NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F101260

Metagenome / Metatranscriptome Family F101260

Go to section:
Overview Alignments Structure & Topology Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F101260
Family Type Metagenome / Metatranscriptome
Number of Sequences 102
Average Sequence Length 54 residues
Representative Sequence NTTNSNMADIYFESKYLTYLFKVPGKYEITLELTDTNGNKYKKGRNILVIK
Number of Associated Samples 97
Number of Associated Scaffolds 102

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Viruses
% of genes with valid RBS motifs 1.03 %
% of genes near scaffold ends (potentially truncated) 93.14 %
% of genes from short scaffolds (< 2000 bps) 77.45 %
Associated GOLD sequencing projects 91
AlphaFold2 3D model prediction No

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group unclassified viruses (81.373 % of family members)
NCBI Taxonomy ID 12429
Taxonomy All Organisms → Viruses → unclassified viruses

Most Common Ecosystem
GOLD Ecosystem Environmental → Aquatic → Marine → Coastal → Unclassified → Seawater
(15.686 % of family members)
Environment Ontology (ENVO) Unclassified
(46.078 % of family members)
Earth Microbiome Project Ontology (EMPO) Free-living → Saline → Water (saline)
(73.529 % of family members)



 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      


 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 0.00%    β-sheet: 56.86%    Coil/Unstructured: 43.14%
Feature Viewer
Powered by Feature Viewer


 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms94.12 %
UnclassifiedrootN/A5.88 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
3300000130|SA_S2_NOR15_50mDRAFT_c10222888All Organisms → Viruses → unclassified viruses → Virus NIOZ-UU157588Open in IMG/M
3300000949|BBAY94_12629138All Organisms → Viruses → unclassified viruses → Virus NIOZ-UU157602Open in IMG/M
3300001344|JGI20152J14361_10016318All Organisms → Viruses → unclassified viruses → Virus NIOZ-UU1572906Open in IMG/M
3300001589|JGI24005J15628_10002034All Organisms → Viruses → unclassified viruses → Virus NIOZ-UU15710489Open in IMG/M
3300001589|JGI24005J15628_10063240All Organisms → Viruses → unclassified viruses → Virus NIOZ-UU1571371Open in IMG/M
3300002186|JGI24539J26755_10160557All Organisms → Viruses → unclassified viruses → Virus NIOZ-UU157649Open in IMG/M
3300002835|B570J40625_100183411All Organisms → Viruses → Predicted Viral2305Open in IMG/M
3300003543|FS898DNA_10384414All Organisms → Viruses → unclassified viruses → Virus NIOZ-UU157559Open in IMG/M
3300004097|Ga0055584_100410041All Organisms → Viruses → unclassified viruses → Virus NIOZ-UU1571403Open in IMG/M
3300004097|Ga0055584_100430183All Organisms → Viruses → unclassified viruses → Virus NIOZ-UU1571368Open in IMG/M
3300004448|Ga0065861_1147940All Organisms → Viruses → unclassified viruses → Virus NIOZ-UU1571020Open in IMG/M
3300004461|Ga0066223_1027748All Organisms → Viruses → unclassified viruses → Virus NIOZ-UU157938Open in IMG/M
3300005590|Ga0070727_10429144All Organisms → Viruses → unclassified viruses → Virus NIOZ-UU157737Open in IMG/M
3300006357|Ga0075502_1511674All Organisms → Viruses → unclassified viruses → Virus NIOZ-UU1572182Open in IMG/M
3300006402|Ga0075511_1321388All Organisms → Viruses → unclassified viruses → Virus NIOZ-UU157678Open in IMG/M
3300006405|Ga0075510_11026813All Organisms → Viruses → unclassified viruses → Virus NIOZ-UU1571627Open in IMG/M
3300006571|Ga0075505_1440613All Organisms → Viruses → unclassified viruses → Virus NIOZ-UU157510Open in IMG/M
3300006868|Ga0075481_10183424All Organisms → Viruses → unclassified viruses → Virus NIOZ-UU157753Open in IMG/M
3300006869|Ga0075477_10211825All Organisms → Viruses → unclassified viruses → Virus NIOZ-UU157790Open in IMG/M
3300006924|Ga0098051_1083796All Organisms → Viruses → unclassified viruses → Virus NIOZ-UU157861Open in IMG/M
3300007276|Ga0070747_1037587All Organisms → Viruses → unclassified viruses → Virus NIOZ-UU1571893Open in IMG/M
3300007345|Ga0070752_1042687All Organisms → Viruses → unclassified viruses → Virus NIOZ-UU1572129Open in IMG/M
3300007523|Ga0105052_10736616All Organisms → Viruses → unclassified viruses → Virus NIOZ-UU157624Open in IMG/M
3300007640|Ga0070751_1279770All Organisms → Viruses → unclassified viruses → Virus NIOZ-UU157626Open in IMG/M
3300007715|Ga0102827_1141965All Organisms → Viruses → unclassified viruses → Virus NIOZ-UU157551Open in IMG/M
3300008448|Ga0114876_1099708All Organisms → Viruses → unclassified viruses → Virus NIOZ-UU1571160Open in IMG/M
3300008470|Ga0115371_10694075All Organisms → Viruses → unclassified viruses → Virus NIOZ-UU1573217Open in IMG/M
3300008470|Ga0115371_11066683All Organisms → Viruses → unclassified viruses → Virus NIOZ-UU157591Open in IMG/M
3300009420|Ga0114994_10389143All Organisms → Viruses → unclassified viruses → Virus NIOZ-UU157924Open in IMG/M
3300009423|Ga0115548_1212133All Organisms → Viruses → unclassified viruses → Virus NIOZ-UU157598Open in IMG/M
3300009495|Ga0115571_1011648All Organisms → Viruses → unclassified viruses → Virus NIOZ-UU1574820Open in IMG/M
3300009526|Ga0115004_10939630All Organisms → Viruses → unclassified viruses → Virus NIOZ-UU157517Open in IMG/M
3300009677|Ga0115104_11073079All Organisms → Viruses → unclassified viruses → Virus NIOZ-UU157858Open in IMG/M
3300009790|Ga0115012_11628253All Organisms → Viruses → unclassified viruses → Virus NIOZ-UU157560Open in IMG/M
3300010309|Ga0102890_1046902All Organisms → Viruses → unclassified viruses → Virus NIOZ-UU157852Open in IMG/M
3300010430|Ga0118733_100016792All Organisms → cellular organisms → Bacteria17518Open in IMG/M
3300010883|Ga0133547_12066247All Organisms → Viruses → unclassified viruses → Virus NIOZ-UU1571040Open in IMG/M
3300012419|Ga0138260_10151477All Organisms → Viruses → unclassified viruses → Virus NIOZ-UU157739Open in IMG/M
3300013004|Ga0164293_10261862All Organisms → Viruses → unclassified viruses → Virus NIOZ-UU1571216Open in IMG/M
3300013010|Ga0129327_10796804All Organisms → Viruses → unclassified viruses → Virus NIOZ-UU157536Open in IMG/M
3300013098|Ga0164320_10015574All Organisms → Viruses → Predicted Viral2916Open in IMG/M
3300013098|Ga0164320_10039168All Organisms → Viruses → Predicted Viral1904Open in IMG/M
3300017743|Ga0181402_1139216All Organisms → Viruses → unclassified viruses → Virus NIOZ-UU157618Open in IMG/M
3300017755|Ga0181411_1033614All Organisms → Viruses → unclassified viruses → Virus NIOZ-UU1571624Open in IMG/M
3300017758|Ga0181409_1091875All Organisms → Viruses → unclassified viruses → Virus NIOZ-UU157908Open in IMG/M
3300017781|Ga0181423_1019604All Organisms → Viruses → Predicted Viral2785Open in IMG/M
3300017967|Ga0181590_10632288All Organisms → Viruses → unclassified viruses → Virus NIOZ-UU157729Open in IMG/M
3300017968|Ga0181587_10265672All Organisms → Viruses → unclassified viruses → Virus NIOZ-UU1571167Open in IMG/M
3300018065|Ga0180430_10564521All Organisms → Viruses → unclassified viruses → Virus NIOZ-UU157783Open in IMG/M
3300018421|Ga0181592_10154325All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → unclassified Phycisphaerae → Phycisphaerae bacterium1748Open in IMG/M
3300018428|Ga0181568_10771844All Organisms → Viruses → unclassified viruses → Virus NIOZ-UU157745Open in IMG/M
3300020184|Ga0181573_10280807All Organisms → Viruses → unclassified viruses → Virus NIOZ-UU157832Open in IMG/M
3300020382|Ga0211686_10056328All Organisms → Viruses → unclassified viruses → Virus NIOZ-UU1571590Open in IMG/M
3300020453|Ga0211550_10115001All Organisms → Viruses → Predicted Viral1269Open in IMG/M
3300020810|Ga0181598_1298108All Organisms → Viruses → unclassified viruses → Virus NIOZ-UU157574Open in IMG/M
3300021443|Ga0206681_10414214All Organisms → Viruses → unclassified viruses → Virus NIOZ-UU157519Open in IMG/M
3300022164|Ga0212022_1051968All Organisms → Viruses → unclassified viruses → Virus NIOZ-UU157633Open in IMG/M
3300023115|Ga0255760_10156853All Organisms → Viruses → unclassified viruses → Virus NIOZ-UU1571273Open in IMG/M
3300023176|Ga0255772_10172537All Organisms → Viruses → unclassified viruses → Virus NIOZ-UU1571259Open in IMG/M
3300023297|Ga0222640_1060500All Organisms → Viruses → unclassified viruses → Virus NIOZ-UU157818Open in IMG/M
3300023568|Ga0228696_1003126All Organisms → Viruses → unclassified viruses → Virus NIOZ-UU1571876Open in IMG/M
3300024183|Ga0228603_1029669All Organisms → Viruses → unclassified viruses → Virus NIOZ-UU157790Open in IMG/M
3300025099|Ga0208669_1012925All Organisms → Viruses → unclassified viruses → Virus NIOZ-UU1572282Open in IMG/M
3300025626|Ga0209716_1022071All Organisms → Viruses → Predicted Viral2530Open in IMG/M
3300025696|Ga0209532_1022671All Organisms → Viruses → unclassified viruses → Virus NIOZ-UU1572953Open in IMG/M
3300025751|Ga0208150_1025647All Organisms → Viruses → unclassified viruses → Virus NIOZ-UU1572070Open in IMG/M
3300025816|Ga0209193_1112240All Organisms → Viruses → unclassified viruses → Virus NIOZ-UU157667Open in IMG/M
3300025853|Ga0208645_1033158All Organisms → Viruses → unclassified viruses → Virus NIOZ-UU1572654Open in IMG/M
3300025860|Ga0209119_1218421All Organisms → Viruses → unclassified viruses → Virus NIOZ-UU157727Open in IMG/M
3300026094|Ga0209937_1073302Not Available555Open in IMG/M
3300026466|Ga0247598_1043962All Organisms → Viruses → unclassified viruses → Virus NIOZ-UU1571258Open in IMG/M
3300026495|Ga0247571_1059926All Organisms → Viruses → unclassified viruses → Virus NIOZ-UU157865Open in IMG/M
3300026503|Ga0247605_1000280All Organisms → Viruses → unclassified viruses → Virus NIOZ-UU1578115Open in IMG/M
3300026513|Ga0247590_1071341All Organisms → Viruses → unclassified viruses → Virus NIOZ-UU157899Open in IMG/M
3300027248|Ga0208176_1044803All Organisms → Viruses → unclassified viruses → Virus NIOZ-UU157570Open in IMG/M
3300027582|Ga0208971_1149090All Organisms → Viruses → unclassified viruses → Virus NIOZ-UU157500Open in IMG/M
3300027791|Ga0209830_10160649All Organisms → Viruses → unclassified viruses → Virus NIOZ-UU1571070Open in IMG/M
3300027805|Ga0209229_10395247All Organisms → Viruses → unclassified viruses → Virus NIOZ-UU157601Open in IMG/M
3300027820|Ga0209578_10341705All Organisms → Viruses → unclassified viruses → Virus NIOZ-UU157690Open in IMG/M
3300027849|Ga0209712_10462347All Organisms → Viruses → unclassified viruses → Virus NIOZ-UU157712Open in IMG/M
3300027978|Ga0209165_10288892All Organisms → Viruses → unclassified viruses → Virus NIOZ-UU157552Open in IMG/M
3300028109|Ga0247582_1044429All Organisms → Viruses → Predicted Viral1155Open in IMG/M
3300028111|Ga0233397_1003528All Organisms → Viruses → unclassified viruses → Virus NIOZ-UU1576901Open in IMG/M
3300028131|Ga0228642_1020979All Organisms → Viruses → Predicted Viral1917Open in IMG/M
3300028137|Ga0256412_1075638All Organisms → Viruses → Predicted Viral1203Open in IMG/M
3300028416|Ga0228614_1062430All Organisms → Viruses → unclassified viruses → Virus NIOZ-UU157758Open in IMG/M
3300028416|Ga0228614_1077910All Organisms → Viruses → unclassified viruses → Virus NIOZ-UU157642Open in IMG/M
3300028418|Ga0228615_1056291All Organisms → Viruses → unclassified viruses → Virus NIOZ-UU1571170Open in IMG/M
3300029787|Ga0183757_1022949All Organisms → Viruses → Predicted Viral1447Open in IMG/M
3300031143|Ga0308025_1004772All Organisms → Viruses → unclassified viruses → Virus NIOZ-UU1575831Open in IMG/M
3300031175|Ga0308020_1037561All Organisms → Viruses → unclassified viruses → Virus NIOZ-UU1571180Open in IMG/M
3300031628|Ga0308014_1042281All Organisms → Viruses → unclassified viruses → Virus NIOZ-UU1571139Open in IMG/M
3300031656|Ga0308005_10045270All Organisms → Viruses → unclassified viruses → Virus NIOZ-UU1571149Open in IMG/M
3300031676|Ga0302136_1180078All Organisms → Viruses → unclassified viruses → Virus NIOZ-UU157634Open in IMG/M
3300031851|Ga0315320_10460773All Organisms → Viruses → unclassified viruses → Virus NIOZ-UU157866Open in IMG/M
3300032032|Ga0315327_10096542All Organisms → Viruses → Predicted Viral1815Open in IMG/M
3300032073|Ga0315315_11295811All Organisms → Viruses → unclassified viruses → Virus NIOZ-UU157640Open in IMG/M



 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
SeawaterEnvironmental → Aquatic → Marine → Coastal → Unclassified → Seawater15.69%
AqueousEnvironmental → Aquatic → Marine → Coastal → Unclassified → Aqueous13.73%
MarineEnvironmental → Aquatic → Marine → Oceanic → Unclassified → Marine11.76%
Salt MarshEnvironmental → Aquatic → Marine → Intertidal Zone → Salt Marsh → Salt Marsh7.84%
Pelagic MarineEnvironmental → Aquatic → Marine → Neritic Zone → Unclassified → Pelagic Marine4.90%
Marine SedimentEnvironmental → Aquatic → Marine → Coastal → Sediment → Marine Sediment3.92%
SeawaterEnvironmental → Aquatic → Marine → Intertidal Zone → Unclassified → Seawater3.92%
MarineEnvironmental → Aquatic → Marine → Unclassified → Unclassified → Marine3.92%
MarineEnvironmental → Aquatic → Marine → Unclassified → Unclassified → Marine3.92%
Pelagic MarineEnvironmental → Aquatic → Marine → Pelagic → Unclassified → Pelagic Marine3.92%
SeawaterEnvironmental → Aquatic → Marine → Strait → Unclassified → Seawater3.92%
EstuarineEnvironmental → Aquatic → Marine → Intertidal Zone → Estuary → Estuarine2.94%
MarineEnvironmental → Aquatic → Marine → Coastal → Unclassified → Marine1.96%
Marine SedimentEnvironmental → Aquatic → Marine → Hydrothermal Vents → Sediment → Marine Sediment1.96%
SedimentEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Sediment1.96%
FreshwaterEnvironmental → Aquatic → Freshwater → Lentic → Epilimnion → Freshwater0.98%
Freshwater And SedimentEnvironmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater And Sediment0.98%
FreshwaterEnvironmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater0.98%
Freshwater LakeEnvironmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake0.98%
FreshwaterEnvironmental → Aquatic → Freshwater → Ice → Glacial Lake → Freshwater0.98%
Freshwater To Marine Saline GradientEnvironmental → Aquatic → Marine → Coastal → Unclassified → Freshwater To Marine Saline Gradient0.98%
MarineEnvironmental → Aquatic → Marine → Intertidal Zone → Unclassified → Marine0.98%
MarineEnvironmental → Aquatic → Marine → Intertidal Zone → Sediment → Marine0.98%
Diffuse Hydrothermal Flow Volcanic VentEnvironmental → Aquatic → Marine → Hydrothermal Vents → Diffuse Flow → Diffuse Hydrothermal Flow Volcanic Vent0.98%
Saline WaterEnvironmental → Aquatic → Non-Marine Saline And Alkaline → Saline → Unclassified → Saline Water0.98%
Pond WaterEnvironmental → Aquatic → Non-Marine Saline And Alkaline → Saline → Unclassified → Pond Water0.98%
Hypersaline Lake SedimentEnvironmental → Aquatic → Non-Marine Saline And Alkaline → Hypersaline → Sediment → Hypersaline Lake Sediment0.98%
Macroalgal SurfaceHost-Associated → Algae → Green Algae → Ectosymbionts → Unclassified → Macroalgal Surface0.98%
Polar MarineEnvironmental → Aquatic → Marine → Unclassified → Unclassified → Polar Marine0.98%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
3300000130Marine microbial communities from chronically polluted sediments in Adventfjord, Norway - Svalbard Archipelago station 2 sample NOR 15_50mEnvironmentalOpen in IMG/M
3300000949Macroalgal surface ecosystem from Botany Bay, Sydney, Australia - BBAY94Host-AssociatedOpen in IMG/M
3300001344Pelagic Microbial community sample from North Sea - COGITO 998_met_02EnvironmentalOpen in IMG/M
3300001589Marine viral communities from the Pacific Ocean - LP-40EnvironmentalOpen in IMG/M
3300002186Marine eukaryotic phytoplankton communities from the Norwegian Sea - 10m ARK-5M MetagenomeEnvironmentalOpen in IMG/M
3300002835Freshwater microbial communities from Lake Mendota, WI - (Lake Mendota Combined Ray assembly, ASSEMBLY_DATE=20140605)EnvironmentalOpen in IMG/M
3300003543Diffuse hydrothermal flow volcanic vent microbial communities from Axial Seamount, northeast Pacific ocean - Sample FS898_N3Area_DNAEnvironmentalOpen in IMG/M
3300004097Pelagic marine sediment microbial communities from the LTER site Helgoland, North Sea, for post-phytoplankton bloom and carbon turnover studies - OSD3 (Helgoland) metaGEnvironmentalOpen in IMG/M
3300004448Marine viral communities from Newfoundland, Canada BC-1EnvironmentalOpen in IMG/M
3300004461Marine viral communities from Newfoundland, Canada BC-2EnvironmentalOpen in IMG/M
3300005590Marine sediment microbial communities from the Atlantic coast under amendment with organic carbon and nitrate - tdAd47.2EnvironmentalOpen in IMG/M
3300006357Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_22_D_<0.8_RNA1 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300006402Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_29_D_<0.8_RNA2 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300006405Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_29_D_<0.8_RNA1 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300006571Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_22_D_>0.8_RNA2 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300006868Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_29_N_>0.8_DNAEnvironmentalOpen in IMG/M
3300006869Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_22_N_>0.8_DNAEnvironmentalOpen in IMG/M
3300006924Marine viral communities from the Subarctic Pacific Ocean - 14B_ETSP_OMZ_AT15311_CsCl metaGEnvironmentalOpen in IMG/M
3300007229Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_30_<0.8_DNAEnvironmentalOpen in IMG/M
3300007276Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Mar_31EnvironmentalOpen in IMG/M
3300007345Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Aug_30EnvironmentalOpen in IMG/M
3300007523Freshwater microbial communities from Lake Fryxell liftoff mats and glacier meltwater in Antarctica - FRY-03EnvironmentalOpen in IMG/M
3300007640Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Aug_28EnvironmentalOpen in IMG/M
3300007715Estuarine microbial communities from the Columbia River estuary - metaG S.751EnvironmentalOpen in IMG/M
3300008448Freshwater viral communities during cyanobacterial harmful algal blooms (CHABs) in Western Lake Erie, USA - August 4, 2014 all contigsEnvironmentalOpen in IMG/M
3300008470Sediment core microbial communities from Adelie Basin, Antarctica. Combined Assembly of Gp0136540, Gp0136562, Gp0136563EnvironmentalOpen in IMG/M
3300009420Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB2_152EnvironmentalOpen in IMG/M
3300009423Pelagic marine microbial communities from North Sea - COGITO_mtgs_100423EnvironmentalOpen in IMG/M
3300009495Pelagic marine microbial communities from North Sea - COGITO_mtgs_120531EnvironmentalOpen in IMG/M
3300009526Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB11_90EnvironmentalOpen in IMG/M
3300009677Marine eukaryotic communities from Pacific Ocean to study complex ecological interactions - CN13ID_70_C50_10m_0.8um Metatranscriptome (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300009790Marine eukaryotic phytoplankton communities from Atlantic Ocean - Tropical Atlantic ANT10 MetagenomeEnvironmentalOpen in IMG/M
3300010309Estuarine microbial communities from the Columbia River estuary - metaG 1552A-3EnvironmentalOpen in IMG/M
3300010430Marine sediment microbial communities from Gulf of Thailand under amendment with organic carbon and nitrate - JGI co-assembly of 8 samplesEnvironmentalOpen in IMG/M
3300010883western Arctic Ocean co-assemblyEnvironmentalOpen in IMG/M
3300012419Metatranscriptomics of polar marine prokaryotic and eukaryotic communities from Palmer Station, Antarctica after 24hr light incubation - RNA10.B_24.20151111 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300013004Eutrophic lake water microbial communities from Lake Mendota, Wisconsin, USA - GEODES118 metaGEnvironmentalOpen in IMG/M
3300013010Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Spr_31_0.8_DNAEnvironmentalOpen in IMG/M
3300013098Subseafloor sediment microbial communities from Guaymas Basin, Gulf of California, Mexico - Guay11, Core 4567-28, 0-3 cmEnvironmentalOpen in IMG/M
3300017743Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 25 SPOT_SRF_2011-08-17EnvironmentalOpen in IMG/M
3300017755Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 34 SPOT_SRF_2012-07-09EnvironmentalOpen in IMG/M
3300017758Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 32 SPOT_SRF_2012-05-30EnvironmentalOpen in IMG/M
3300017781Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 46 SPOT_SRF_2013-08-14EnvironmentalOpen in IMG/M
3300017967Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 071411BT metaG (megahit assembly)EnvironmentalOpen in IMG/M
3300017968Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 071409AT metaG (megahit assembly)EnvironmentalOpen in IMG/M
3300018065Hypersaline lake sediment archaeal communities from the Salton Sea, California, USA - SS_1_S_2 metaGEnvironmentalOpen in IMG/M
3300018421Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 071412BT metaG (megahit assembly)EnvironmentalOpen in IMG/M
3300018428Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 101404AT metaG (megahit assembly)EnvironmentalOpen in IMG/M
3300020184Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 101409BT metaG (spades assembly)EnvironmentalOpen in IMG/M
3300020382Marine microbial communities from Tara Oceans - TARA_B100000780 (ERX556058-ERR599059)EnvironmentalOpen in IMG/M
3300020453Marine microbial communities from Tara Oceans - TARA_B100001758 (ERX556003-ERR598963)EnvironmentalOpen in IMG/M
3300020810Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 041404US metaG (spades assembly)EnvironmentalOpen in IMG/M
3300021443Ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M1 500m 12015EnvironmentalOpen in IMG/M
3300022164Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Mar_31 (v2)EnvironmentalOpen in IMG/M
3300023115Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 071410BT metaGEnvironmentalOpen in IMG/M
3300023176Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 071411BT metaGEnvironmentalOpen in IMG/M
3300023297Saline water microbial communities from Ace Lake, Antarctica - #187EnvironmentalOpen in IMG/M
3300023568Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - 84R (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300024183Seawater microbial communities from Monterey Bay, California, United States - 3DEnvironmentalOpen in IMG/M
3300024322Seawater microbial communities from Monterey Bay, California, United States - 68DEnvironmentalOpen in IMG/M
3300025099Marine viral communities from the Subarctic Pacific Ocean - 21_ETSP_OMZ_AT15319 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025543Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1504_2 Viral MetaG (SPAdes)EnvironmentalOpen in IMG/M
3300025626Pelagic marine microbial communities from North Sea - COGITO_mtgs_120531 (SPAdes)EnvironmentalOpen in IMG/M
3300025696Pelagic Microbial community sample from North Sea - COGITO 998_met_02 (SPAdes)EnvironmentalOpen in IMG/M
3300025751Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_29_D_>0.8_DNA (SPAdes)EnvironmentalOpen in IMG/M
3300025816Pelagic marine microbial communities from North Sea - COGITO_mtgs_100330 (SPAdes)EnvironmentalOpen in IMG/M
3300025853Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Sep_01 (SPAdes)EnvironmentalOpen in IMG/M
3300025860Pelagic Microbial community sample from North Sea - COGITO 998_met_03 (SPAdes)EnvironmentalOpen in IMG/M
3300026094Salt pond water microbial communities from South San Francisco under conditions of wetland restoration - Salt Pond MetaG R1_B_H2O_MG (SPAdes)EnvironmentalOpen in IMG/M
3300026466Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - 70R (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300026495Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - 24R (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300026503Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - 91R (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300026513Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - 51R (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300027248Estuarine microbial communities from the Columbia River estuary - metaG 1558A-3 (SPAdes)EnvironmentalOpen in IMG/M
3300027582Ammonia-oxidizing marine microbial communities from Monterey Bay, California, USA - CAN11_18_M0_10 (SPAdes)EnvironmentalOpen in IMG/M
3300027791Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB8_130 (SPAdes)EnvironmentalOpen in IMG/M
3300027805Freshwater and sediment microbial communities from dead zone in Sandusky Bay, Ohio, USA (SPAdes)EnvironmentalOpen in IMG/M
3300027820Marine sediment microbial communities from the Atlantic coast under amendment with organic carbon and nitrate - tdAd47.2 (SPAdes)EnvironmentalOpen in IMG/M
3300027849Marine eukaryotic phytoplankton communities from Arctic Ocean - Arctic Ocean - Greenland ARC118M Metagenome (SPAdes)EnvironmentalOpen in IMG/M
3300027978Marine sediment microbial communities from the Atlantic coast under amendment with organic carbon and nitrate - tdAd00.1 (SPAdes)EnvironmentalOpen in IMG/M
3300028106Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - 66R (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300028109Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - 41R (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300028111Seawater microbial communities from Monterey Bay, California, United States - 35DEnvironmentalOpen in IMG/M
3300028131Seawater microbial communities from Monterey Bay, California, United States - 53DEnvironmentalOpen in IMG/M
3300028137Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - WCR_74 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300028282Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - WCR_77 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300028416Seawater microbial communities from Monterey Bay, California, United States - 15DEnvironmentalOpen in IMG/M
3300028418Seawater microbial communities from Monterey Bay, California, United States - 16DEnvironmentalOpen in IMG/M
3300029787Marine viral communities collected during Tara Oceans survey from station TARA_018 - TARA_A100000172EnvironmentalOpen in IMG/M
3300031143Marine microbial communities from water near the shore, Antarctic Ocean - #422EnvironmentalOpen in IMG/M
3300031175Marine microbial communities from water near the shore, Antarctic Ocean - #349EnvironmentalOpen in IMG/M
3300031628Marine microbial communities from water near the shore, Antarctic Ocean - #229EnvironmentalOpen in IMG/M
3300031656Marine microbial communities from water near the shore, Antarctic Ocean - #67EnvironmentalOpen in IMG/M
3300031676Marine microbial communities from Western Arctic Ocean, Canada - CBN3_20mEnvironmentalOpen in IMG/M
3300031851Ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M1 40m 21515EnvironmentalOpen in IMG/M
3300032032Ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M1 100m 32315EnvironmentalOpen in IMG/M
3300032073Ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M1 40m 3416EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap



 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
SA_S2_NOR15_50mDRAFT_1022288813300000130MarineVADIYFESKYLTYLFKDPGKYMISLELTDTNGNKYKKDRNIVNIKQIKQNGN*
BBAY94_1262913813300000949Macroalgal SurfaceTITNTTNSSVADIYFESKYLTYLFKDPGKYMITLELTDTNGNKYKKGRNILNIKQTK*
JGI20152J14361_1001631813300001344Pelagic MarineIIKNTTNSKMADIYFESKYLTYLFKESGKYEITLELTDTNGNKYKKGRNILVIK*
JGI24005J15628_1000203463300001589MarineTNSSVADIYFESKYLTYLFKDPGKYMITLELTDTNGNKYKKGRNILNIKEINRSQQI*
JGI24005J15628_1006324013300001589MarineTNSSVADIYFESKYLTYLFKDPGKYMITLELTDTNGNKYKKGRNILNIKQTK*
JGI24539J26755_1016055713300002186MarinePRWTISNTTNSSVADIYFESKYLTYLFKDPGKYMITLELTDTNGNKYKKGRNILNIKQTK
B570J40625_10018341133300002835FreshwaterMPDIYFESKYLTYLFQKPGRYEIGLELTDSNGNKYKKERNILIIK*
FS898DNA_1038441413300003543Diffuse Hydrothermal Flow Volcanic VentKCRIVGKAEARWTISNTTNSSVADIYFDSKYLTYLFKDPGKYMITLELTDTNGNKYKKDRNILNIKQTK*
Ga0055584_10041004113300004097Pelagic MarineIYFESKYLTYLFKDPGKYMISLELTDTNGNKYKKDRNILNIKEIERSQQI*
Ga0055584_10043018313300004097Pelagic MarineIYFESKYLTYLFKDPGKYMITLELTDTNGNKYKKGRNILNIKQTK*
Ga0065861_114794013300004448MarineNTTNSSVADIYFESKYLTYLFKDPGKYMITLELTDTNGNKYKKGRNILNIKEISKSQQI*
Ga0066223_102774833300004461MarineESKYLTYLFKDPGKYMITLELTDSNGNKYKKGRNILNIKQIKQNGN*
Ga0070727_1042914413300005590Marine SedimentMADIYFESKYLTYLFKESGKYEITLELTDTNGNKYKKGRNILVIK*
Ga0075502_151167413300006357AqueousFESKYLTYLFKHPGKYEITLELTDTNGNKYKKGRNILVIK*
Ga0075511_132138813300006402AqueousLTYLFKHPGKYEITLELTDTNGNKYKKGRNILVIK*
Ga0075510_1102681333300006405AqueousPGKANPRWTIKNTTNSRVADIYFESKYLTYLFKHPGKYEITLELTDTNGNKYKKGRNILVIK*
Ga0075505_144061313300006571AqueousPGKANPRWIIKNTTNSRVADIYFESKYLTYLFKHPGKYEIALELTDTNGNKYKKGRNILVIK*
Ga0075481_1018342413300006868AqueousIIKNTTARNRSDIYFESKYLTYLFQDPGKYEITLELTDSNGNKYKKGRNILIIK*
Ga0075477_1021182513300006869AqueousSDIYFESKYLTYLFQDPGKYEITLELTDSNGNKYKKGRNILIIK*
Ga0098051_108379623300006924MarineRWIISNTTNSSVADIYFESKYLTYLFKDPGKYMISLELTDTNGNKYKKDRNILNIKEIERSQQI*
Ga0075468_1020402723300007229AqueousSKYLTYLFKDPGKYMITLELTDTNGNKYKKDRNILNIKQTK*
Ga0070747_103758733300007276AqueousYDKCKIPGKANPRWIIKNTTNLNMADIYFESKYLTYLFKESGKYEITLELTDTNGNKYKKGRNILVIK*
Ga0070752_104268723300007345AqueousMFVYDKCKIPGKANPRWIIKNTTNSRVADIYFESKYLTYLFKHPGKYEIALELTDTNGNKYKKGRNILVIK*
Ga0105052_1073661613300007523FreshwaterPKWTISNTTNSSVADIYFESKYLTYLFKDPGKYMITLELTDNNGNKYKKGRNILNIKQIN
Ga0070751_127977023300007640AqueousNVADIYFESKYLTYLFKHPGKYEITLELTDTNGNKYKKGRNILVIK*
Ga0102827_114196513300007715EstuarineTNLNMADIYFESKYLTYLFKESGKYEITLELTDTNGNKYKKGRNILVIK*
Ga0114876_109970833300008448Freshwater LakeNTSNPNTPNIYFESKYLTYLFQNPGRYEIGLELTDSNGNKYKKERNILIIK*
Ga0115371_1069407513300008470SedimentRWTISNTTNSSVADIYFESKYLTYLFKDPGKYMITLELTDTNGNKYKKGRNILNIKQTK*
Ga0115371_1106668323300008470SedimentSSVADIYFESKYLTYLFKDPGKYMITLELTDTNGNKYKKGRNILNIKQTN*
Ga0114994_1038914333300009420MarineISNTTNSSVADIYFESKYLTYLFKDPGKYMITLELTDTNGNKYKKGRNIVNIKQIKQNGN
Ga0115548_121213313300009423Pelagic MarineTNSSMADIYFESKYLTYLFKNSGKYEITLELTDTNGNKYKKNRNILVIK*
Ga0115571_101164813300009495Pelagic MarineIPGKTNPRWIIKNTTNSKMADIYFESKYLTYLFKESGKYEITLELTDTNGNKYKKGRNILVIK*
Ga0115004_1093963023300009526MarineADIYFESKYLTYLFKDPGKYMITLELTDTNGNKYKKGRNIVNIKQIKQNGN*
Ga0115104_1107307913300009677MarineSSVADIYFESKYLTYLFKDPGKYMITLELTDTNGNKYKKGRNILNIKEIERSQQI*
Ga0115012_1162825323300009790MarineDIYFNSKYLTYLFKDPGKYVITLELTDSNGNKYKKDRNILNIKEVAIS*
Ga0102890_104690223300010309EstuarineNMADIYFESKYLTYLFKESGKYEITLELTDTNGNKYKKGRNILVIK*
Ga0118733_10001679213300010430Marine SedimentAPRWTISNTTNSSVADIYFESKYLTYLFKDPGKYMITLELTDTNGNKYKKGRNILNIKQTK*
Ga0133547_1206624733300010883MarineADIYFESKYLTYLFKNPGKYVVGLELTDSNGNKYNKDRNILNIK*
Ga0138260_1015147713300012419Polar MarinePKWTISNTTNSSVADIYFESKYLTYLFKDPGKYMISLELTDTNGNKYKQDRNIVNIKQTK
Ga0164293_1026186233300013004FreshwaterKINGKGKPKWTIRNTSNPNTPDIYFESKYLTYLFQDPGRYEIGLELTDSNGNKYKKERNILIIK*
Ga0129327_1079680413300013010Freshwater To Marine Saline GradientKWTISNTTNSSVADIYFESKYLTYLFKDPGKYMITLELTDTNGNKYKKGRNIVNIKQIKQNGN*
Ga0164320_1001557433300013098Marine SedimentTITNTTNSSAADIYFNSKYLTYLFKDPGKYVITLELIDSNGNKYKKDRNILNIKQIK*
Ga0164320_1003916813300013098Marine SedimentNSSVADIYFESKYLTYLFKIPGKYEITLELTDTNGNKYKKDRNILVIK*
Ga0181402_113921613300017743SeawaterPRWIIKNTTNSSVADIYFESKYLTYLFKIPGKYEITLELTDTNGNKYKKDRNILVIK
Ga0181411_103361413300017755SeawaterDTPRWIISNTTNSSVADIYFESKYLTYLFKDPGKYMITLELTDTNGNKYKKDRNILNIKEIERSQQI
Ga0181409_109187523300017758SeawaterSNTTNSSVADIYFESKYLTYLFKDPGKYMITLELTDTNGNKYKKGRNILNIKEIERSQQI
Ga0181423_101960413300017781SeawaterNTTNSSAADIYFNSKYLTYLFKDPGKYVITLELIDSNGNKYKKDRNILNIKQIK
Ga0181590_1063228813300017967Salt MarshWKIRNTTDSSFADIYFESKYLTYLFKKKGKYEITLELIDSNGNKYQKSRNIVVIK
Ga0181587_1026567233300017968Salt MarshTIKNTTARNTSDIYFESKYLTYLFQDPGKYEITLELTDSNGNKYKKGRNILIIK
Ga0180430_1056452123300018065Hypersaline Lake SedimentETKYLTYLFKDLGKYEIELELEDSNGNFYTKTRNILNIK
Ga0181592_1015432543300018421Salt MarshDIYFESKYLTYLFKKKGKYEITLELVDSNGNKYQKSRNIVVIK
Ga0181568_1077184413300018428Salt MarshNTSDIYFESKYLTYLFQDPGKYEITLELTDSNGNKYKKGRNILIIK
Ga0181573_1028080713300020184Salt MarshNTTARNRSDIYFESKYLTYLFQDPGKYEITLELTDSNGNKYKKGRNILIIK
Ga0211686_1005632833300020382MarineSSVADIYFESKYLTYLFKDPGKYMITLELTDTNGNKYKKGRNILNIKQTQKNGN
Ga0211550_1011500133300020453MarineADIYFESKYLTYLFKNPGKYAVTLELTDNNGNKYKKSRNILNIK
Ga0181598_129810813300020810Salt MarshTSNPKMADIYFESKYLTYLFKESGNYKITLELTDTNGNKYKKDRNILIIK
Ga0206681_1041421423300021443SeawaterKYLTYLFKVPGKYEITLELTDTNGNKYKKGRNILVIK
Ga0212022_105196813300022164AqueousNNSSVADIYFESKYLTYLFKDPGKYMITLELTDTNGNKYKKGRNILNIKQTK
Ga0255760_1015685333300023115Salt MarshRWTIKNTTARNTSDIYFESKYLTYLFQDPGKYEITLELTDSNGNKYKKGRNILIIK
Ga0255772_1017253733300023176Salt MarshKGKPRWTIKNTTARNTSDIYFESKYLTYLFQDPGKYEITLELTDSNGNKYKKGRNILIIK
Ga0222640_106050023300023297Saline WaterYLDSKYLTYLFKDLGKYEITLELEDSNGNKYIKSRNILVIE
Ga0228696_100312613300023568SeawaterKIPGKGNPRWIIKNTTNSKMADIYFESKYLTYLFKESGKYEITLELTDTNGNKYKKGRNILVIK
Ga0228603_102966913300024183SeawaterTNSKMADIYFESKYLTYLFKESGKYEITLELTDTNGNKYKKGRNILVIK
Ga0228656_112934923300024322SeawaterYDKCKIPGKAEPRWIIKNTTNSNMADIYFESKYLTYLFKVPGKYEITLELTDTNGNKYKKGRNILVIK
Ga0208669_101292533300025099MarineDIYSESKYLTYLFKNPGKYMITLELTDTNGNKYKKSRNILNIKEIRQS
Ga0208303_109845823300025543AqueousMFVYDKCKIPGKANPRWIIKNTTNSRVADIYFESKYLTYLFKHPGKYEIALELTDTNGNKYKKGRNILVIK
Ga0209716_102207113300025626Pelagic MarineIKNTTNSKMADIYFESKYLTYLFKESGKYEITLELTDTNGNKYKKGRNILVIK
Ga0209532_102267133300025696Pelagic MarineYDKCKIPGKANPRWIIKNTTNPKMADIYFESKYLTYLFKESGKYEITLELTDTNGNKYKKGRNILVIK
Ga0208150_102564713300025751AqueousKIPGKANPRWTIKNTTNSRVADIYFESKYLTYLFKHPGKYEIALELTDTNGNKYKKGRNILVIK
Ga0209193_111224023300025816Pelagic MarineDIYFESKYLTYLFKESGKYEITLELTDTNGNKYKKGRNILVIK
Ga0208645_103315813300025853AqueousDIYFESKYLTYLFKHPGKYEITLELTDTNGNKYKKGRNILVIK
Ga0209119_121842113300025860Pelagic MarinePKWTISNTTNSSVADIYFESKYLTYLFKNPGKYMITLELTDTNGNKYKKGRNILNIKQTK
Ga0209937_107330223300026094Pond WaterFESRYLTYLFKKEGKYEITLELEDSNGNKYKKERNILIIK
Ga0247598_104396213300026466SeawaterGNPRWIIKNTTNSKMADIYFESKYLTYLFKESGKYEITLELTDTNGNKYKKGRNILVIK
Ga0247571_105992623300026495SeawaterNPRWIIKNTTNSKMADIYFESKYLTYLFKESGKYEITLELTDTNGNKYKKGRNILVIK
Ga0247605_100028013300026503SeawaterLTYLFKVPGKYEITLELTDTNGNKYKKGRNILVIK
Ga0247590_107134113300026513SeawaterADISFESKYLTYLFKQPGKYEITLELTDTNGNKYKKGRNILVIK
Ga0208176_104480313300027248EstuarineMADIYFESKYLTYLFKNSGKYEITLELTDTNGNKYKKNRNILVIK
Ga0208971_114909013300027582MarineGKGQPRWIIKNTTNSSVADIYFESKYLTYLFKIPGKYEITLELTDTNGNKYKKDRNILNIKEIERSQQI
Ga0209830_1016064933300027791MarineVADIYFESKYLTYLFKDPGKYMITLELTDTNGNKYKKGRNILNIKEIKESQQI
Ga0209229_1039524723300027805Freshwater And SedimentIRNTSNPNTSDIYFESKYLTYLFQDPGRYEIGLELTDSNGNKYKKERNILIIK
Ga0209578_1034170513300027820Marine SedimentPRWIIKNTTNSKMADIYFESKYLTYLFKESGKYEITLELTDTNGNKYKKGRNILVIK
Ga0209712_1046234723300027849MarineNTTNSSVADIYFESKYLTYLFKDPGKYMITLELTDSNGNKYKKGRNILNIKQIKQNGN
Ga0209165_1028889213300027978Marine SedimentRIVGKDGPKWTISNTTNSSVADIYSESKYLTYLFKNPGKYMITLELTDTNGNKYKKSRNILNIKEIRQS
Ga0247596_103806113300028106SeawaterFVYDKCKIPGKANPRWIIKNTTNSNMADIYFESKYLTYLFKQPGKYEITLELTDTNGNKYKKGRNILVIK
Ga0247582_104442913300028109SeawaterFESKYLTYLFKQPGKYEITLELTDTNGNKYKKGRNILVIK
Ga0233397_100352843300028111SeawaterTTNSNMADIYFESKYLTYLFKQPGKYEITLELTDTNGNKYKKGRNILVIK
Ga0228642_102097933300028131SeawaterGKPRWIIKNTTNSSMADIYFESKYLTYLFKNSGKYEITLELTDTNGNKYKKNRNILVIK
Ga0256412_107563833300028137SeawaterGKANPRWIIKNTTNSNMADIYFESKYLTYLFKVPGKYEITLELTDTNGNKYKKGRNILVI
Ga0256413_107631133300028282SeawaterDKCNIPGKANPRWIIKNTTNSNMADIYFESKYLTYLFKQPGKYEITLELTDTNGNKYKKGRNILVIK
Ga0228614_106243013300028416SeawaterGKAEPRWIIKNTTNSNMADIYFESKYLTYLFKVAGKYEITLELTDTNGNKYKKGRNILVI
Ga0228614_107791013300028416SeawaterTTDSTFSDIYFESKYLTYLFKKKGKYEITLELTDSNGNKYQKSRNIIVIK
Ga0228615_105629133300028418SeawaterIPGKGNPRWIIKNTTNSKMADIYFESKYLTYLFKESGKYEITLELTDTNGNKYKKGRNILVIK
Ga0183757_102294913300029787MarineYFESKYLTYLFKDPGKYVITLELTDNNGNKYKKDRNILNIKEVAIS
Ga0308025_100477243300031143MarineSKYLTYLFKDPGKYMITLELTDTNGNKYKKSRNILNIKQTKQNGN
Ga0308020_103756113300031175MarineSNTTNSSVADIYFESKYLTYLFKDPGKYMITLELTDTNGNKYKKDRNILNIKQTKQNGN
Ga0308014_104228113300031628MarineTEPRWTISNTTNSSVADIYFESKYLTYLFKDPGKYMITLELTDTNGNKYKKGRNILNIKQIN
Ga0308005_1004527013300031656MarineESKYLTYLFKDPGKYMITLELTDTNGNKYKKGRNILNIKQIN
Ga0302136_118007813300031676MarineDIYFESKYLTYLFKDPGKYMISLELTDTNGNKYKKDRNILNIKQTKQNGN
Ga0315320_1046077323300031851SeawaterNTTNSNMADIYFESKYLTYLFKVPGKYEITLELTDTNGNKYKKGRNILVIK
Ga0315327_1009654233300032032SeawaterQPRWTISNTTDSSVADIYFNSKYLTYLFKNPGRYVITLELTDNNGNKYKKDRNILNIK
Ga0315315_1129581123300032073SeawaterNGSNIYFESKYLTYLFKDKGKYAITLELEDTNGNKYTKEKNILIIK


 ⦗Top⦘


© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.