032519|Ga0314676_10687809All Organisms → cellular organisms → Eukaryota → Cryptophyceae → Pyrenomonadales → Geminigeraceae → Guillardia → Guillardia theta → Guillardia theta CCMP2712597Open in IMG/M
3300032520|Ga0314667_10639178All Organisms → cellular organisms → Eukaryota → Cryptophyceae586Open in IMG/M
3300032522|Ga0314677_10491842All Organisms → cellular organisms → Eukaryota → Cryptophyceae653Open in IMG/M
3300032540|Ga0314682_10585103All Organisms → cellular organisms → Eukaryota → Cryptophyceae611Open in IMG/M
3300032540|Ga0314682_10631376All Organisms → cellular organisms → Eukaryota → Cryptophyceae → Pyrenomonadales → Geminigeraceae → Guillardia → Guillardia theta → Guillardia theta CCMP2712584Open in IMG/M
3300032616|Ga0314671_10756396All Organisms → cellular organisms → Eukaryota → Cryptophyceae → Pyrenomonadales → Geminigeraceae → Guillardia → Guillardia theta → Guillardia theta CCMP2712518Open in IMG/M
3300032666|Ga0314678_10431752All Organisms → cellular organisms → Eukaryota → Cryptophyceae595Open in IMG/M
3300032707|Ga0314687_10647442All Organisms → cellular organisms → Eukaryota → Cryptophyceae → Pyrenomonadales → Geminigeraceae → Guillardia → Guillardia theta → Guillardia theta CCMP2712588Open in IMG/M
3300032711|Ga0314681_10525691All Organisms → cellular organisms → Eukaryota → Cryptophyceae → Pyrenomonadales → Geminigeraceae → Guillardia → Guillardia theta → Guillardia theta CCMP2712663Open in IMG/M
3300032713|Ga0314690_10555640All Organisms → cellular organisms → Eukaryota → Cryptophyceae567Open in IMG/M
3300032725|Ga0314702_1306993All Organisms → cellular organisms → Eukaryota → Cryptophyceae → Pyrenomonadales → Geminigeraceae → Guillardia → Guillardia theta → Guillardia theta CCMP2712605Open in IMG/M
3300032728|Ga0314696_10572737All Organisms → cellular organisms → Eukaryota → Cryptophyceae → Pyrenomonadales → Geminigeraceae → Guillardia → Guillardia theta → Guillardia theta CCMP2712577Open in IMG/M
3300032730|Ga0314699_10373361All Organisms → cellular organisms → Eukaryota → Cryptophyceae643Open in IMG/M
3300032730|Ga0314699_10446710All Organisms → cellular organisms → Eukaryota → Cryptophyceae → Pyrenomonadales → Geminigeraceae → Guillardia → Guillardia theta → Guillardia theta CCMP2712583Open in IMG/M
3300032732|Ga0314711_10494702All Organisms → cellular organisms → Eukaryota → Cryptophyceae → Pyrenomonadales → Geminigeraceae → Guillardia → Guillardia theta → Guillardia theta CCMP2712628Open in IMG/M
3300032734|Ga0314706_10554036All Organisms → cellular organisms → Eukaryota → Cryptophyceae → Pyrenomonadales → Geminigeraceae → Guillardia → Guillardia theta → Guillardia theta CCMP2712551Open in IMG/M
3300032743|Ga0314707_10626197All Organisms → cellular organisms → Eukaryota → Cryptophyceae → Pyrenomonadales → Geminigeraceae → Guillardia → Guillardia theta → Guillardia theta CCMP2712552Open in IMG/M
3300032744|Ga0314705_10607013All Organisms → cellular organisms → Eukaryota → Cryptophyceae581Open in IMG/M
3300032749|Ga0314691_10319616All Organisms → cellular organisms → Eukaryota → Cryptophyceae649Open in IMG/M
3300032752|Ga0314700_10455846All Organisms → cellular organisms → Eukaryota → Cryptophyceae → Pyrenomonadales → Geminigeraceae → Guillardia → Guillardia theta → Guillardia theta CCMP2712680Open in IMG/M
3300032754|Ga0314692_10600701All Organisms → cellular organisms → Eukaryota → Cryptophyceae → Pyrenomonadales → Geminigeraceae → Guillardia → Guillardia theta → Guillardia theta CCMP2712586Open in IMG/M
3300034121|Ga0335058_0528513All Organisms → cellular organisms → Eukaryota → Cryptophyceae → Pyrenomonadales → Geminigeraceae → Guillardia → Guillardia theta → Guillardia theta CCMP2712667Open in IMG/M
3300034168|Ga0335061_0236162All Organisms → cellular organisms → Eukaryota → Cryptophyceae → Pyrenomonadales → Geminigeraceae → Guillardia → Guillardia theta → Guillardia theta CCMP2712964Open in IMG/M

Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).


 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
SeawaterEnvironmental → Aquatic → Marine → Oceanic → Unclassified → Seawater25.49%
MarineEnvironmental → Aquatic → Marine → Oceanic → Unclassified → Marine14.71%
MarineEnvironmental → Aquatic → Marine → Unclassified → Unclassified → Marine12.75%
Freshwater LakeEnvironmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lake8.82%
FreshwaterEnvironmental → Aquatic → Freshwater → Ice → Glacial Lake → Freshwater8.82%
Polar MarineEnvironmental → Aquatic → Marine → Unclassified → Unclassified → Polar Marine7.84%
SeawaterEnvironmental → Aquatic → Marine → Coastal → Unclassified → Seawater4.90%
FreshwaterEnvironmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater2.94%
FreshwaterEnvironmental → Aquatic → Freshwater → Unclassified → Unclassified → Freshwater2.94%
AqueousEnvironmental → Aquatic → Marine → Coastal → Unclassified → Aqueous2.94%
Salt MarshEnvironmental → Aquatic → Marine → Intertidal Zone → Salt Marsh → Salt Marsh2.94%
Freshwater LakeEnvironmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake0.98%
FreshwaterEnvironmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater0.98%
Saline LakeEnvironmental → Aquatic → Non-Marine Saline And Alkaline → Saline → Unclassified → Saline Lake0.98%
Host-AssociatedHost-Associated → Human → Digestive System → Large Intestine → Fecal → Host-Associated0.98%
Surface Ocean WaterEnvironmental → Aquatic → Marine → Oceanic → Unclassified → Surface Ocean Water0.98%

Visualization
Powered by ApexCharts



Associated Samples

Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).

Taxon OIDSample NameHabitat TypeIMG/M Link
3300004769Metatranscriptome of freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MM15.SN (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300004788Metatranscriptome of freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM15.SD (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300004790Metatranscriptome of freshwater lake microbial communities from Lake Michigan, USA - Fa13.BD.MM15.SD (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300004836Metatranscriptome of freshwater lake microbial communities from Lake Michigan, USA - Fa13.BD.MM15.DN (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300005420Freshwater lake microbial communities from Lake Erie, under a cyanobacterial bloom - NOAA_Erie_Diel1S_2200h metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300005565Freshwater lake microbial communities from Lake Erie, under a cyanobacterial bloom - NOAA_Erie_Diel7S_1600h metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300006355Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_0.19_N_>0.8_RNA2 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300006419Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_30_>0.8_RNA1 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300006602Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Fall_15_>0.8_RNA2 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300007516Freshwater microbial communities from Lake Fryxell liftoff mats and glacier meltwater in Antarctica - FRY-01EnvironmentalOpen in IMG/M
3300007519Freshwater microbial communities from Lake Bonney liftoff mats and glacier meltwater in Antarctica - BON-03EnvironmentalOpen in IMG/M
3300007522Freshwater microbial communities from Lake Bonney liftoff mats and glacier meltwater in Antarctica - BON-01EnvironmentalOpen in IMG/M
3300007722Freshwater microbial communities from Lake Fryxell liftoff mats and glacier meltwater in Antarctica - FRY-02 (megahit assembly)EnvironmentalOpen in IMG/M
3300009263Eukaryotic communities of water from the North Atlantic ocean - ACM27EnvironmentalOpen in IMG/M
3300009543Marine eukaryotic communities from Pacific Ocean to study complex ecological interactions - MBTS_20Mar14_M2_3um Metatranscriptome (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300009592Marine eukaryotic communities from Pacific Ocean to study complex ecological interactions - MBTS_20Mar14_M1_3um Metatranscriptome (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300009606Marine eukaryotic communities from Pacific Ocean to study complex ecological interactions - MBTS_5May14_M2_3um Metatranscriptome (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300009608Marine eukaryotic communities from Pacific Ocean to study complex ecological interactions - MBTS_2Apr14_M1_3um Metatranscriptome (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300012272Saline lake microbial communities from Rauer Islands, Antarctica - Metagenome Filla 1 #562EnvironmentalOpen in IMG/M
3300012408Metatranscriptomics of polar marine prokaryotic and eukaryotic communities from Palmer Station, Antarctica after 192hr light incubation - RNA23.A_192.20151118 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300012414Metatranscriptomics of polar marine prokaryotic and eukaryotic communities from Arthur Harbor ice station, Antarctica - RNA16.ICE_1m.20151115 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300012415Metatranscriptomics of polar marine prokaryotic and eukaryotic communities from Arthur Harbor ice station, Antarctica - RNA15.ICE_1m.20151115 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300012416Metatranscriptomics of polar marine prokaryotic and eukaryotic communities from Palmer Station, Antarctica after 24hr light incubation - RNA9.A_24.20151111 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300012418Metatranscriptomics of polar marine prokaryotic and eukaryotic communities from Palmer Station, Antarctica after 72hr light incubation - RNA12.A_72.20151113 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300012760Freshwater microbial communities from Lake Croche, Canada - C_130709_M_mt (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300012767Metatranscriptomics of polar marine prokaryotic and eukaryotic communities from Arthur Harbor ice station, Antarctica - RNA29.ICE_1m.20151125 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300012782Metatranscriptomics of polar marine prokaryotic and eukaryotic communities from Arthur Harbor ice station, Antarctica - RNA30.ICE_1m.20151125 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300012935Metatranscriptomics of polar marine prokaryotic and eukaryotic communities from Arthur Harbor ice station, Antarctica - RNA5.ICE_1m.20151110 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300013132 (restricted)Freshwater microbial communities from Kabuno Bay, South-Kivu, Congo ? kab_092012_9.5mEnvironmentalOpen in IMG/M
3300013295northern Canada Lakes metatranscriptome co-assemblyEnvironmentalOpen in IMG/M
3300016703Metatranscriptome of coastal salt marsh microbial communities from the Groves Creek Marsh, Georgia, USA - 041407CT metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300016723Metatranscriptome of coastal salt marsh microbial communities from the Groves Creek Marsh, Georgia, USA - 041405ZT metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300016740Metatranscriptome of coastal salt marsh microbial communities from the Groves Creek Marsh, Georgia, USA - 041413YT metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300017284Metatranscriptome of marine eukaryotic communities from unknown location in f/2 medium w/o silicate, at 4 C, 31 psu salinity and 530 ?mol photons light - Geminigera cryophila CCMP 2564 (MMETSP0799)Host-AssociatedOpen in IMG/M
3300018836Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_066 - TARA_N000000807 (ERX1789715-ERR1719504)EnvironmentalOpen in IMG/M
3300018913Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_066 - TARA_N000000805 (ERX1782451-ERR1712205)EnvironmentalOpen in IMG/M
3300019009Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_067 - TARA_N000000756 (ERX1782233-ERR1711966)EnvironmentalOpen in IMG/M
3300019032Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_066 - TARA_N000000805 (ERX1782188-ERR1712216)EnvironmentalOpen in IMG/M
3300019095Metatranscriptome of marine microbial communities from Baltic Sea - GS694_3p0_dTEnvironmentalOpen in IMG/M
3300019149Metatranscriptome of marine microbial communities from Baltic Sea - GS695_3p0_dTEnvironmentalOpen in IMG/M
3300021894Metatranscriptome of marine eukaryotic phytoplankton communities from the Arctic Ocean - ARK-63M (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300021897Metatranscriptome of marine eukaryotic phytoplankton communities from Norwegian Sea - 20m ARK-7M ARK-7-2 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300021902Metatranscriptome of marine eukaryotic phytoplankton communities from the Arctic Ocean - ARK-1S (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300021903Metatranscriptome of marine eukaryotic phytoplankton communities from Norwegian Sea - 20m ARK-7M ARK-7-3 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300021921Metatranscriptome of marine eukaryotic phytoplankton communities from Norwegian Sea - 10m ARK-5M ARK-5-3 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300021922Metatranscriptome of marine eukaryotic phytoplankton communities from Norwegian Sea - 10m ARK-5M ARK-5-2 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300021926Metatranscriptome of marine eukaryotic phytoplankton communities from South Atlantic Ocean - 30m ANT-15 ARK-20-3 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300021932Metatranscriptome of marine eukaryotic phytoplankton communities from South Atlantic Ocean - 30m ANT-15 Euk ARK-20-1 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300021933Marine eukaryotic phytoplankton communities from the Norwegian Sea - 20m ARK-7M Euk - ARK-7-1 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300021954Marine eukaryotic phytoplankton communities from the Norwegian Sea - 10m ARK-5M Euk ARK-5-1 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300027832Freshwater microbial communities from Lake Bonney liftoff mats and glacier meltwater in Antarctica - BON-02 (SPAdes)EnvironmentalOpen in IMG/M
3300027848Freshwater microbial communities from Lake Bonney liftoff mats and glacier meltwater in Antarctica - BON-01 (SPAdes)EnvironmentalOpen in IMG/M
3300027976Freshwater microbial communities from Lake Fryxell liftoff mats and glacier meltwater in Antarctica - FRY-01 (SPAdes)EnvironmentalOpen in IMG/M
3300027983Freshwater microbial communities from Lake Fryxell liftoff mats and glacier meltwater in Antarctica - FRY-03 (SPAdes)EnvironmentalOpen in IMG/M
3300028134Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - WCR_12 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300028137Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - WCR_74 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300028282Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - WCR_77 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300030653Metatranscriptome of marine eukaryotic phytoplankton communities from Antarctic Ocean - PS103-29 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030671Metatranscriptome of marine eukaryotic phytoplankton communities from Antarctic Ocean - PS103-34 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030709Metatranscriptome of marine eukaryotic phytoplankton communities from Antarctic Ocean - PS103-17 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300031729Metatranscriptome of marine eukaryotic phytoplankton communities from South Atlantic Ocean ? PS103-4.R2 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300031750Metatranscriptome of marine eukaryotic phytoplankton communities from South Atlantic Ocean ? PS103-3.R3 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300031784Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 4 MA112EnvironmentalOpen in IMG/M
3300031786Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 4 MA124EnvironmentalOpen in IMG/M
3300032092Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 4 MA121EnvironmentalOpen in IMG/M
3300032435Freshwater microbial communities from Lake Bonney liftoff mats and glacier meltwater in Antarctica - BON-03 (spades assembly)EnvironmentalOpen in IMG/M
3300032463Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Red4_24May_surf (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032470Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Red2_24May_surf (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032491Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Red2_26May_deep (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032518Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Red4_26May_deep (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032519Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Red3_22May_surf (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032520Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Amb1_24May_surf (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032522Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Red3_24May_surf (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032540Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Red3_26May_deep (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032616Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Red2_26May_surf (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032666Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Red3_26May_surf (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032707Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Red4_22May_deep (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032711Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Red3_24May_deep (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032713Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Plim5_22May_sur (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032725Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Shad8_24May_surf (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032728Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Plim7_22May_surf (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032730Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Plim7_22May_deep (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032732Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Shad11_26May_surf (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032734Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Amb9_26May_surf (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032743Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Shad10_24May_surf (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032744Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Amb9_24May_surf (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032749Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Plim5_26May_surf (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032752Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Plim7_26May_deep (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032754Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Plim5_28May_surf (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300034121Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME19May2015-rr0174EnvironmentalOpen in IMG/M
3300034168Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME06Apr2016-rr0183EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap


 ⦗Top⦘

Family Sequences

Note: Some of these sequences are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).

Protein ID Sample Taxon ID Habitat Sequence
Ga0007748_1129655513300004769Freshwater LakeVSRSTCEHEARGSLTDVGVRVCADGTFMPEVGVARRGRAAGGLAAVAVAALALAMVALVYANTSSEWPASVMMSEGQRTTKLAWGGFTLDMQKEADKALRLCKVGLLGKGQHCATHVVSTEDSKWTHTDAGQPIWEESTNVLDSQTSVVPQGPDIGTPGDFGDRR*
Ga0007742_1091561813300004788Freshwater LakeTFMPEVGVARRGRAAGGLAAVAVAALALAMVALVYANTSSEWPASVMMSEGQRTTKLAWGGFTLDMQKEADKALRLCKVGLLGKGQHCATHVVSTEDSKWTHTDAGQPIWEESTNVLDSQTSVVPQGPDIGTPGDFGDRR*
Ga0007758_1105695813300004790Freshwater LakeLALAMVALVYANTSSEWPASVMMSQGQRITKLAWGGFTLDMQKEADKALRLCKVGLLGTKQHCATHVVSTEDTKWTHTDAGQPVWEESTNVLDSQTSVVPQGPDIGTPGDFGDRR*
Ga0007759_1131969613300004836Freshwater LakeLALAMVALVYANTSSEWPASVMMSEGQRTTKLAWGGFTLDMQKEADKALRLCKVGLLGKGQHCATHVVSTEDSKWTHTDAGQPIWEESTNVLDSQTSVVPQGPDIGTPGDFGDRR*
Ga0068879_138658213300005420Freshwater LakeYGTFMPEVGVARRGRAAGGLAAVAVAALALAMVALVYANTSSEWPASVMMSEGQRTTKLAWGGFTLDMQKEADKALRLCKVGLLGKGQHCATHVVSTEDSKWTHTDAGQPIWEESTNVLDSQTSVVPQGPDIGTPGDFGDR*
Ga0068885_186057113300005565Freshwater LakeRTATSSEWPASVMMSEGQRTTKLAWGGFTLDMQKEADKALRLCKVGLLGKGQHCATHVVSTEDSKWTHTDAGQPVWEESTNVLDSQTSVVPQGPDIGTPGDFGDRR*
Ga0075501_123073023300006355AqueousMAYGTFVPEVNVARRGNGVLSVVAVAAVAIAMVALVYTNTSSEWPGTVLMSEGQRTTQLAWGGFTNQMQEEADKALRLCKVGLLGQNKHCATHVVSTDFTKWTHTDAGQPEWEESQNVLSSQTSVIPQGPDIGTPGDFGDRR*
Ga0075496_143532613300006419AqueousAVAMVALVYANTSSEWPGSVLMSEGQRTTKLAWGGFTNQMQEEADKALRLCKVGLLGKKQHCATHVVSTDFTKWTHTDAGQPTWEERQRVLSQQTSVIPSGPDIGTPGDFGDRR*
Ga0075484_136236213300006602AqueousSSEWPGSSVALMSEGQRTTKLAWGGFTLQMQEEADKALRLCKVGLLGPNQHCATHVVSTDDTKWTHSDAGQPVWEESVNVLDRQSSVVPQGPDIGTPGDFGDRR*
Ga0105050_1002998643300007516FreshwaterVGLARRGRAAGGLAVVAVAAMALAMVAVVYINISSKWPGQTVLMSQGQRTTKLAWGGFTLDMQHEADKALRLCKVGMFGPGKHCATHVVSTDLTKWTHTDAGQPIWEESQNVLSSQVWNLFNYERLNVQ*
Ga0105055_1009446723300007519FreshwaterVPEVGLARRGRAAGGLAVVAVAAMALAMVAVVYINTSSEWPGQTVLMSEGQKTTKLAWGGFTLDMQHEADKALRLCKVGMFGPGKHCATHVVSTDLTKWTHTDAGQPIWEESQNVLSSQVWNLFNYERLHVQ*
Ga0105053_1033136713300007522FreshwaterVPEVGLARRGRAAGGLAVVAVAAMALAMVAVVYINTSSEWPGQTVLMSQGQRTTKLAWGGFTLDMQHEADKALRLCKVGMFGPGKHCATHVVSTDLTKWTHTDAGQPIWEESQNVLSSQVWNLFNYERLHVQ*
Ga0105051_1034764413300007722FreshwaterVPEVGLARRGRAAGGLAVVAVAAMALAMVAVVYINTSSEWPGQTVLMSQGQRTTKLAWGGFTLDMQHEADKALRLCKVGMFGPGKHCATHVVSTDLTKWTHTDAGQPIWEESQNVLSSQVWNLFNYERLNVQ*
Ga0103872_103860113300009263Surface Ocean WaterITLIALVYVNTSSEWPESVLMSEGQRTTQLAWGGFTNQMQNEADKAIRLCKVGLMGKNKHCATHVVSTEYTKWTHSDAGQPTWEESQRVLDHQGSVEPHGPDIGTPGDFGDRR*
Ga0115099_1030181313300009543MarineRKGAVSPTEDHKRWTKMGLARQRRGINALAAVAAVSITLIALVYVNTSSEWPESVLMSEGQRTTQLAWGGFTNQMQNEADKAIRLCKVGLMGKNKHCATHVVSTKYTKWTHSDAGQPTWEESQRVLDHQGSVEPHGPDIGTPGDFGDRR*
Ga0115099_1064553613300009543MarineYGTFVPEVGVARRGKGVLSVVAVAAAAIAMVALVYANTSSEWPGSVLMSEGQRTTQLAWGGFTNQMQEEADKALRLCKVGLLGPKQHCATHVVSTDFTKWTHTDAGQPVWEESQNVLSSQTSVIPQGPDIGTPGDFGDRR*
Ga0115099_1079061113300009543MarineMALAATATLALAMVALVYANTSSDWPGSALMSEGQRTTKLAWGGFTLQMQDEADKALRLCKVGLMGPNQHCATHVVSTDDTKWTHSDAGQPTWEESQMVLSRQSSVIPRGPDIGTPGDFGDRR*
Ga0115101_122159113300009592MarineAMAYGTFVPEVGVARRGKGVLSVVAVAAAAIAMVALVYANTSSEWPGSVLMSEGQRTTQLAWGGFTNQMQEEADKALRLCKVGLLGPKQHCATHVVSTDFTKWTHTDAGQPVWEESQNVLSSQTSVIPQGPDIGTPGDFGDRR*
Ga0115101_125665813300009592MarineAIMPYGTFEPEVAARGRSAARGGMALAATATLALAMVALVYANTSSDWPGSALMSEGQRTTKLAWGGFTLQMQDEADKALRLCKVGLMGPNQHCATHVVSTDDTKWTHSDAGQPTWEESQMVLSRQSSVIPRGPDIGTPGDFGDRR*
Ga0115102_1096490313300009606MarineMLLMCADHKRWTKMGLARQRRGINALAAVAAVSITLIALVYVNTSSEWPESVLMSEGQRTTQLAWGGFTNQMQNEADKAIRLCKVGLMGKNKHCATHVVSTKYTKWTHSDAGQPTWEESQRVLDHQGSVEPHGPDIGTPGDFGDRR*
Ga0115100_1084880013300009608MarineAYGTFMPEVGVARRGRAAGGLAVVAVAALAVAMVALVYANTSSEWPGSVLMSEGQRTTKLAWGGFTNQMQEEADKALRLCKVGLLGKKQHCATHVVSTDFTKWTHTDAGQPTWEESQRVLSQQTSVIPSGPDIGTPGDFGDRR*
Ga0136586_114969113300012272Saline LakeVPEVGLARRGRAAGGLAVVAVAAMALAMVAVVYINTSSEWPGQTVLMSEGQKTTKLAWGGFTLDMQHEADKALRLCKVGMFGPGKHCATHVVSTDLTKWTHTDAGQPIWEESQNVLSSQVWNLFNYERLPVQ*
Ga0138265_100593513300012408Polar MarineSMAYGTFVPEVGVARRGRAAGGLAVVAVAAVAIAMVALVYTNTSSEWPGQTVLMSEGQRTTKLAWGGFTLAMQDEADKALRLCKVGLMGPNQHCATHVVSTDDTKWTHTDAGQPIWEESQMVLSRQSSVIPRGPDIGTPGDFGDRR*
Ga0138264_102730113300012414Polar MarineLHSMAYGTFVPEVGVARRGRAAGGLAVVAVAAVAIAMVALVYTNTSSEWPGQTVLMSEGQRTTKLAWGGFTLAMQDEADKALRLCKVGLMGPNQHCATHVVSTDDTKWTHTDAGQPIWEESQMVLSRQSSVIPRGPDIGTPGDFGDRR*
Ga0138263_160153713300012415Polar MarinePPSMAYGTFVPEVGVARRGRAAGGLAVVAVAAVAIAMVALVYTNTSSEWPGQTVLMSEGQRTTKLAWGGFTLAMQDEADKALRLCKVGLMGPNQHCATHVVSTDDTKWTHTDAGQPIWEESQMVLSRQSSVIPRGPDIGTPGDFGDRR*
Ga0138259_159327313300012416Polar MarineGTFVPEVGVARRGRAAGGLAVVAVAAVAIAMVALVYTNTSSEWPGQTVLMSEGQRTTKLAWGGFTLAMQDEADKALRLCKVGLMGPNQHCATHVVSTDDTKWTHTDAGQPIWEESQMVLSRQSSVIPRGPDIGTPGDFGDRR*
Ga0138261_117249513300012418Polar MarineSLHSMAYGTFVPEVGVARRGRAAGGLAVVAVAAVAIAMVALVYTNTSSEWPGQTVLMSEGQRTTKLAWGGFTLAMQDEADKALRLCKVGLMGPNQHCATHVVSTDDTKWTHTDAGQPIWEESQMVLSRQSSVIPRGPDIGTPGDFGDRR*
Ga0138273_101974013300012760Freshwater LakeFSPEAGVVRPRRGVGAAAAVAAVAIAMVALVYANTSSEWPETVLMSEGQRTTKLAWGGFTGVMQDEADRALHLCKVGLLGKKKHCATHVVSTEDSKWTHTDAGQPTWAESQRVLSRQSSVVPRGPDIGTPGDFGDRR*
Ga0138267_116988713300012767Polar MarineVAVAAVAIAMVALVYTNTSSEWPGQTVLMSEGQRTTKLAWGGFTLAMQDEADKALRLCKVGLMGPNQHCATHVVSTDDTKWTHTDAGQPIWEESQMVLSRQSSVIPRGPDIGTPGDFGDRR*
Ga0138268_172597213300012782Polar MarineMAYGTFVPEVGVARRGRAAGGLAVVAVAAVAIAMVALVYTNTSSEWPGQTVLMSEGQRTTKLAWGGFTLAMQDEADKALRLCKVGLMGPNQHCATHVVSTDDTKWTHTDAGQPIWEESQMVLSRQSSVIPRGPDIGTPGDFGDRR*
Ga0138257_112601713300012935Polar MarineAYGTFVPEVGVARRGRAAGGLAVVAVAAVAIAMVALVYTNTSSEWPGQTVLMSEGQRTTKLAWGGFTLAMQDEADKALRLCKVGLMGPNQHCATHVVSTDDTKWTHTDAGQPIWEESQMVLSRQSSVIPRGPDIGTPGDFGDRR*
(restricted) Ga0172372_1098861413300013132FreshwaterVAALALAMVALVYANTSSEWPASVMMSQGQRTTKLAWGGFTLDMQKEADKALRLCKVGLLGTKQHCATHVVSTEDTKWTHTDAGQPVWEESTNVLDSQVTETHAYTHFMYVCVYT*
Ga0170791_1170201313300013295FreshwaterRSAMAYGTFSPEAGVVRPRRGVGAAAAVAAVAIAMVALVYANTSSEWPETVLMSEGQRTTKLAWGGFTGVMQDEADRALHLCKVGLLGKKKHCATHVVSTEDSKWTHTDAGQPTWAESQRVLSRQSSVVPRGPDIGTPGDFGDRR*
Ga0182088_124822913300016703Salt MarshARGGLALAATAALAFAAVALVYANTSSEWPGSSVALMSEGQRTTKLAWGGFTLQMQEEADKALRLCKVGLLGPNQHCATHVVSTDDTKWTHSDAGQPVWEESVNVLDRQSSVVPQGPDIGTPGDFGDRR
Ga0182085_132212713300016723Salt MarshLALAATAALAFAAVALVYANTSSEWPGSSVALMSEGQRTTKLAWGGFTLQMQEEADKALRLCKVGLLGPNQHCATHVVSTDDTKWTHSDAGQPVWEESVNVLDRQSSVVPQGPDIGTPGDFGDRR
Ga0182096_111287113300016740Salt MarshLVYANTSSEWPGSSVALMSEGQRTTKLAWGGFTLQMQEEADKALRLCKVGLLGPNQHCATHVVSTDDTKWTHSDAGQPVWEESVNVLDRQSSVVPQGPDIGTPGDFGDRR
Ga0186171_101961913300017284Host-AssociatedVPEVGLARRGRAAGGLAVVAVAAMALAMVAVVYINTSSEWPGQTVLMSEGQKTTKLAWGGFTLDMQHEADKALRLCKVGMFGPGKHCATHVVSTDLTKWTHTDAGQPIWEESQNVLSSQTSVVPQGPDIGTPGDFGDRR
Ga0192870_106296313300018836MarineRMAYGTFSADAGSTRRGGRGALTAVAMAAGAIAMVALVYANTSSAWPGSALMSEGQRTTQLAWGGYTNAMQDEADKAIRLCKVGLMGPGQHCAKHVVSTKYTKWTHSDAGQPTWEESQRVLSNQNSVIPHGPDIGTPGDFGDRR
Ga0192868_1003215913300018913MarineHGGRSSRKGAVSPTEDHKRWTKMGLARQRRGINALAAVAAVSITLIALVYVNTSSEWPESVLMSEGQRTTQLAWGGFTNQMQNEADKAIRLCKVGLMGKNKHCATHVVSTKYTKWTHSDAGQPTWEESQRVLDHQGSVEPHGPDIGTPGDFGDRR
Ga0192868_1005691213300018913MarineHGGSAAQDGLRDVQCRCRFDARGGRGALTAVAMAAGAIAMVALVYANTSSAWPGSALMSEGQRTTQLAWGGYTNAMQDEADKAIRLCKVGLMGPGQHCAKHVVSTKYTKWTHSDAGQPTWEESQRVLSNQNSVIPHGPDIGTPGDFGDRR
Ga0192880_1012936413300019009MarineGRSSRKGAVSPTEDHKRWTKMGLARQRRGINALAAVAAVSITLIALVYVNTSSEWPESVLMSEGQRTTQLAWGGFTNQMQNEADKAIRLCKVGLMGKNKHCATHVVSTKYTKWTHSDAGQPTWEESQRVLDHQGSVEPHGPDIGTPGDFGDRR
Ga0192869_1029950713300019032MarineVALVYANTSSEWPASVLMSEGQRTTKLAWGGFTGQMQEEADKALRLCKVGLLGQKQHCATHVVSTDFTKWTHTDAGQPTWEESQTVLSHQTSVIPQGPDIGTPGDFGDRR
Ga0192869_1033827613300019032MarineTWGRRTRMAYGTFSADAGSTRRGGRGALTAVAMAAGAIAMVALVYANTSSAWPGSALMSEGQRTTQLAWGGYTNAMQDEADKAIRLCKVGLMGPGQHCAKHVVSTKYTKWTHSDAGQPTWEESQRVLSNQNSVIPHGPDIGTPGDFGDRR
Ga0188866_102031413300019095Freshwater LakeGTFEPEVAARGRSAARGGMALAATATLALAMVALVYANTSSDWPGSALMSEGQRTTKLAWGGFTLQMQDEADKALRLCKVGLMGPNQHCATHVVSTDDTKWTHSDAGQPTWEESQMVLSRQSSVIPRGPDIGTPGDFGDRR
Ga0188870_1009079313300019149Freshwater LakeIMPYGTFEPEVAARGRSAARGGMALAATATLALAMVALVYANTSSDWPGSALMSEGQRTTKLAWGGFTLQMQDEADKALRLCKVGLMGPNQHCATHVVSTDDTKWTHSDAGQPTWEESQMVLSRQSSVIPRGPDIGTPGDFGDRR
Ga0188870_1009302113300019149Freshwater LakeRKGAVSPTEDHKRWTKMGLARQRRGINALAAVAAVSITLIALVYVNTSSEWPESVLMSEGQRTTQLAWGGFTNQMQNEADKAIRLCKVGLMGKNKHCATHVVSTKYTKWTHSDAGQPTWEESQRVLDHQGSVEPHGPDIGTPGDFGDRR
Ga0063099_102097413300021894MarineVALVYANTSSEWPGSVLMSEGQRTTKLAWGGFTNQMQEEADKALRLCKVGLLGKKQHCATHVVSTDFTKWTHTDAGQPTWEESQRVLSQQTSVIPSGPDIGTPGDFGDRR
Ga0063873_100821113300021897MarineYGTFMPEVGVARRGRAAGGLAVVAVAALAVAMVALVYANTSSEWPGSVLMSEGQRTTKLAWGGFTNQMQEEADKALRLCKVGLLGKKQHCATHVVSTDFTKWTHTDAGQPTWEESQRVLSQQTSVIPSGPDIGTPGDFGDRR
Ga0063086_103680813300021902MarineKGAVSPTEDHKRWTKMGLARQRRGINALAAVAAVSITLIALVYVNTSSEWPESVLMSEGQRTTQLAWGGFTNQMQNEADKAIRLCKVGLMGKNKHCATHVVSTKYTKWTHSDAGQPTWEESQRVLDHQGSVEPHGPDIGTPGDFGDRR
Ga0063874_100771113300021903MarineGTFMPEVGVARRGRAAGGLAVVAVAALAVAMVALVYANTSSEWPGSVLMSEGQRTTKLAWGGFTNQMQEEADKALRLCKVGLLGKKQHCATHVVSTDFTKWTHTDAGQPTWEESQRVLSQQTSVIPSGPDIGTPGDFGDRR
Ga0063870_100321013300021921MarineAVAMVALVYANTSSEWPGSVLMSEGQRTTKLAWGGFTNQMQEEADKALRLCKVGLLGKKQHCATHVVSTDFTKWTHTDAGQPTWEESQRVLSQQTSVIPSGPDIGTPGDFGDRR
Ga0063869_100675313300021922MarineANTSSEWPGSVLMSEGQRTTKLAWGGFTNQMQEEADKALRLCKVGLLGKKQHCATHVVSTDFTKWTHTDAGQPTWEESQRVLSQQTSVIPSGPDIGTPGDFGDRR
Ga0063871_100897313300021926MarineAVAALAVAMVALVYANTSSEWPGSVLMSEGQRTTKLAWGGFTNQMQEEADKALRLCKVGLLGKKQHCATHVVSTDFTKWTHTDAGQPTWEESQRVLSQQTSVIPSGPDIGTPGDFGDRR
Ga0063872_101129913300021932MarineGRAAGGLAVVAVAALAVAMVALVYANTSSEWPGSVLMSEGQRTTKLAWGGFTNQMQEEADKALRLCKVGLLGKKQHCATHVVSTDFTKWTHTDAGQPTWEESQRVLSQQTSVIPSGPDIGTPGDFGDRR
Ga0063756_101124013300021933MarineGGLAVVAVAALAVAMVALVYANTSSEWPGSVLMSEGQRTTKLAWGGFTNQMQEEADKALRLCKVGLLGKKQHCATHVVSTDFTKWTHTDAGQPTWEESQRVLSQQTSVIPSGPDIGTPGDFGDRR
Ga0063755_100691313300021954MarineRAAGGLAVVAVAALAVAMVALVYANTSSEWPGSVLMSEGQRTTKLAWGGFTNQMQEEADKALRLCKVGLLGKKQHCATHVVSTDFTKWTHTDAGQPTWEESQRVLSQQTSVIPSGPDIGTPGDFGDRR
Ga0209491_1039842713300027832FreshwaterVPEVGLARRGRAAGGLAVVAVAAMALAMVAVVYINTSSEWPGQTVLMSEGQKTTKLAWGGFTLDMQHEADKALRLCKVGMFGPGKHCATHVVSTDLTKWTHTDAGQPIWEESQNVLSSQVWNLFNYERLHVQ
Ga0209390_1035980013300027848FreshwaterVPEVGLARRGRAAGGLAVVAVAAMALAMVAVVYINTSSEWPGQTVLMSQGQRTTKLAWGGFTLDMQHEADKALRLCKVGMFGPGKHCATHVVSTDLTKWTHTDAGQPIWEESQNVLSSQVWNLFNYERLHVQ
Ga0209702_1004353213300027976FreshwaterVPEVGLARRGRAAGGLAVVAVAAMALAMVAVVYINISSKWPGQTVLMSQGQRTTKLAWGGFTLDMQHEADKALRLCKVGMFGPGKHCATHVVSTDLTKWTHTDAGQPIWEESQNVLSSQVWNLFNYERLNVQ
Ga0209284_1009579713300027983FreshwaterVPEVGLARRGRAAGGLAVVAVAAMALAMVAVVYINTSSEWPGQTVLMSQGQRTTKLAWGGFTLDMQHEADKALRLCKVGMFGPGKHCATHVVSTDLTKWTHTDAGQPIWEESQNVLSSQVWNLFNYERLNVQ
Ga0256411_126667013300028134SeawaterLVYANTSSAWPGSALMSEGQRTTQLAWGGYTNAMQDEADKAIRLCKVGLMGPGQHCAKHVVSTKYTKWTHSDAGQPTWEESQRVLSNQNSVIPHGPDIGTPGDFGDRR
Ga0256412_120037813300028137SeawaterPYGTFEPEVAARGRSAARGGMALAATATLALAMVALVYANTSSDWPGSALMSEGQRTTKLAWGGFTLQMQDEADKALRLCKVGLMGPNQHCATHVVSTDDTKWTHSDAGQPTWEESQMVLSRQSSVIPRGPDIGTPGDFGDRR
Ga0256412_129579313300028137SeawaterTFMPEVGVARRGRAAGGLAVVAVAALAVAMVALVYANTSSEWPGSVLMSEGQRTTKLAWGGFTNQMQEEADKALRLCKVGLLGKKQHCATHVVSTDFTKWTHTDAGQPTWEESQRVLSQQTSVIPSGPDIGTPGDFGDRR
Ga0256412_138578613300028137SeawaterAVAMAAGAIAMVALVYANTSSAWPGSALMSEGQRTTQLAWGGYTNAMQDEADKAIRLCKVGLMGPGQHCAKHVVSTKYTKWTHSDAGQPTWEESQRVLSNQNSVIPHGPDIGTPGDFGDR
Ga0256413_134131813300028282SeawaterVYANTSSAWPGSALMSEGQRTTQLAWGGYTNAMQDEADKAIRLCKVGLMGPGQHCAKHVVSTKYTKWTHSDAGQPTWEESQRVLSNQNSVIPHGPDIGTPGDFGDRR
Ga0307402_1072389013300030653MarineMPYGTFVPEVGVARRGRTAGGLAVVAVAAMALAMVALVYTNTSSEWPGQTALMSEGQRTTKLAWGGFTLDMQHEADKALRLCKVGMFGPGKHCATHVVSTDLTKWTHTDAGQPIWEESQNVLSTQTSVVPRGPDIGTPGDFGDRR
Ga0307403_1061459813300030671MarineMAPMPYGTFVPEVGVARRGRTAGGLAVVAVAAMALAMVALVYTNTSSEWPGQTALMSEGQRTTKLAWGGFTLDMQHEADKALRLCKVGMFGPGKHCATHVVSTDLTKWTHTDAGQPIWEESQNVLSTQTSVVPRGPDIGTPGDFGDRR
Ga0307400_1030011613300030709MarineGTFVPEVGVARRGRAIGGLAVVAVAAVAIAMVALVYTNTSSEWPGQTVLMSEGQRTTKLAWGGFTLAMQDEADKALRLCKVGLMGPNQHCATHVVSTDLTKWTHTDAGQPIWEESQQVLSRQSSVIPRGPDIGTPGDFGDRR
Ga0307391_1020754523300031729MarineMAYGTFVPEVGVARRGRAIGGLAVVAVAAVAIAMVALVYTNTSSEWPGQTVLMSEGQRTTKLAWGGFTLAMQDEADKALRLCKVGLMGPNQHCATHVVSTDLTKWTHTDAGQPIWEESQQVLSRQSSVIPRGPDIGTPGDFGDRR
Ga0307389_1030661113300031750MarineAYGTFVPEVGVARRGRAIGGLAVVAVAAVAIAMVALVYTNTSSEWPGQTVLMSEGQRTTKLAWGGFTLAMQDEADKALRLCKVGLMGPNQHCATHVVSTDLTKWTHTDAGQPIWEESQQVLSRQSSVIPRGPDIGTPGDFGDRR
Ga0315899_1006436353300031784FreshwaterMPEVGVARRGRAAGGLAAVAVAALALAMVALVYANTSSEWPASVMMSEGQRTTKLAWGGFTLDMQKEADKALRLCKVGLLGKGQHCATHVVSTEDSKWTHTDAGQPIWEESTNVLDSQVTKTHAYTHTTYVCVSIMCFVYAHTCW
Ga0315908_1074379513300031786FreshwaterMPEVGVARRGRAAGGLAVVAVAALALAMVALVYANTSSEWPASVMMSQGQRTTKLAWGGFTLDMQKEADKALRLCKVGLLGTKQHCATHVVSTEDTKWTHTDAGQPVWEESTNVL
Ga0315905_1033916623300032092FreshwaterMPEVGVARRGRAAGGLAVVAVAALALAMVALVYANTSSEWPASVMMSQGQRTTKLAWGGFTLDMQKEADKALRLCKVGLLGTKQHCATHVVSTEDTKWTHTDAGQPVWEESTNVLDSQVTETHAYTHFMYVCVYT
Ga0335398_1067669113300032435FreshwaterVPEVGLARRGRAAGGLAVVAVAAMALAMVAVVYINTSSEWPGQTVLMSEGQKTTKLAWGGFTLDMQHEADKALRLCKVGMFGPGKHCATHVVSTDLTKWTHTDAGQPIWEESQNVLSSQVWNLFNYERLNVQ
Ga0314684_1064519413300032463SeawaterAMAYGTFVPEVGVARRGASHGGLALAATAALALAAVALVYANTSSEWPGSALMSEGQRTTKLAWGGFTLAMQDEADKALRLCKVGLLGPNQHCATHVVSTDDTKWTHSDAGQPTWEESQMVLSRQSSVIPRGPDIGTPGDFGDRR
Ga0314684_1073928713300032463SeawaterAYGTFMPEVGVARRGRAAGGLAVVAVAALAVAMVALVYANTSSEWPGSVLMSEGQRTTKLAWGGFTNQMQEEADKALRLCKVGLLGKKQHCATHVVSTDFTKWTHTDAGQPTWEESQRVLSQQTSVIPSGPDIGTPGDFGDRR
Ga0314670_1056706413300032470SeawaterVPEVGVARRGASHGGLALAATAALALAAVALVYANTSSEWPGSALMSEGQRTTKLAWGGFTLAMQDEADKALRLCKVGLLGPNQHCATHVVSTDDTKWTHSDAGQPTWEESQMVLSRQSSVIPRGPDIGTPGDFGDRR
Ga0314675_1055949613300032491SeawaterGTFVPEVGVARRGSHGGLALAATAALALAAVALVYANTSSEWPGSALMSEGQRTTKLAWGGFTLAMQDEADKALRLCKVGLLGPNQHCATHVVSTDDTKWTHSDAGQPTWEESQMVLSRQSSVIPRGPDIGTPGDFGDRR
Ga0314689_1069482613300032518SeawaterHGGLALAATAALALAAVALVYANTSSEWPGSALMSEGQRTTKLAWGGFTLAMQDEADKALRLCKVGLLGPNQHCATHVVSTDDTKWTHSDAGQPTWEESQMVLSRQSSVIPRGPDIGTPGDFGDRR
Ga0314676_1068780913300032519SeawaterFMPEVGVARRGRAAGGLAVVAVAALAVAMVALVYANTSSEWPGSVLMSEGQRTTKLAWGGFTNQMQEEADKALRLCKVGLLGKKQHCATHVVSTDFTKWTHTDAGQPTWEESQRVLSQQTSVIPSGPDIGTPGDFGDRR
Ga0314667_1063917813300032520SeawaterRHFAMAYGTFVPEVGVARRGASHGGLALAATAALALAAVALVYANTSSEWPGSALMSEGQRTTKLAWGGFTLAMQDEADKALRLCKVGLLGPNQHCATHVVSTDDTKWTHSDAGQPTWEESQMVLSRQSSVIPRGPDIGTPGDFGDRR
Ga0314677_1049184213300032522SeawaterGTFVPEVGVARRGASHGGLALAATAALALAAVALVYANTSSEWPGSALMSEGQRTTKLAWGGFTLAMQDEADKALRLCKVGLLGPNQHCATHVVSTDDTKWTHSDAGQPTWEESQMVLSRQSSVIPRGPDIGTPGDFGDRR
Ga0314682_1058510313300032540SeawaterMAYGTFMPEVGVARRGRAAGGLAVVAVAALAVAMVALVYANTSSEWPGSVLMSEGQRTTKLAWGGFTNQMQEEADKALRLCKVGLLGKKQHCATHVVSTDFTKWTHTDAGQPTWEESQRVLSQQTSVIPSGPDIGTPGDFGDRR
Ga0314682_1063137613300032540SeawaterVPEVGVARRGSHGGLALAATAALALAAVALVYANTSSEWPGSALMSEGQRTTKLAWGGFTLAMQDEADKALRLCKVGLLGPNQHCATHVVSTDDTKWTHSDAGQPTWEESQMVLSRQSSVIPRGPDIGTPGDFGDRR
Ga0314671_1075639613300032616SeawaterLALAAVALVYANTSSEWPGSALMSEGQRTTKLAWGGFTLAMQDEADKALRLCKVGLLGPNQHCATHVVSTDDTKWTHSDAGQPTWEESQMVLSRQSSVIPRGPDIGTPGDFGDRR
Ga0314678_1043175213300032666SeawaterAYGTFVPEVGVARRGSHGGLALAATAALALAAVALVYANTSSEWPGSALMSEGQRTTKLAWGGFTLAMQDEADKALRLCKVGLLGPNQHCATHVVSTDDTKWTHSDAGQPTWEESQMVLSRQSSVIPRGPDIGTPGDFGDRR
Ga0314687_1064744213300032707SeawaterTFVPEVGVARRGSHGGLALAATAALALAAVALVYANTSSEWPGSALMSEGQRTTKLAWGGFTLAMQDEADKALRLCKVGLLGPNQHCATHVVSTDDTKWTHSDAGQPTWEESQMVLSRQSSVIPRGPDIGTPGDFGDRR
Ga0314681_1052569113300032711SeawaterRCGELAASVPRMCSLCMPCALTPVWRTSPADGTFVPEVGVARRGSHGGLALAATAALALAAVALVYANTSSEWPGSALMSEGQRTTKLAWGGFTLAMQDEADKALRLCKVGLLGPNQHCATHVVSTDDTKWTHSDAGQPTWEESQMVLSRQSSVIPRGPDIGTPGDFGDRR
Ga0314690_1055564013300032713SeawaterAYGTFVPEVGVARRGASHGGLALAATAALALAAVALVYANTSSEWPGSALMSEGQRTTKLAWGGFTLAMQDEADKALRLCKVGLLGPNQHCATHVVSTDDTKWTHSDAGQPTWEESQMVLSRQSSVIPRGPDIGTPGDFGDRR
Ga0314702_130699313300032725SeawaterEVGVARRGASHGGLALAATAALALAAVALVYANTSSEWPGSALMSEGQRTTKLAWGGFTLAMQDEADKALRLCKVGLLGPNQHCATHVVSTDDTKWTHSDAGQPTWEESQMVLSRQSSVIPRGPDIGTPGDFGDRR
Ga0314696_1057273713300032728SeawaterALAATAALALAAVALVYANTSSEWPGSALMSEGQRTTKLAWGGFTLAMQDEADKALRLCKVGLLGPNQHCATHVVSTDDTKWTHSDAGQPTWEESQMVLSRQSSVIPRGPDIGTPGDFGDRR
Ga0314699_1037336113300032730SeawaterLAASVPRMCSLCMPCALTPVWRTSPADGTFVPEVGVARRGASHGGLALAATAALALAAVALVYANTSSEWPGSALMSEGQRTTKLAWGGFTLAMQDEADKALRLCKVGLLGPNQHCATHVVSTDDTKWTHSDAGQPTWEESQMVLSRQSSVIPRGPDIGTPGDFGDRR
Ga0314699_1044671013300032730SeawaterMPEVGVARRGRAAGGLAVVAVAALAVAMVALVYANTSSEWPGSVLMSEGQRTTKLAWGGFTNQMQEEADKALRLCKVGLLGKKQHCATHVVSTDFTKWTHTDAGQPTWEESQRVLSQQTSVIPSGPDIGTPGDFGDRR
Ga0314711_1049470223300032732SeawaterASHGGLALAATAALALAAVALVYANTSSEWPGSALMSEGQRTTKLAWGGFTLAMQDEADKALRLCKVGLLGPNQHCATHVVSTDDTKWTHSDAGQPTWEESQMVLSRQSSVIPRGPDIGTPGDFGDRR
Ga0314706_1055403613300032734SeawaterSHGGLALAATAALALAAVALVYANTSSEWPGSALMSEGQRTTKLAWGGFTLAMQDEADKALRLCKVGLLGPNQHCATHVVSTDDTKWTHSDAGQPTWEESQMVLSRQSSVIPRGPDIGTPGDFGDRR
Ga0314707_1062619713300032743SeawaterPEVGVARRGASHGGLALAATAALALAAVALVYANTSSEWPGSALMSEGQRTTKLAWGGFTLAMQDEADKALRLCKVGLLGPNQHCATHVVSTDDTKWTHSDAGQPTWEESQMVLSRQSSVIPRGPDIGTPGDFGDRR
Ga0314705_1060701313300032744SeawaterHFAMAYGTFVPEVGVARRGASHGGLALAATAALALAAVALVYANTSSEWPGSALMSEGQRTTKLAWGGFTLAMQDEADKALRLCKVGLLGPNQHCATHVVSTDDTKWTHSDAGQPTWEESQMVLSRQSSVIPRGPDIGTPGDFGDRR
Ga0314691_1031961613300032749SeawaterRFKNDYPNRIGPGRFAMAYGTFVPEVGVARRGSHGGLALAATAALALAAVALVYANTSSEWPGSALMSEGQRTTKLAWGGFTLAMQDEADKALRLCKVGLLGPNQHCATHVVSTDDTKWTHSDAGQPTWEESQMVLSRQSSVIPRGPDIGTPGDFGDRR
Ga0314700_1045584613300032752SeawaterCGELAASVPRMCSLCMPCALTPVWRTSPADGTFVPEVGVARRGSHGGLALAATAALALAAVALVYANTSSEWPGSALMSEGQRTTKLAWGGFTLAMQDEADKALRLCKVGLLGPNQHCATHVVSTDDTKWTHSDAGQPTWEESQMVLSRQSSVIPRGPDIGTPGDFGDRR
Ga0314692_1060070113300032754SeawaterFVPEVGVARRGASHGGLALAATAALALAAVALVYANTSSEWPGSALMSEGQRTTKLAWGGFTLAMQDEADKALRLCKVGLLGPNQHCATHVVSTDDTKWTHSDAGQPTWEESQMVLSRQSSVIPRGPDIGTPGDFGDRR
Ga0335058_0528513_195_6023300034121FreshwaterMPEVGVARRGRAAGGLAAVAVAALALAMVALVYANTSSEWPASVMMSEGQRTTKLAWGGFTLDMQKEADKALRLCKVGLLGTKQHCATHVVSTEDTKWTHTDAGQPVWEESTNVLDSQVTETHAYTHFMYVCVYT
Ga0335061_0236162_1_3243300034168FreshwaterMPEVGVARRGRAAGGLAVVAVAALALAMVALVYANTSSEWPASVMMSQGQRTTKLAWGGFTLDMQKEADKALRLCKVGLLGTKQHCATHVVSTEDTKWTHTDAGQPVW

 ⦗Top⦘


Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.