Basic Information | |
---|---|
Family ID | F101239 |
Family Type | Metagenome |
Number of Sequences | 102 |
Average Sequence Length | 50 residues |
Representative Sequence | LTRELGSELTANCQTKHNGTDSLHDRIDGYTNKYHMSNRCETLIEKAM |
Number of Associated Samples | 57 |
Number of Associated Scaffolds | 102 |
Quality Assessment | |
---|---|
Transcriptomic Evidence | No |
Most common taxonomic group | Unclassified |
% of genes with valid RBS motifs | 0.99 % |
% of genes near scaffold ends (potentially truncated) | 82.35 % |
% of genes from short scaffolds (< 2000 bps) | 99.02 % |
Associated GOLD sequencing projects | 55 |
AlphaFold2 3D model prediction | Yes |
3D model pTM-score | 0.28 |
Hidden Markov Model |
---|
Powered by Skylign |
Most Common Taxonomy | |
---|---|
Group | Unclassified (99.020 % of family members) |
NCBI Taxonomy ID | N/A |
Taxonomy | N/A |
Most Common Ecosystem | |
---|---|
GOLD Ecosystem | Host-Associated → Plants → Phyllosphere → Unclassified → Unclassified → Miscanthus Phyllosphere (78.431 % of family members) |
Environment Ontology (ENVO) | Unclassified (78.431 % of family members) |
Earth Microbiome Project Ontology (EMPO) | Host-associated → Plant → Plant surface (78.431 % of family members) |
⦗Top⦘ |
⦗Top⦘ |
Predicted Topology & Secondary Structure | |||||
---|---|---|---|---|---|
Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 44.74% β-sheet: 0.00% Coil/Unstructured: 55.26% | Feature Viewer |
|
|||||
Powered by Feature Viewer |
Structure Viewer | |
---|---|
| |
Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.28 |
Powered by PDBe Molstar |
⦗Top⦘ |
Name | Rank | Taxonomy | Distribution |
Unclassified | root | N/A | 99.02 % |
All Organisms | root | All Organisms | 0.98 % |
Visualization |
---|
Powered by ApexCharts |
⦗Top⦘ |
Habitat | Taxonomy | Distribution |
Miscanthus Phyllosphere | Host-Associated → Plants → Phyllosphere → Unclassified → Unclassified → Miscanthus Phyllosphere | 78.43% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 12.75% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 4.90% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere | 1.96% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 0.98% |
Miscanthus Rhizosphere | Host-Associated → Plants → Roots → Rhizosphere → Soil → Miscanthus Rhizosphere | 0.98% |
Visualization |
---|
Powered by ApexCharts |
Taxon OID | Sample Name | Habitat Type | IMG/M Link |
---|---|---|---|
3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Host-Associated | Open in IMG/M |
3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Host-Associated | Open in IMG/M |
3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Host-Associated | Open in IMG/M |
3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Host-Associated | Open in IMG/M |
3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Host-Associated | Open in IMG/M |
3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Host-Associated | Open in IMG/M |
3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Host-Associated | Open in IMG/M |
3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Host-Associated | Open in IMG/M |
3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Host-Associated | Open in IMG/M |
3300015267 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_MAIN_31MAY2016_LD1 MG | Host-Associated | Open in IMG/M |
3300015268 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_MAIN_12JUL2016_LD1 MG | Host-Associated | Open in IMG/M |
3300015269 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_NF_09MAY2016_LD1 MG | Host-Associated | Open in IMG/M |
3300015274 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_MAIN_22AUG2016_LD1 MG | Host-Associated | Open in IMG/M |
3300015275 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_MAIN_01AUG2016_LD1 MG | Host-Associated | Open in IMG/M |
3300015276 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_MAIN_01AUG2016_LD1 MG | Host-Associated | Open in IMG/M |
3300015277 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_NF_31MAY2016_LD1 MG | Host-Associated | Open in IMG/M |
3300015279 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_NF_01AUG2016_LD1 MG | Host-Associated | Open in IMG/M |
3300015283 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_MAIN_12JUL2016_LD1 MG | Host-Associated | Open in IMG/M |
3300015286 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_NF_01AUG2016_LD1 MG | Host-Associated | Open in IMG/M |
3300015288 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_MAIN_01AUG2016_LD1 MG | Host-Associated | Open in IMG/M |
3300015291 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_MAIN_31MAY2016_LD1 MG | Host-Associated | Open in IMG/M |
3300015292 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_MAIN_20JUN2016_LD1 MG | Host-Associated | Open in IMG/M |
3300015295 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_NF_01AUG2016_LD1 MG | Host-Associated | Open in IMG/M |
3300015296 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_MAIN_12JUL2016_LD1 MG | Host-Associated | Open in IMG/M |
3300015298 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_MAIN_09MAY2016_LD1 MG | Host-Associated | Open in IMG/M |
3300015299 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_MAIN_09MAY2016_LD1 MG | Host-Associated | Open in IMG/M |
3300015302 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_NF_20JUN2016_LD1 MG | Host-Associated | Open in IMG/M |
3300015304 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_NF_09MAY2016_LD1 MG | Host-Associated | Open in IMG/M |
3300015307 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_NF_20JUN2016_LD1 MG | Host-Associated | Open in IMG/M |
3300015308 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_NF_20JUN2016_LD1 MG | Host-Associated | Open in IMG/M |
3300015321 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_NF_31MAY2016_LD1 MG | Host-Associated | Open in IMG/M |
3300015341 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_MAIN_22AUG2016_LD1 MG | Host-Associated | Open in IMG/M |
3300015343 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_MAIN_12JUL2016_LD1 MG | Host-Associated | Open in IMG/M |
3300015344 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_MAIN_22AUG2016_LD1 MG | Host-Associated | Open in IMG/M |
3300015345 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_NF_09MAY2016_LD1 MG | Host-Associated | Open in IMG/M |
3300015347 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_NF_01AUG2016_LD1 MG | Host-Associated | Open in IMG/M |
3300015351 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_NF_12JUL2016_LD1 MG | Host-Associated | Open in IMG/M |
3300017404 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_MAIN_12SEP2016_LD1 MG | Host-Associated | Open in IMG/M |
3300017407 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_MAIN_03OCT2016_LD1 MG | Host-Associated | Open in IMG/M |
3300017410 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_NF_12SEP2016_LD1 MG | Host-Associated | Open in IMG/M |
3300017411 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_NF_12SEP2016_LD1 MG | Host-Associated | Open in IMG/M |
3300017417 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_NF_07NOV2016_LD1 MG | Host-Associated | Open in IMG/M |
3300017425 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_NF_03OCT2016_LD1 MG | Host-Associated | Open in IMG/M |
3300017427 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_NF_22AUG2016_LD1 MG | Host-Associated | Open in IMG/M |
3300017430 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_NF_22AUG2016_LD1 MG | Host-Associated | Open in IMG/M |
3300017433 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_NF_12SEP2016_LD1 MG | Host-Associated | Open in IMG/M |
3300017436 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_NF_12SEP2016_LD1 MG | Host-Associated | Open in IMG/M |
3300017438 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_NF_22AUG2016_LD1 MG | Host-Associated | Open in IMG/M |
3300017442 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_MAIN_03OCT2016_LD1 MG | Host-Associated | Open in IMG/M |
3300017443 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_NF_22AUG2016_LD1 MG | Host-Associated | Open in IMG/M |
3300017682 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_MAIN_07NOV2016_LD1 MG | Host-Associated | Open in IMG/M |
3300017684 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_NF_03OCT2016_LD1 MG | Host-Associated | Open in IMG/M |
3300017685 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_MAIN_07NOV2016_LD1 MG | Host-Associated | Open in IMG/M |
3300017686 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_MAIN_12SEP2016_LD1 MG | Host-Associated | Open in IMG/M |
3300017690 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_NF_03OCT2016_LD1 MG | Host-Associated | Open in IMG/M |
3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) | Host-Associated | Open in IMG/M |
Geographical Distribution | |
---|---|
Zoom: | Powered by OpenStreetMap |
⦗Top⦘ |
Protein ID | Sample Taxon ID | Habitat | Sequence |
Ga0068869_1005952242 | 3300005334 | Miscanthus Rhizosphere | LASILTRELGSELTANCHKNHNGTDSLHDRIDGYTNKYHIANRCETLTEKAM* |
Ga0068869_1016207841 | 3300005334 | Miscanthus Rhizosphere | LASILTRELGSELTANCQTKHNGTDSLHDRIDGYTNKYHMSNRCEILIEKAM* |
Ga0068869_1016554232 | 3300005334 | Miscanthus Rhizosphere | LASIPTRELGSELTANCQTEHNGTDSLHDRIDGYTNKYHMSNRCEILTEKAM* |
Ga0068867_1004670613 | 3300005459 | Miscanthus Rhizosphere | LASILTRELGSELTANCQTKHNGTDSLHDRIDGYTNNYHMSNRSETLIEKAM* |
Ga0068867_1023638271 | 3300005459 | Miscanthus Rhizosphere | LASFLTRELGSEMTANFQTKHNGTDSLHDRIDRYTNKYHIANRCETLAKKAM* |
Ga0070672_1001408191 | 3300005543 | Miscanthus Rhizosphere | LASILTRELGSEMTANFQTKHNGTDSLHDRIDRYTNKYHIANRCETLAEKAM* |
Ga0070672_1020963791 | 3300005543 | Miscanthus Rhizosphere | LASILTRELGSELTANCHKNHNGTDSLHDRVDGYTNKYHIANRCETLTEKAM* |
Ga0068866_103678251 | 3300005718 | Miscanthus Rhizosphere | LASILTRELGSELTANCQWNHNGTDSLHDRIDRYTNKYHMSNRYETLAEKAM* |
Ga0068866_104298951 | 3300005718 | Miscanthus Rhizosphere | LASILTRELGSELTVNCQTKHNGTDSLHDRIDRYTNKYHISNRCEILIEKAM* |
Ga0068861_1013017272 | 3300005719 | Switchgrass Rhizosphere | LASILTRELGSELTANCQTKHNGTDSLHDRIDGYTNKYHISNRCEILIEKAM* |
Ga0068870_102785842 | 3300005840 | Miscanthus Rhizosphere | LASILTRELGSELTVNCQTKHNGTDSLHDRIDGYTNKYHISNRCEILIEKAM* |
Ga0068870_106703912 | 3300005840 | Miscanthus Rhizosphere | LASILTHELGSELTANCHKNHNGTDSLHDRIDGYTNKYHIANRCETLIEKAM* |
Ga0068870_108172922 | 3300005840 | Miscanthus Rhizosphere | TAADEDQLSNCRFRGLASILTRELGSEMTANFQTKHNGTDSLHDRIDRYTNKYHIANRCETLAEKAM* |
Ga0068870_112280942 | 3300005840 | Miscanthus Rhizosphere | LASILTRELGSELTANCHKNHNRTDSLHDRIDGYTNKYNMSNRCETLIEKAM* |
Ga0068871_1015259722 | 3300006358 | Miscanthus Rhizosphere | LASILTRELGSELTANCQKNHNGTDSLHDRVDGYTNKYHMSNRCETLIEKAM* |
Ga0157374_117555301 | 3300013296 | Miscanthus Rhizosphere | TAADEDQLSNCRFQGLASILTRELGSELTANCQTKHNETDPLHDRIDGYTNKYHMSNRCEILIEKAM* |
Ga0157378_107778601 | 3300013297 | Miscanthus Rhizosphere | TRELGSELTANCQTKHNGTDSLHDRIDGYTNNYHMSNRSETLIEKAM* |
Ga0157378_112164561 | 3300013297 | Miscanthus Rhizosphere | TRELGSELTVNCQTKHNGTDSLHDRIDGYTNKYHISNRCETLIEKAM* |
Ga0157378_115916603 | 3300013297 | Miscanthus Rhizosphere | ELGSELTANCHKNHNGTDSLHDRIDGYTNKYNMSNRCETLIEKAM* |
Ga0157378_121673791 | 3300013297 | Miscanthus Rhizosphere | FRGLASILTRELGSELTANCQTKHNGTDPLHDRIDGYTNKYHMSNRCEILIEKAM* |
Ga0182122_10515741 | 3300015267 | Miscanthus Phyllosphere | ELGSELTANCHKNHNGTDSLHDRIDGYTDKYNMSNRCETLIEKAM* |
Ga0182154_10028161 | 3300015268 | Miscanthus Phyllosphere | ELGSELTANCQKNHNGTDSLHDRIDGYTNKYHMSNRCENLIEKAM* |
Ga0182154_10253381 | 3300015268 | Miscanthus Phyllosphere | LASILTRELGSELTANYQKNHNGTDSLHDRIDGYTNKYHMSNRCETLIEKAM* |
Ga0182113_10067414 | 3300015269 | Miscanthus Phyllosphere | RGLASILTRELGSELTANCHKNHNGTDSLHDRIDGYTNKYHIANRCGTLIEKAM* |
Ga0182188_10102001 | 3300015274 | Miscanthus Phyllosphere | ASILTRELGSEMTANCHKNHNGTDSLHDRVDGYTDKYHIANRCETLIEKAM* |
Ga0182188_10213092 | 3300015274 | Miscanthus Phyllosphere | LASILTRELGSELTANYHKNHNGTDSLHDRIDGYTNKYHIANRCETLTEKAM* |
Ga0182172_10033523 | 3300015275 | Miscanthus Phyllosphere | EDQLSNCRFRGLASILTRELGSELTANCQKNHNGTDSLHDRVDGYTDKYHMSNRCEALIEKAM* |
Ga0182172_10705952 | 3300015275 | Miscanthus Phyllosphere | EDQLSNCRFRGLASILTRELGSELTANCQKNHNGTDSLHDRIDGYTNKYHMSNRCETLIEKAM* |
Ga0182170_10723791 | 3300015276 | Miscanthus Phyllosphere | ELGSKLAANCHKNLNGTDSLHDRIDGYTNKYNISNRCETLKEKAIW* |
Ga0182128_10126571 | 3300015277 | Miscanthus Phyllosphere | GLASILTRELGSELTVNCQTKHNGTDSLHDRIDGYTNKYHISNRCEILIEKAM* |
Ga0182128_10689241 | 3300015277 | Miscanthus Phyllosphere | HSRGLASILTRELGSELTANYHKNHNSTDSLHDRIDGYTNKYNISNRCETLIEKAM* |
Ga0182128_10791051 | 3300015277 | Miscanthus Phyllosphere | VADEDQLSNCRFRGLASILTRELGSELTANCQWNHNGTDSLHDRIDRYTNKYHMSNRYETLAEKAM* |
Ga0182174_10143212 | 3300015279 | Miscanthus Phyllosphere | CQTEHNRTDSLHDRIDGYTNKYHMSNRCEILIEKAM* |
Ga0182156_10187281 | 3300015283 | Miscanthus Phyllosphere | LTRELGSEMTANFQTKHNGTDSLHDRIDRYTNKYHIANRCEALAEKAM* |
Ga0182176_10092221 | 3300015286 | Miscanthus Phyllosphere | LTRELGSELTVNCQTKHNGTDSLHDRIYGYTNKYHMSNRCEILIEKAM* |
Ga0182176_10585361 | 3300015286 | Miscanthus Phyllosphere | ELGSELTANYQTKHNGTDSLHDRIDGYTNKYHMSNRCETLIEKAM* |
Ga0182173_10064411 | 3300015288 | Miscanthus Phyllosphere | LTRELGSELTANCQTKHNGTDSLHDRIDGYTNKYHMSNRCEILIEKAM* |
Ga0182173_10165201 | 3300015288 | Miscanthus Phyllosphere | LSNCRFRGLASFLTRELGSEMTANFQTKHNGTDSLHDRIDRYTNKYHIANRCETLAEKAM |
Ga0182173_10530222 | 3300015288 | Miscanthus Phyllosphere | HELGSELTANCHKNYNGTDSLHDRIDEYTNKYHMSNRCETLIEKAM* |
Ga0182125_10199481 | 3300015291 | Miscanthus Phyllosphere | ELGSEMTANFQTKHNGTDSLHDRIDRYTNKYHIANRCETLVEKAM* |
Ga0182125_10947491 | 3300015291 | Miscanthus Phyllosphere | ILTRELGSELTANCQKNLNGTDSLHNRVDGYTNKYHMSNRCEILIEKAM* |
Ga0182141_10253231 | 3300015292 | Miscanthus Phyllosphere | LGSELTANCHKNHNGTDSLHDRVDGYTNKYNMSNRCKTLIEKAM* |
Ga0182175_10179471 | 3300015295 | Miscanthus Phyllosphere | ELGSELTANCHKNHNRTDSLYDRIDGYTNKHHIANSCETLIEKAM* |
Ga0182157_10082531 | 3300015296 | Miscanthus Phyllosphere | LGSELTINCQTKHNGTDSLHDRIDRYTNKYHISNRCEILIEKAM* |
Ga0182106_10203171 | 3300015298 | Miscanthus Phyllosphere | LASILTHKLGSELTANCHKNHNGTDSLHDRIDGYTNKYNISNRCETLIEKAI* |
Ga0182107_10223731 | 3300015299 | Miscanthus Phyllosphere | LASILTRELGSEMTANCHKNHNGTDSLHDRIDGYTNKYHIANRCETLIEKAM* |
Ga0182107_10734832 | 3300015299 | Miscanthus Phyllosphere | ELGSELTANYHKNHNGTDSLHDRIDGYTNKYNMSNRCETLIEKAM* |
Ga0182143_10538222 | 3300015302 | Miscanthus Phyllosphere | ELGFELTANCQKNHNGTDLLHDRVDGYTNKYHMSNRCETLIEKAM* |
Ga0182112_10179561 | 3300015304 | Miscanthus Phyllosphere | LTRELGSELTANCQTKHNGTDSLHDRIDGYTNNYHMSNRSETLIEKAM* |
Ga0182112_10242011 | 3300015304 | Miscanthus Phyllosphere | SNCRFRGLASILTRELGSELTANCQTKHNGTDSLHDRIDRYTNKYHIANRCETLIEKAM* |
Ga0182112_10303411 | 3300015304 | Miscanthus Phyllosphere | ASILTRELGFEMTANCHKNHNGTDSLHDRIDGYTNKYHIANRCKTLIEKAM* |
Ga0182112_10742341 | 3300015304 | Miscanthus Phyllosphere | SELTANSQKNHNGTDSLHDKIDGYTNKYHMYNRCETLIEKAM* |
Ga0182144_10278811 | 3300015307 | Miscanthus Phyllosphere | GLASILTRELGSELTANCQKNHNGTDSLHDRIDGYTNKYHMSNRCETLIEKAM* |
Ga0182144_10307371 | 3300015307 | Miscanthus Phyllosphere | KNHNGTDSMHDKIDGYTDKYSMSNRCETLIEKAM* |
Ga0182142_10394491 | 3300015308 | Miscanthus Phyllosphere | SELTANCQTKHNGTDSLHDRIDGYTNKYHMSNRCEILIEKAM* |
Ga0182127_10107041 | 3300015321 | Miscanthus Phyllosphere | DQDQLSNCRFRGLASILTRELGSELTANCQTKHNETDPLHDRIDGYTNKYHMSNRCETLIEKAM* |
Ga0182127_10484191 | 3300015321 | Miscanthus Phyllosphere | VVDEDQLSNCRFRGLASIPTRELGSELTANCQTEHNGTDSLHDRIDGYTNKYHMSNRCEILTEKAM* |
Ga0182187_11733242 | 3300015341 | Miscanthus Phyllosphere | LTANYQKNHNGTDSLYDRIDGYTNKYHMSNRCENLIEKAM* |
Ga0182155_10849622 | 3300015343 | Miscanthus Phyllosphere | RELGSELTANCHKNHNGTDSLHDRIDGYIDKYNMSNRCETLIEKAMKMRT* |
Ga0182155_11048361 | 3300015343 | Miscanthus Phyllosphere | TANCHKNHNGTDSLHDRIDGYTNKYHIANRCETLIEKAM* |
Ga0182155_11091351 | 3300015343 | Miscanthus Phyllosphere | TANCQTKHNGTDSLHDRIDGYTNKYHMSNRYEILIEKAM* |
Ga0182155_11991111 | 3300015343 | Miscanthus Phyllosphere | SSELAANCQKNHNGTNSLHDRIDGYTNKYHMSNRCETLIEKAM* |
Ga0182189_10582551 | 3300015344 | Miscanthus Phyllosphere | TANFQTKHNGTDSLHDRIDRYTNKYHIANRCETLAKKAM* |
Ga0182111_10708301 | 3300015345 | Miscanthus Phyllosphere | SEMTANFQTKHNGTDSLHDRIDRYTNKYHIANRCETLGKKAM* |
Ga0182177_10492011 | 3300015347 | Miscanthus Phyllosphere | TAADEDQLSNCRFRGLASILTRELGSEMTANFQTKHNGTDLLHDRIDRYTNKYHIANRCETLAEKAM* |
Ga0182177_10538102 | 3300015347 | Miscanthus Phyllosphere | RGLASVRTRELGSELTANCHKNHNGTNSLHGRIDGYINKYNMSNRCETLIEKAM* |
Ga0182177_10772071 | 3300015347 | Miscanthus Phyllosphere | GSELTANCQKNHNGTDSLHDRIDGYTNKYHMSNRCENLIEKAM* |
Ga0182161_11311701 | 3300015351 | Miscanthus Phyllosphere | NCQTKHNGTDSLHDRIDGYTNKYHMSNRCEILIEKAM* |
Ga0182161_11714931 | 3300015351 | Miscanthus Phyllosphere | RELGSELTANCQKNHNGTDSLHDRVDGYTNKYYMSNRCETLIEKAM* |
Ga0182203_10937982 | 3300017404 | Miscanthus Phyllosphere | TANCQKDHNGTDSLHDRVDGYTNKYHMSNRWETLIEKAM |
Ga0182203_11440671 | 3300017404 | Miscanthus Phyllosphere | LTRELGSELTANCQTKHNGTDSLHDRIDGYTNKYHISNRCEILIEKAI |
Ga0182220_10340021 | 3300017407 | Miscanthus Phyllosphere | GLASILTRELGSEMTANCHKNHNGTDSLHDRVDGYTNKYHIANRCETLIEKAM |
Ga0182220_10705521 | 3300017407 | Miscanthus Phyllosphere | RELGSELTANCHKNHNGTDSLHDRIDGYTNKYHMSNRCENLIEKAM |
Ga0182220_11062032 | 3300017407 | Miscanthus Phyllosphere | ASILTRELGSEMTANCHKNHNGTDSLHDRIDGYTNKYHIANRCGTLIEKAM |
Ga0182207_10190431 | 3300017410 | Miscanthus Phyllosphere | ASILTRELGSELTANYHKNHNGTDLMHDRIDGYTNKYHMSNRCETLIEKAM |
Ga0182208_10068372 | 3300017411 | Miscanthus Phyllosphere | GLASILTRELGSELTVNCQTKHNGTDSLHDRIDGYTNKYHMSNRCETLIEKAM |
Ga0182208_10337461 | 3300017411 | Miscanthus Phyllosphere | TAADEDQLSNCRFRGLASILTRELGSEKTANFQTKHNGTDLLHDRIDRYTNKYHIANRCETLAEKAM |
Ga0182230_10812241 | 3300017417 | Miscanthus Phyllosphere | TRELGSELTVNCQTKHNGTDSLHDRIDRYTNKYHISNRCEILIEKAM |
Ga0182224_10846051 | 3300017425 | Miscanthus Phyllosphere | LTRELGSEMTANFQTKHNGTDSLHDRIDRYTNKYHIANRCETLAEKAM |
Ga0182224_10932722 | 3300017425 | Miscanthus Phyllosphere | DEDQLSNCRFRGLASILTRELGSELTANSHKNHNGTDSLHDRIDRYTNKYHIANRYETLAEKAM |
Ga0182190_11425781 | 3300017427 | Miscanthus Phyllosphere | GSELTANCHKNHNGTDSLHDRIDGYTNKYHIANRYETLTEKAM |
Ga0182192_11103813 | 3300017430 | Miscanthus Phyllosphere | RELGSELTANCQKNHNGTDSLHDRIDGYTNKYNMSNRCKTLIEKAM |
Ga0182206_10835022 | 3300017433 | Miscanthus Phyllosphere | TRELGSELTVNCQTKHNGTDSLHDRIDGYTNKYHMSNGCETLIEKAM |
Ga0182206_10841112 | 3300017433 | Miscanthus Phyllosphere | DEDQLSNCRFRGLASILTRELGSELTANYQKNHNGTDSLHNRIDGYTNKYNMSNRYETLIEKAM |
Ga0182206_11337201 | 3300017433 | Miscanthus Phyllosphere | ELGSELTANCHKNHNGTDSLHDRVDGYTNKYNMSNRCETLIEKAM |
Ga0182209_10394401 | 3300017436 | Miscanthus Phyllosphere | TVNCQTKHNGTDSLHDRIDGYTNNYHMSNRSETLIEKAM |
Ga0182209_10987791 | 3300017436 | Miscanthus Phyllosphere | ILTHELGSELTANCHKNHNGTDSLHDRVDGYTNKYNMSNRCETLIEKAM |
Ga0182191_10990021 | 3300017438 | Miscanthus Phyllosphere | RELGSKMTANCHKNHNGTDSLHDIIDGYTNKYHIANRCETLIEKAM |
Ga0182221_10183241 | 3300017442 | Miscanthus Phyllosphere | ELGSELTANCQTKHNGTDSLHDRIDGYTNNYHMSNRSETLIEKAM |
Ga0182221_10842152 | 3300017442 | Miscanthus Phyllosphere | LILTRELGSELTANCHKNHNDTDSLHDGIDGYTNKYNISNRCETLKEKAIW |
Ga0182221_10957001 | 3300017442 | Miscanthus Phyllosphere | ELGSEMTANCHKNHNGTDSLHDRIDGYTNKYHIANRCGTLIEKAM |
Ga0182193_10420601 | 3300017443 | Miscanthus Phyllosphere | LTRELGSELTANCQTKHNGTDSLHDRIDGYTNNYHMSNRSETLIEKAM |
Ga0182193_10905081 | 3300017443 | Miscanthus Phyllosphere | ELTVNCQTKHNGTDSLHDRIDGYTNKYHMSNGCETLIEKAM |
Ga0182229_10423851 | 3300017682 | Miscanthus Phyllosphere | ELGSELTANCHKNHNGTDSLHDRIDGYTNKYHIANRCETLIEKAM |
Ga0182229_10685242 | 3300017682 | Miscanthus Phyllosphere | GLASILTRELGSELTANCQKNHNGADSLHDRIDGYTNKYHMSNRCETLIEKAM |
Ga0182225_10216352 | 3300017684 | Miscanthus Phyllosphere | ILTRELGSELTVNCQTKHNGTDSLHDRIDGYTNKYHMSNRCEILTEKAM |
Ga0182227_10599222 | 3300017685 | Miscanthus Phyllosphere | ELGSEITANCHKNHNGTDSLHDRVDGYTDKYHIANRCETLIEKAM |
Ga0182205_10298151 | 3300017686 | Miscanthus Phyllosphere | GLASILTRELGSELTANCHKNHNGTDSLHDRIDGYTNKYHMSNRCETLIEKAM |
Ga0182205_10303561 | 3300017686 | Miscanthus Phyllosphere | LTRELGSELTANCQKNHNGTDSLHDRIDEYTNKYHIANRCETLGKKAM |
Ga0182223_10547121 | 3300017690 | Miscanthus Phyllosphere | LGSELTANCHKNHNGTDSLHDRIDGYTNKYNISNRCETLIEKAM |
Ga0207642_109675211 | 3300025899 | Miscanthus Rhizosphere | ADEDQLSNCRFRGLASILTRELGSELTANCQTKHNGTDSLHDRIDGYTNNYHMSNRSETLIEKAM |
Ga0207648_105255653 | 3300026089 | Miscanthus Rhizosphere | LTRELGSELTANCQTKHNGTDSLHDRIDGYTNKYHMSNRCETLIEKAM |
⦗Top⦘ |