NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F101237

Metagenome / Metatranscriptome Family F101237

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F101237
Family Type Metagenome / Metatranscriptome
Number of Sequences 102
Average Sequence Length 154 residues
Representative Sequence MRSNFGSKEEGKRKRRIKIVLVSVLVFVLAIIGFGFLYWNTHKNKIIKTELEKAIVKNNKGFYKISYDDMKIDETAGYLSARNMKVRFDSARYQSSELENKVPSMVFSIDIPEINVIGVRTTRALLDKEIVGRKLEIKNPIIDLQYTYKG
Number of Associated Samples 81
Number of Associated Scaffolds 102

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 0.00 %
% of genes near scaffold ends (potentially truncated) 100.00 %
% of genes from short scaffolds (< 2000 bps) 96.08 %
Associated GOLD sequencing projects 75
AlphaFold2 3D model prediction Yes
3D model pTM-score0.33

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (97.059 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil
(34.314 % of family members)
Environment Ontology (ENVO) Unclassified
(36.275 % of family members)
Earth Microbiome Project Ontology (EMPO) Host-associated → Plant → Plant rhizosphere
(41.176 % of family members)



 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      


 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Transmembrane (alpha-helical) Signal Peptide: No Secondary Structure distribution: α-helix: 32.02%    β-sheet: 25.84%    Coil/Unstructured: 42.13%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  
pTM-score: 0.33
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.


 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 102 Family Scaffolds
PF02674Colicin_V 3.92
PF11683DUF3278 0.98

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 102 Family Scaffolds
COG1286Colicin V production accessory protein CvpA, regulator of purF expression and biofilm formationCell wall/membrane/envelope biogenesis [M] 3.92


 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms97.06 %
UnclassifiedrootN/A2.94 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
3300000956|JGI10216J12902_103565842All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium741Open in IMG/M
3300004480|Ga0062592_101337262All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae → Terrimonas → Terrimonas ferruginea678Open in IMG/M
3300005293|Ga0065715_10743400All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium633Open in IMG/M
3300005294|Ga0065705_10681581All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae → Terrimonas → Terrimonas ferruginea591Open in IMG/M
3300005295|Ga0065707_10945998All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae → Terrimonas → Terrimonas ferruginea554Open in IMG/M
3300005330|Ga0070690_101338711All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae → Terrimonas → Terrimonas ferruginea575Open in IMG/M
3300005333|Ga0070677_10309214All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium806Open in IMG/M
3300005354|Ga0070675_100182819All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium1813Open in IMG/M
3300005354|Ga0070675_100848983All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium836Open in IMG/M
3300005367|Ga0070667_101832109All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae → Terrimonas → Terrimonas ferruginea571Open in IMG/M
3300005459|Ga0068867_102095368All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae → Terrimonas → Terrimonas ferruginea536Open in IMG/M
3300005578|Ga0068854_101516648All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae → Terrimonas → Terrimonas ferruginea609Open in IMG/M
3300005618|Ga0068864_102116130All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae → Terrimonas → Terrimonas ferruginea569Open in IMG/M
3300005719|Ga0068861_101433158All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium676Open in IMG/M
3300005844|Ga0068862_102023309All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae → Terrimonas → Terrimonas ferruginea587Open in IMG/M
3300006358|Ga0068871_101920821All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae → Terrimonas → Terrimonas ferruginea563Open in IMG/M
3300009094|Ga0111539_11722496All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium727Open in IMG/M
3300009553|Ga0105249_10841264All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium983Open in IMG/M
3300010403|Ga0134123_12966503All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae → Terrimonas → Terrimonas ferruginea543Open in IMG/M
3300011332|Ga0126317_10893170All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium1073Open in IMG/M
3300012883|Ga0157281_1025519All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium781Open in IMG/M
3300012884|Ga0157300_1003476All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium1636Open in IMG/M
3300012885|Ga0157287_1007155All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium1192Open in IMG/M
3300012885|Ga0157287_1035645All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae → Terrimonas → Terrimonas ferruginea727Open in IMG/M
3300012891|Ga0157305_10096834All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium721Open in IMG/M
3300012893|Ga0157284_10186915All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae → Terrimonas → Terrimonas ferruginea615Open in IMG/M
3300012895|Ga0157309_10176102All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae → Terrimonas → Terrimonas ferruginea654Open in IMG/M
3300012896|Ga0157303_10056110All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium826Open in IMG/M
3300012896|Ga0157303_10190326All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae → Terrimonas → Terrimonas ferruginea584Open in IMG/M
3300012901|Ga0157288_10198303All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae → Terrimonas → Terrimonas ferruginea638Open in IMG/M
3300012904|Ga0157282_10027899All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium1231Open in IMG/M
3300012905|Ga0157296_10156254All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium688Open in IMG/M
3300012907|Ga0157283_10172346All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium658Open in IMG/M
3300012908|Ga0157286_10310345All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae → Terrimonas → Terrimonas ferruginea581Open in IMG/M
3300012914|Ga0157297_10059370All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium1031Open in IMG/M
3300013297|Ga0157378_13137142All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae → Terrimonas → Terrimonas ferruginea513Open in IMG/M
3300013308|Ga0157375_11068558All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium944Open in IMG/M
3300013308|Ga0157375_11482274All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes800Open in IMG/M
3300014325|Ga0163163_12270819All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae → Terrimonas → Terrimonas ferruginea601Open in IMG/M
3300014326|Ga0157380_10007796All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes7619Open in IMG/M
3300014326|Ga0157380_10200701All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium1769Open in IMG/M
3300014326|Ga0157380_12279902All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae → Terrimonas → Terrimonas ferruginea606Open in IMG/M
3300014326|Ga0157380_12661853All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae → Terrimonas → Terrimonas ferruginea567Open in IMG/M
3300015200|Ga0173480_10223412All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium1011Open in IMG/M
3300015371|Ga0132258_10273895All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae4138Open in IMG/M
3300015372|Ga0132256_102013800All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae → Terrimonas → Terrimonas ferruginea684Open in IMG/M
3300015372|Ga0132256_103728914All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae → Terrimonas → Terrimonas ferruginea512Open in IMG/M
3300015373|Ga0132257_101656351All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium819Open in IMG/M
3300018031|Ga0184634_10104100All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium1242Open in IMG/M
3300018051|Ga0184620_10090143All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium931Open in IMG/M
3300018072|Ga0184635_10389072All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae → Terrimonas → Terrimonas ferruginea529Open in IMG/M
3300018073|Ga0184624_10333241All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae → Terrimonas → Terrimonas ferruginea679Open in IMG/M
3300018074|Ga0184640_10524727All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae → Terrimonas → Terrimonas ferruginea519Open in IMG/M
3300018081|Ga0184625_10288604All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium858Open in IMG/M
3300018083|Ga0184628_10372022All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium748Open in IMG/M
3300018083|Ga0184628_10415756All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium702Open in IMG/M
3300018469|Ga0190270_11351483All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae → Terrimonas → Terrimonas ferruginea757Open in IMG/M
3300018469|Ga0190270_12290651All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae → Terrimonas → Terrimonas ferruginea601Open in IMG/M
3300018476|Ga0190274_10311658All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium1472Open in IMG/M
3300018476|Ga0190274_11997366All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium676Open in IMG/M
3300018476|Ga0190274_12950568Not Available571Open in IMG/M
3300018481|Ga0190271_10970360All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium974Open in IMG/M
3300019356|Ga0173481_10005151All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae3477Open in IMG/M
3300019356|Ga0173481_10288441All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium757Open in IMG/M
3300019356|Ga0173481_10726245All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae → Terrimonas → Terrimonas ferruginea540Open in IMG/M
3300019362|Ga0173479_10077916All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium1170Open in IMG/M
3300019362|Ga0173479_10401061All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium662Open in IMG/M
3300019362|Ga0173479_10609745All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae → Terrimonas → Terrimonas ferruginea573Open in IMG/M
3300019362|Ga0173479_10842363All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae → Terrimonas → Terrimonas ferruginea512Open in IMG/M
3300019996|Ga0193693_1013719All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium1588Open in IMG/M
3300019996|Ga0193693_1016146All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium1433Open in IMG/M
3300019998|Ga0193710_1007029All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium1131Open in IMG/M
3300020000|Ga0193692_1128622All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae → Terrimonas → Terrimonas ferruginea505Open in IMG/M
3300020016|Ga0193696_1021099All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium1750Open in IMG/M
3300021082|Ga0210380_10366839All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae → Terrimonas → Terrimonas ferruginea658Open in IMG/M
3300021968|Ga0193698_1003321All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae1952Open in IMG/M
3300022756|Ga0222622_10426044All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium938Open in IMG/M
3300022899|Ga0247795_1013844All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium1287Open in IMG/M
3300023064|Ga0247801_1070351All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae → Terrimonas → Terrimonas ferruginea559Open in IMG/M
3300023263|Ga0247800_1080787All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae → Terrimonas → Terrimonas ferruginea636Open in IMG/M
3300023264|Ga0247772_1155228All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae → Terrimonas → Terrimonas ferruginea503Open in IMG/M
3300023265|Ga0247780_1046478All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium1083Open in IMG/M
3300024055|Ga0247794_10004993All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae2847Open in IMG/M
3300025923|Ga0207681_11784849Not Available513Open in IMG/M
3300025925|Ga0207650_11899851All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae → Terrimonas → Terrimonas ferruginea503Open in IMG/M
3300025926|Ga0207659_10148834All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium1826Open in IMG/M
3300025961|Ga0207712_10686318All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium893Open in IMG/M
3300025961|Ga0207712_10821076All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium818Open in IMG/M
3300026089|Ga0207648_11956922All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae → Terrimonas → Terrimonas ferruginea548Open in IMG/M
3300026095|Ga0207676_12170399All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae → Terrimonas → Terrimonas ferruginea554Open in IMG/M
3300027880|Ga0209481_10562869All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae → Terrimonas → Terrimonas ferruginea590Open in IMG/M
3300031538|Ga0310888_10232099All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium1028Open in IMG/M
3300031538|Ga0310888_10281789All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium944Open in IMG/M
3300031562|Ga0310886_10296162All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium923Open in IMG/M
3300031847|Ga0310907_10750077All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae → Terrimonas → Terrimonas ferruginea543Open in IMG/M
3300031854|Ga0310904_10583679All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium761Open in IMG/M
3300031940|Ga0310901_10510500Not Available540Open in IMG/M
3300031944|Ga0310884_10736543All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae → Terrimonas → Terrimonas ferruginea599Open in IMG/M
3300032003|Ga0310897_10560811All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae → Terrimonas → Terrimonas ferruginea561Open in IMG/M
3300032122|Ga0310895_10087330All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium1242Open in IMG/M
3300032211|Ga0310896_10096283All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium1315Open in IMG/M
3300032211|Ga0310896_10944662All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae → Terrimonas → Terrimonas ferruginea501Open in IMG/M



 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil34.31%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural → Soil10.78%
Groundwater SedimentEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment7.84%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil3.92%
Switchgrass RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere3.92%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere3.92%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere3.92%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere2.94%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere2.94%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere2.94%
Switchgrass RhizosphereEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Switchgrass Rhizosphere1.96%
Plant LitterEnvironmental → Terrestrial → Plant Litter → Unclassified → Unclassified → Plant Litter1.96%
Arabidopsis RhizosphereHost-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere1.96%
Miscanthus RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere1.96%
Populus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere1.96%
Arabidopsis RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Arabidopsis Rhizosphere1.96%
Groundwater SedimentEnvironmental → Aquatic → Freshwater → Sediment → Unclassified → Groundwater Sediment0.98%
SoilEnvironmental → Aquatic → Freshwater → Groundwater → Unclassified → Soil0.98%
Groundwater SedimentEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment0.98%
Terrestrial SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil0.98%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil0.98%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Soil0.98%
Switchgrass RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere0.98%
Miscanthus RhizosphereHost-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Miscanthus Rhizosphere0.98%
Corn RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere0.98%
Miscanthus RhizosphereHost-Associated → Plants → Roots → Rhizosphere → Soil → Miscanthus Rhizosphere0.98%
Switchgrass RhizosphereHost-Associated → Plants → Roots → Rhizosphere → Soil → Switchgrass Rhizosphere0.98%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
3300000956Soil microbial communities from Great Prairies - Kansas, Native Prairie soilEnvironmentalOpen in IMG/M
3300004480Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of AARS Block 4EnvironmentalOpen in IMG/M
3300005293Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1Host-AssociatedOpen in IMG/M
3300005294Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 Bulk SoilEnvironmentalOpen in IMG/M
3300005295Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3EnvironmentalOpen in IMG/M
3300005330Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaGEnvironmentalOpen in IMG/M
3300005333Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaGHost-AssociatedOpen in IMG/M
3300005354Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaGHost-AssociatedOpen in IMG/M
3300005367Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaGHost-AssociatedOpen in IMG/M
3300005459Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2Host-AssociatedOpen in IMG/M
3300005578Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2Host-AssociatedOpen in IMG/M
3300005618Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2Host-AssociatedOpen in IMG/M
3300005719Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2Host-AssociatedOpen in IMG/M
3300005844Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2Host-AssociatedOpen in IMG/M
3300006358Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2Host-AssociatedOpen in IMG/M
3300009094Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2)Host-AssociatedOpen in IMG/M
3300009553Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaGHost-AssociatedOpen in IMG/M
3300010403Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-3EnvironmentalOpen in IMG/M
3300011332Soil microbial communities from California, USA to study soil gas exchange rates - SR-CA-SC2 metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300012883Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S014-104B-1EnvironmentalOpen in IMG/M
3300012884Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S073-202C-2EnvironmentalOpen in IMG/M
3300012885Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S104-311B-1EnvironmentalOpen in IMG/M
3300012891Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S148-409B-2EnvironmentalOpen in IMG/M
3300012893Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S059-202B-1EnvironmentalOpen in IMG/M
3300012895Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S208-509C-2EnvironmentalOpen in IMG/M
3300012896Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S118-311C-2EnvironmentalOpen in IMG/M
3300012901Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S119-311C-1EnvironmentalOpen in IMG/M
3300012904Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S029-104C-1EnvironmentalOpen in IMG/M
3300012905Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S013-104B-2EnvironmentalOpen in IMG/M
3300012907Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S044-104R-1EnvironmentalOpen in IMG/M
3300012908Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S089-202R-1EnvironmentalOpen in IMG/M
3300012914Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S028-104C-2EnvironmentalOpen in IMG/M
3300013297Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaGHost-AssociatedOpen in IMG/M
3300013308Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaGHost-AssociatedOpen in IMG/M
3300014325Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaGHost-AssociatedOpen in IMG/M
3300014326Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaGHost-AssociatedOpen in IMG/M
3300015200Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S209-509C-1 (version 2)EnvironmentalOpen in IMG/M
3300015371Combined assembly of cpr5 and col0 rhizosphere and soilHost-AssociatedOpen in IMG/M
3300015372Soil combined assemblyHost-AssociatedOpen in IMG/M
3300015373Combined assembly of cpr5 rhizosphereHost-AssociatedOpen in IMG/M
3300018031Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3-1_200_b1EnvironmentalOpen in IMG/M
3300018051Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_5_b1EnvironmentalOpen in IMG/M
3300018072Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_30_b2EnvironmentalOpen in IMG/M
3300018073Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_5_b1EnvironmentalOpen in IMG/M
3300018074Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3-1_200_b2EnvironmentalOpen in IMG/M
3300018081Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_30_b1EnvironmentalOpen in IMG/M
3300018083Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM4_5_b1EnvironmentalOpen in IMG/M
3300018469Populus adjacent soil microbial communities from riparian zone of Weber River, Utah, USA - 320 TEnvironmentalOpen in IMG/M
3300018476Populus adjacent soil microbial communities from riparian zone of Yellowstone River, Montana, USA - 531 TEnvironmentalOpen in IMG/M
3300018481Populus adjacent soil microbial communities from riparian zone of Weber River, Utah, USA - 356 TEnvironmentalOpen in IMG/M
3300019356Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S073-202C-2 (version 2)EnvironmentalOpen in IMG/M
3300019362Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S104-311B-1 (version 2)EnvironmentalOpen in IMG/M
3300019996Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L3a2EnvironmentalOpen in IMG/M
3300019998Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? H3m1EnvironmentalOpen in IMG/M
3300020000Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L3a1EnvironmentalOpen in IMG/M
3300020016Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L3m1EnvironmentalOpen in IMG/M
3300021082Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM4_5_coex redoEnvironmentalOpen in IMG/M
3300021968Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L3c1EnvironmentalOpen in IMG/M
3300022756Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM2_5_b1EnvironmentalOpen in IMG/M
3300022899Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-S016-104C-6EnvironmentalOpen in IMG/M
3300023064Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-S001-104B-6EnvironmentalOpen in IMG/M
3300023263Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-S092-311B-6EnvironmentalOpen in IMG/M
3300023264Plant litter microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-L151-409C-6EnvironmentalOpen in IMG/M
3300023265Plant litter microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-L079-202R-5EnvironmentalOpen in IMG/M
3300024055Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-S046-202B-6EnvironmentalOpen in IMG/M
3300025923Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025925Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025926Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025961Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300026089Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026095Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300027880Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD3 (SPAdes)Host-AssociatedOpen in IMG/M
3300031538Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T20D1EnvironmentalOpen in IMG/M
3300031562Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T60D3EnvironmentalOpen in IMG/M
3300031847Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C48D4EnvironmentalOpen in IMG/M
3300031854Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C48D1EnvironmentalOpen in IMG/M
3300031940Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C24D2EnvironmentalOpen in IMG/M
3300031944Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T60D1EnvironmentalOpen in IMG/M
3300032003Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C0D1EnvironmentalOpen in IMG/M
3300032122Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C0D4EnvironmentalOpen in IMG/M
3300032211Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C8D1EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap



 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
JGI10216J12902_10356584213300000956SoilMKLDSSLKVKTTTRKKVRIASGGILFFLTSIIAFAYWYWDTHKNKIIENELEEALVKTNKGFYKVSYDDIKVNESAGALTLRNMKVRFDSVVYQSTKNVEKIPAMVFNIDIPEINVVGVKTKSALLDKEIVGRKIEIKNPVIDLQYTYKGKDSIRN
Ga0062592_10133726213300004480SoilMRSNPEAKVKANKRNWGKIVLISILFFVLAIIGVGFFYWNTHKNKIIKTELEKAIVKNNNGFYKIDYDDMKIDEAAGALSVRNMKLRFDSARYRSLEKENKAPSMVFNVDIPEINIVGVRTTRALLDKEIVGRKLEIRNPVIDLQYTYKGKDSD
Ga0065715_1074340023300005293Miscanthus RhizosphereMRSNFGSKEEGKRKRRIKIVLVSVLVFVLAIIGFGFLYWNTHKNKIIKTELEKAIVKNNKGFYKISYDDMKIDETAGYLSARNMKVRFDSARYQSSELENKVPSMVFSIDIPEINVIGVRTTRALLDKEI
Ga0065705_1068158113300005294Switchgrass RhizosphereMHLNSPLEVKHRRRNTIKIVLISISFLILAIIGFGFLYWNTHKNKIIKTELEKAIVKSNKGFYKVSYDDMKIDESVGALSIRNMKLRFDSTRYQSFEKGGKVPSMVFNIDIPEINVVGVKTTSALIDKEIIGRKLE
Ga0065707_1094599813300005295Switchgrass RhizosphereMKSNSPLEIKDTKRNTIKIIFISISISILAIIGFGFWYWNTHKNKIIKTELEKAIVKSNKGFYKVSYDDMKIDESAGALSIHNMKLRFDSASYQSFERNGKAPSMVFNIDIPEINVVGVKTTRALLDKEIIGRK
Ga0070690_10133871113300005330Switchgrass RhizosphereMRSNFGSKEEGKRKRRIKIVLVSVLVFVLAIIGFGFLYWNTHKNKIIKTELEKAIVKNNKGFYKISYDDMKIDETAGYLSAHNMKVRFDSARYQSSELENKVPSMVFSIDIPEINVIGVRTTRALLDKEIVGRKLEIKNPIIDLQYTYK
Ga0070677_1030921413300005333Miscanthus RhizosphereMRSNSGSNEEGKRKRRIKIVLVSVLVFVLAIVGFGFFYWNTHKNKIIKTELEKAIVKNNKGFYKISYDDMKIDETSGYLSARNMKVRFDSARYQSSELKNKVPSIVFNIDIPEINVIGVRTTRALLDKEIVGRKLEIKNPIIDLQYTYKGKDATRKVPTQEIYRQILGDMDMIQIDSVLITG
Ga0070675_10018281913300005354Miscanthus RhizosphereMRSNFGSKEEGKRKRRIKIVLVSVLVFVLAIIGFGFLYWNTHKNKIIKTELEKAIVKNNKGFYKISYDDMKIDETAGYLSARNMKVRFDSARYQSSELENKVPSMVFSIDIPEINVIGVRTTRALLDKEIVGRKLEIKNPIIDLQYTYKGKDAIRNVPTQEIYRQILGD
Ga0070675_10084898323300005354Miscanthus RhizosphereMRSNSGSNEERKRKRRIKIVLVSVLVFVLAIFGFGFFYWNTHKNKIIKTELEKAIVKNNKGFYKISYDDMKIDETSGYLSARNMKVRFDSARYQSSELKNKVPSIVFNIDIPEINVIGVRTTRALLDKEIVGRKLEIKNPIIDLQYTYKGKDATRKVPTQEIYRQILG
Ga0070667_10183210913300005367Switchgrass RhizosphereMRSNFVSKKEGKSRRRVKIVLVSILVFVMAIIGIGFLYWNTHKNKIIKTELEKAIVKNNKGFYKISYDDMKIDETAGYLSARNMKVRFDSARYQSSELENKVPSIVFNIDIPEINVIGVRTTRALLDKEIVGRKLEIKNPIIDLQYTYKGKDAIRNVPTQEIYRQILGDMDMIQID
Ga0068867_10209536813300005459Miscanthus RhizosphereMRSNFGSNKEGKRKRRGKIVLVSILVFVLSIIGFGFLYWNTHKNKIIKTELEKAIVKNNKGFYKISYDDMKIDETAGYLSVRNMKVRFDSARYQSSELENKVPSMVFSIDIPEINVIGVRTTRALLDKEIVG
Ga0068854_10151664813300005578Corn RhizosphereMRSNFGSNKEGKRKRRVKIVLVSILVFVLSIIGFGFLYWNTHKNKIIKTELEKAIVKNNKGFYKISYDDMKIDETSGYLSARNMKVRFDSARYQSSELENKVPSMVFSIDIPEINVIGVRTTRALLDKEIVGRKLEIKNPIIDLQYTYKG
Ga0068864_10211613013300005618Switchgrass RhizosphereILTRWNSNCFIDPMELNSESKVKEKRRRRSKIVIISILCFLLAIIGFGFLYWNTHKNKIIKTELEKAIVKNNKGFYKISYDDMKIDETSGYLSARNMKVRFDSARYQSSELENKVPSIVFNIDIPEINVIGVRTTRALLDKEIVGRKLEIKNPIIDLQYTYKGKDSIRHVPTQEVYRQILGNLDMIQID
Ga0068861_10143315813300005719Switchgrass RhizosphereMRSNFGSKEEGKRKRRIKIVLVSVLVFVLAIIGFGFLYWNTHKNKIIKTELEKAIVKNNKGFYKISYDDMKIDETAGYLSARNMKVRFDSARYQSSELENKVPSMVFSIDIPEINVIGVRTTRALLDKEIVGRKLEIKNPIIDLQYTYKG
Ga0068862_10202330913300005844Switchgrass RhizosphereWRCSIRWNSNCLIAIMKLNSSSEDKGTKRHTVKIILISSSFFLLAVMGFGFWYWTTHKNKIIKTELEKAIVKSNKGFYKVSYDDMKIDEIVGSLFVRNMKLRFDSATYQSLEKENKVPSMVFNIDIPEISVVGVRTTRALLDKEIVGRKLEIKNPIIDLQYTYKGKDSIRHVPTQEVYRQILGNLDMIQIDSVLI
Ga0068871_10192082113300006358Miscanthus RhizosphereMRSNFVSKEEGKSRRRVKIVLVSIMVFVLAIIGIGFLYWNTHKNKIIKTELEKAIVKNNKGFYKISYDDMKIDETAGYLSAHNMKVRFDSARYQSSELENKVPSIVFNIDIPEINVIGVRTARALLDKEIV
Ga0111539_1172249613300009094Populus RhizosphereMRSNSGSNEEGKRKRRVKIVLVSILVFVLAIIGFGFLYWNTHKNKIIKTELEKAIVKNNKGFYKISYDDMKIDETAGYLSARNMKVRFDSARYQSSELENKVPSMVFNIDIPEINVIGVRTTRALLDKEIVGRK
Ga0105249_1084126413300009553Switchgrass RhizosphereMRLNSESKIKRERRGRIKMVLISILVFVLAIVGFGLFYWTTHKNKIVKTELEKAIVKNNNGFYKISYDDMKIDETAGYLSVRNMKVRFDSARYQSSELENKVPSMVFNIDIPEINVVGVRTTRALLDKEIVGRKLEIKNPIIDLQYTYKGKD
Ga0134123_1296650313300010403Terrestrial SoilMRSNFVSKEEGKSRRRVKIVLVSILVFVLAIIGIGFLYWNTHKNKIIKTELEKAIVKNNKGFYKISYDDMKIDETAGYLSAHNMKVRFDSARYQSSELENKVPSMVFSIDIPEINVIGVRTTRALLDKEIV
Ga0126317_1089317033300011332SoilMELNSGLNEKGKRKRRVKIVLVSILVFVLAFIGFGFLYWTTHKDKIIKTELEKAIVKNNKGFYKISYDNMKIDETAGYLSARNMKVRFDSARYQSSDLENKVPSMVFNIDIPEINIIGVRTTRALL
Ga0157281_102551923300012883SoilMRSNSGSNEERKRKRRIKIVLVSVLVFVLAIIGFGFLYWSTHKNKIIKTELEKAIVKNNKGFYKISYDDMKIDETAGYLSARNMKVRFDSARYQSSELENKVPSMVFNIDIPEINVIGVRTTRALLDKEIVG
Ga0157300_100347613300012884SoilMGLNSGSKVKGNRRNRIKIVLISILFFVLAIIGVGFFYWTTHKNKIIKTELEKAIVKNNNGFYKISYDDMKIDEVAGSLSVRNMKLRFDSARYQSAEKENKVPSMVFDVAIPEINVVGVR
Ga0157287_100715513300012885SoilMRSNSGSNEEGKRKRRNKIVLVSVLVFVLAIIGFGFLYWNTHKNKIIKTELEKAIVKNNKGFYKISYDDMKIDETAGYLSARNMKVRFDSARYQSSELENKVPSMVFSIDIPEINVIGVRTTRALLDKEIVGRKLEIKNPIIDLQYTYKGKD
Ga0157287_103564513300012885SoilMRSNSGSNEERKKKRRIKIVLVSVLVFVLAIVGFGFFYWNTHKNKIIKTELEKAIVKNNKGFYKISYDDMKIDETAGYLSARNMKVRFDSARYQSSELENKVPSIVFNIDIPEINVIGVRTTRALLDKEIVGRKLEIKNPIIDLQYTYKGKDSIRNVPTQEIYRQILGDMDMIQIDSVLITG
Ga0157305_1009683423300012891SoilMRSNSGSNEERKRKRRIKIVLVSILVFVVGIIGFGFLYWNTHKNKIIKAELEKAIVKNNKGFYKISYDDMKIDETSGYLSARNMKVRFDSARYQSSELKNKVPSMVFNIDIPEINIIGVRTTRALLDKEIVGRKLEI
Ga0157284_1018691513300012893SoilMKLNSSSPVKSTKGNTIKIVLISISFLLLAIIGFGFFYWNTHKNKIIKTELEKAIVKSNKGFYKISYDDMKIDETAGYLSAHNMKVGFDSARYQTSELENKIPSMVFNIDIPEINIVGVRTTRALLDKEIVGRKLEIKNPIIDLQYTYKGKDAIRNVPTQEI
Ga0157309_1017610213300012895SoilMKSNSGSKVQGKRKRRVKIVLVSILVFVLAIIGIGFLYWNTHKNKIIKTELEKAIVKNNKGFYKISYDDMKIDETAGYLSAHNMKVRFDSARYQSSELENKVPSMVFSIDIPEINVIGVRTTRALLDKEIVGRKLEIKNPIIDLQYTYKGKDSIRHVPTQEVYRQILGNLDMIQIDSVLITGAQIRTSNRK
Ga0157303_1005611023300012896SoilMRSNSGSNEEVKRKRRIKIVLVSILVFVLAIVGFGFFYWNTHKNKIIKTELEKAIVKNNKGFYKISYDDMKIDETAGYLSARNMKVRFDSARYQTSELENKVPSMVFNIDIPEINVIGVRTTSALLDKEIVGRKLEIRNPIIDLQYTYKGKDAIRNVPTQEIYRQILGDMDMIQIDSVLITGAQIRTSN
Ga0157303_1019032613300012896SoilMKLNSSSEDKGTKRHTVKIILISSSFFLLAVMGFGFWYWTTHKNKIIKTELEKAIVKSNKGFYKVSYDDMKIDEIVGSLFVRNMKLRFDPATYQSLEKENKVPSMVFNIDIPEISVVGVRTTRALLDKEIVGRKLEIKNPIIDLQYTYKGKDSIRH
Ga0157288_1019830313300012901SoilMKLNSSSEDKGTKRHTVKIILISSSFFLLAVMGFGFWYWTTHKNKIIKTELEKAIVKSNKGFYKVSYDDMKIDEIVGSLFVRNMKLRFDSATYQSLEKENKVPSMVFNIDIPEISVVGVRTTRALLDKEIVGRKLEIKNPIIDLQYTYKGKDSIRHVPTQEVYRQILGNLDMIQID
Ga0157282_1002789933300012904SoilLCKYSLEILISGIVIVLFDAMRSNSGSKEEGKKRRRIKIVLVSILVFVVAIIGFGFLYWNTHKNKIIKTELEKAIVKNNKGFYKISYDDMKIDETSGYLSARNMKVRFDSARYQSSELKNKVPSMVFNIDIPE
Ga0157296_1015625423300012905SoilMKLNSPLEIKDTKRNTIKIIFISISISILAIIGFGFWYWNTHKNKIIKTELEKAIVKSNKGFYKVSYDDMKIDESAGALSIHNMKLRFDSASYQSFERNGKAPSMVFNIDIPEINVVGVKTTRALLDKEIIGRKLEVKNPVIDLQYTYKGKDSIRNV
Ga0157283_1017234613300012907SoilMRSNFGSNEEGKRKRRIKIVLGSVLVFVLAIIGFGFLYWNTHKNKIIKTELEKAIVKNNKGFYKISYDDMKIDETAGYLSARNMKVRFDSARYQSSELENKVPSMVFSIDIPEINVIGVRTTRALLDKE
Ga0157286_1031034513300012908SoilMRSNSGSNEEGKRKRRVKIVLVSILVFVLAIIGFGFLYWNTHKNKIIKTELEKAIVKNNKGFYKISYDDMKIDETSGYLSAPNMKVRFDSARYQASELENKVPSMVFNIDIPEINVIGVRTTRALLDKEIVGRKLEI
Ga0157297_1005937013300012914SoilMRSNSGSNEEGKRKRRVKIVLVSILVFVLAIIGFGFLYWNTHKNKIIKTELEKAIVKNNKGFYKISYDDMKIDETSGYLSASNMKVRFDSARYQTSELENKIPSMVFNIDIPEINIVGVRTTRALLDKEIVGRKLEIKNPIIDLQYTYKGKDA
Ga0157378_1313714213300013297Miscanthus RhizosphereMRSNFVSKEEGKSRRRVKIVLVSILVFVLAIIGIGFLYWNTHKNKIIKTELEKAIVKNNKGFYKISYDDMKIDETAGYLSAHNMKVRFDSARYQSSELENKVPSMVFSIDIPEINVIGVRTTRALLDKEIVGRKLEIKNPIIDLQYTYKGKD
Ga0157375_1106855823300013308Miscanthus RhizosphereMRSNFGSKEEGKRKRRIKIVLVSVLVFVLAIIGFGFLYWNTHKNKIIKTELEKAIVKNNKGFYKISYDDMKIDETAGYLSARNMKVRFDSARYQSSELENKVPSMVFSIDIPEINVIGVRTTRALLDKEIVG
Ga0157375_1148227423300013308Miscanthus RhizosphereMELNSESKVKEKRRRRSKIVIISILCFLLAIIGFGFLYWNTHKNKIIKTELEKAIVKNNKGFYKISYDDMKIDETAGYLSARNMKVRFDSARYQSSELENKVPSIVFNIDIPEINVIGVRTTRALLDKEIVGRKLEIKNPIIDLQYTYKGKDSIRNVPTQEIYRQILGDMDMIQIDSVLI
Ga0163163_1227081913300014325Switchgrass RhizosphereMRSNSGSNEEGKRKRRVKIVLVSILVFVLAIVGFGFFYWNTHKNKIIKTELEKAIVKNNKGFYKISYDDMKIDETSGYLSARNMKVRFDSARYQSSELKNKVPSMVFNIDIPEINVIGVRTTRALLDKEIVGRKLEIKNPIIDLQYT
Ga0157380_10007796123300014326Switchgrass RhizosphereMKLNSSSRVKGTTGKTIKIVLISISFLLLVIIGVGFLYWDTHKNKIIKTELEKAIVKKNKGFYKISYDGMKIDETAGYLTARNMKVRFDSTRYQSSELENKIPSMVFNIDIPEINIIGVRTTRALLDKEIVGRKVEIKNPIIELQYTYKG
Ga0157380_1020070143300014326Switchgrass RhizosphereMRSNFVSKEEGKSRRRVKIVLVSILVFVLAIIGIGFLYWNTHKNKIIKTELEKAIVKNNKGFYKISYDDMKIDETAGYLSAHNMKVRFDSARYQSSELENKVPSMVFSIDIPEINVIGVRTTRALLDKEIVGRKLEIKNPIIDLQYTYKGKDAIR
Ga0157380_1227990213300014326Switchgrass RhizosphereMRSNSESKIKGARRDRIKIVLIGVLLFVLAIVGFGFFYWTTHKNKIVKTELEKAIVKNNNGFYKIDYDDMKIDEAAGALSVRNMKLRFDSARYQSLAKENKVPSMVFNIDIPEINVVGVRTTRALLDKEIVGRKLEIKNPIIDLQYTYKGKD
Ga0157380_1266185313300014326Switchgrass RhizosphereMRSNSGSNEEGKRKRRVKIVLVSILVFVLAIIGFGFLYWNTHKNKIIKTELEKAIVKNNKGFYKISYDDMKIDETSGYLSARNMKVRFDSARYQSSELENKVPSMVFNIDIPEINVIGVRTTRALLDKEIVGRKLEIKNPIIDLQYTYKGKDAIRNVPTQ
Ga0173480_1022341213300015200SoilMRSNSGSNEEGKRKRRVKIVLVSILVFVLAIIGFGFLYWNTHKNKIIKTELEKAIVKNNKGFYKISYDDMKIDETSGYLSARNMKVRFDSARYQASELENKVPSMVFNIDIPEINVIGVRTTRALLDKEIVGRKLEIKNPIIDLQYTYKGKDAIRNVPTQEIYRQIL
Ga0132258_1027389513300015371Arabidopsis RhizosphereMRSNFGSKEEGKRKRRITIVFVSILVFALAIIGFGFLYWNTHKNKIIKTELEKAIVKNNKGFYKISYDDMKIDETTGYLSARNMKVRFDSARYQTSELENKVPSMIFNIDIPEINVIGVRTTRALLDKEIVGRKLEIKNPIIDLQYTYKGKDAI
Ga0132256_10201380013300015372Arabidopsis RhizosphereMRSNFGSKEEGKRKRRITIVFVSILVFALAIIGFGFLYWNTHKNKIIKTELEKAIVKNNKGFYKISYDDMKIDETAGFLSARNMKVRFDSARYKSSELENKVPSMVFNIDIPEINVIGVRTTRALLDKEIIGRKLEIKNPIIDLQYTYKGKDAVRNVPTQEIYRQILGDMDMIQIDSVLITGAQIRT
Ga0132256_10372891413300015372Arabidopsis RhizosphereMKLNSPLGTKTTKRKIIKVVLIGISFFLLAIIGIGFWYWTTHKNKIIKTELEKAIVKNNKGFYKVSYDDMKIDETAGALFVHNMKLRFDSASYQSTEKDSKIPPMVFNIDIPEINILGVKTTKALLDKEIVGRKLEIKNPIINLQYTYKGKDSIRNVPTQEIYRQILGNM
Ga0132257_10165635113300015373Arabidopsis RhizosphereMRSNFGSKEEGKRKRRITIVFVSILVFALAIIGFGFLYWNTHKNKIIKTELEKAIVKNNKGFYKISYDDMKIDETTGYLSARNMKVRFDSARYQSSELENKVPSIVFNIDIPEINVIGVRTTRALLDKEIVGRKLEIKNPIIDLQYTYKGKD
Ga0184634_1010410013300018031Groundwater SedimentMRSNFGSKEEGKRKRRIKIVLVSVLVFVLAIIGFGFLYWNTHKNKIIKTELEKAIVKNNKGFYKISYDDMKIDETSGYLSARNMKVRFDSARYQSSELKNKVPSIVFNIDIPEINVIG
Ga0184620_1009014313300018051Groundwater SedimentMESNSHTGLKETKRRKIKIILVSILFSLIAIIGFGFWYWNTHKNEIIKTELEKAIVKNNKGFYKISYDDMKIDEVAGALSVRNLKLRFDSAGYRLAEQNGKVPPMVFNVDIPEISVAGVKTSKALLDKEIIGRKLEIKNPVIDLQYTYKGKDSKRNVPTQEVYR
Ga0184635_1038907213300018072Groundwater SedimentMRSNSVLKEEGKSRRRVKIVLVSILVFVLAIIGIGFLYWNTHKNKIIKTELEKAIVKNNKGFYKISYDDMKIDETSGYLSAHNMKVRFDSARYQSSELKNKVPSMIFNIDIPEINVIGVRTTRALLDKEIVGR
Ga0184624_1033324113300018073Groundwater SedimentMKSNFVSKEEGKSRRRVKIVLVSILVFVLAIIGIGFLYWNTHKNKIIKTELEKAIVKNNKGFYKISYDDMKIDETAGYLSAHNMKVRFDSARYQSSELENKVPSMVFNIDIPEINVIGVRTTRALLDKEIVGRKLEIKNPIIDLQYTYKGKDAIRNVPTQEIYRQILGDMDMIQIDSVLITGAQIRT
Ga0184640_1052472713300018074Groundwater SedimentMRSNSGSNVEGKKRRRVKIVLVSILVFVLAIIGIGFLYWNTHKNKIIKTELEKAIVKNNKGFYKISYDDMKIDETAGYLSAHNMKVRFDSARYQSSELENKVPSMVFNIDIPEINVIGVRTTRALLDKEIVGRKLEIKNPIIDLQY
Ga0184625_1028860413300018081Groundwater SedimentMLFLFICYPPITIGWNNNCLIISMESNSHTGLKETKRRKIKIIFASILFSLVAIIGFGFWYWDTHKNKIIKTELEKAIVKNNNGFYKISYDDMKIDEVAGALSVRNMKLRFDSAGYQLSEQNGKIPPMIFNIDIPEINVVGVKTTSALLDKEIIGRKLEIKNLIIDLQYTYKGKDSKRNVPTQDVYRQ
Ga0184628_1037202223300018083Groundwater SedimentMKSNSGSKVQGKRKRRVKIVLVSILVFVLAIIGFGFLYWNTHKNKIIKTELEKTIVKNNKGFYKISYDDMKIDETSGFLSARNMKVRFDSTRYQSSELENKVPSMVFNIDIPEINVMGVRTTRALLDKEIVGRKLEIKNPI
Ga0184628_1041575623300018083Groundwater SedimentMELNSEAKVKENKRNRGKIVLISILFFVLAIIGFGFLYWNTHKNKIIKTELEKAIVKNNKGFYKISYDDMKIDETAGYLSARNMKVRFDSTRYQTSELENKVPSMVFNIDIPEINVIGVRTSRALLDKEIVGRKLEIKNPIIDLQYTYKG
Ga0190270_1135148313300018469SoilMRANFTSKEKGKRKHRIKIVLVSVLVLALGIIGFGFLYWNTHKDKIIKTELEKAIVKNNKGFYKISYDDMKIDETAGYLSARNMKVRFDSTRYQSSELEYKVPSMVLNIDIPEINIIGVRTTRALLDKEIVGRRLEIKNPIIDLQYTYKGKDAIRNVPTQEIYRQILGDMDMIQIDSVLITGAQI
Ga0190270_1229065113300018469SoilMELNSESKVKGNTRGRIKIVLVSILFVVLAIIGFGFFYWTTHKNKIIKTELEKAIVKNNNGFYKISYDDMKVDEVVGSLTVRNMKLRFDSARYKSAEKENNVPSMVFDIDIPEINVVGVRTTRALLEKEIVGRKLEIKNPIIDLQYTYRGKDSIRNVPTQEVYRQILGNMDMI
Ga0190274_1031165833300018476SoilMRSNFVSKKEGKSRRRVKIVLVSILVFVMAIIGIGFLYWNTHKNKIIKTELEKAIVKNNKGFYKISYDDMKIDETAGYLSAHNMKVRFDSARYQSSELENKVPSMVFSIDIPEINVIGVRTTRALLDKEIVGRKLEIKNPIIDLQYTYKGKDAIRNVPTQEI
Ga0190274_1199736613300018476SoilMELNSEAKVKENKRNRGKIVLISILFFVLAIIGFGFLYWNTHKNKIIKTELEKAIVKNNKGFYKISYDDMKIDETAGYLSARNMKVRFDSTRYQTSELENKVPSMVFNIDIPEINVIGVRTSRALLDKEIVGRKLEIKNPIIDLQYT
Ga0190274_1295056823300018476SoilMKLNSPSPVKGSKGNTIKIVLISISFLFLAIIGFGFLYWNTHKNKIIKTELEKAIVKSNKGFYKISYDDMKIDETAGYLSARNMKVRFDSTRYQSSELENKVPSMVFNIDIPEINVIGVRTTR
Ga0190271_1097036013300018481SoilMRLNSVSKVKEKGRGRIKIVLISSLVLLLAIISFGFFYWTTHKNKIIKTELEKAIVKNNDGFYKISYDDMKIDEVSGSLSVHNMKLRFDSVRYQSLEKENKVPSMVFDIDIPEINVVGVRTTRALLDREIVGRKLEIKNPIIDL
Ga0173481_1000515173300019356SoilMGINSGSKVKGNRRNRIKIVLISILFFVLAIIGVGFFYWTTHKNKIIKTELEKAIVKNNNGFYKISYDDMKIDEVAGSLSVRNMKLRFDSARYQSAEKENKVPSMVFDVAIPEINVVGVRTTRALLDKEIVGRKLEIKNPIIDLQYTYRGKDSIRNVPTQEVYRQILGNMDMIQFDSVLITGAQIR
Ga0173481_1028844113300019356SoilMRSNSGSNEEGKRKRRVKIVLVSILVFVLAIIGFGFLYWNTHKNKIIKTELEKAIVKNNKGFYKISYDDMKIDETSGYLSARNMKVRFDSARYQTSELENKVPSMVFNIDIPEINVIGVRTTRALLDKEIVGRKLEIKNPIIDLQYTYKGKDAVRNVPTQEIYRQILGDMDMIQIDSV
Ga0173481_1072624513300019356SoilMKLNSPSPVKGTKGNTIKIVLISISFLLLAIIGFGFLYWNTHKNKIIKTELEKAIVKNNKGFYKISYDDMKIDETAGYLSAHNMKVRFDSARYQSSELENKIPSMVFNIDIPEINIIGVRTTRALLDKEIVGRKLEIK
Ga0173479_1007791633300019362SoilMKLNSSSPVKSTKGNTIKIVLISISFLLLAIIGFGFFYWNTHKNKIIKTELEKAIVKNNKGFYKISYDDMKIDEAAGYLTARNMKVRFDSTRYQSSELENKVPSMVFNIDIPEINIIGVRTTRALLDKEIVGRKLEIKNPIIDLQYTYKGKDAIR
Ga0173479_1040106113300019362SoilMRSNFGSKEEGKRKRRIKIVLVSVLVFVLAIIGFGFLYWNTHKNKIIKTELEKAIVKNNKGFYKISYDDMKIDETAGYLSARNMKVRFDSARYQSSELKNKVPSMVFNIDIPEIN
Ga0173479_1060974513300019362SoilSNSGSNEERKRKRRIKIVLVSVLVFVLAIVGFGFFYWNTHKNKIIKTELEKAIVKNNKGFYKISYDDMKIDETSGYLSARNMKVRFDSARYQSSELKNKVPSIVFNIDIPEINVIGVRTTRALLDKEIVGRKLEIKNPIIDLQYTYKGKDATRNVPTQEIYRQILGDMDMIQIDSVLITGAQIRTSNRNT
Ga0173479_1084236313300019362SoilIKIVLISISFLLLAIIGFGFFYWNTHKNKIIKTELEKAIVKSNKGFYKISYDDMKIDETAGYLSAHNMKVRFDSARYQTSELENKIPSMVFNIDIPEINIVGVRTTRALLDKEIVGRKLEIKNPIIDLQYTYKGKDAIRNVPTQEIYRQILGDMDMIQIDSVSITGAQIR
Ga0193693_101371933300019996SoilMRSNFGSKEERKRKRRIKIVLVSVLVFVLAIIGFGFLYWNTHKNKIIKTELEKAIVKNNKGFYKISYDDMKIDETAGYLSARNMKVRFDSARYQSSELENKVPSMVFSIDIPEINVIGVRTTRALLDKEIVGRKLEIKNPIIDLQYT
Ga0193693_101614613300019996SoilMRSNFVSKEEGKSRRRVKIVLVSILVFVLAIIGIGFLYWNTHKNKIIKTELEKAIVKNNKGFYKISYDDMKIDETAGYLSAHNMKVRFDSARYQSSELENKVPSMVFSIDIPEINVIGVRTTRALLDKEIVGRKLEIKNPIIDLQYTYKGKDAIRNVPTQEIYRQILGDMDMIQIDSVLI
Ga0193710_100702923300019998SoilLILAIIGFGFLYWTTHKNKIIKTELEKAIVKSNKGFYKVSYDDMKIDELTGSLSVRNMKLRFDSTRYQSFEKGGKVPSMVFNIDIPEINVAGVKTTSALIDREIIGRKLEIKNPIIDLQYTYRGKDSVRNVPTEEVYRQILGNMDMIQIDS
Ga0193692_112862213300020000SoilMRSNSGSNEEGKRKRRIKIVLVSVLVFVLAVVGFGFFYWNTNKNKIIKTELEKAIVKNNKGFYKISYDDMKIDETAGYLSARNMKVRFDSARYQSSELENKVPSMVFNIDIPEINVIGVRTTRALLDKEIVGR
Ga0193696_102109943300020016SoilMKSNFVSKEEGKSRRRVKIVLVSILVFVLAIIGIGFLYWNTHKNKIIKTELEKAIVKNNKGFYKISYDDMKIDETAGYLSAHNMKVRFDSARYQSSELENKVPSMVFSIDIPEINVIGVRTTRALLDKEIVGRKLEIKNPIIDLQYTYKGRD
Ga0210380_1036683913300021082Groundwater SedimentMGINSGSKVKGNRRNRIKIVLISILFFVLAIIGFGFLYWNTHKNKIIKTELEKAIVKNNKGFYKISYDDMKIDETAGYLSARNMKVRFDSTRYQTSELENKVPSMVFNIDIPEINVIGVRTSRALLDKEIVGRKLEIKNPIIDLQYTYKGKDAIRNVPTQEIYRQILG
Ga0193698_100332153300021968SoilMRSNFGSKEEGKRKRRIKIVLVSVLVFVLAIIGFGFLYWNTHKNKIIKTELEKAIVKNNKGFYKISYDDMKIDETAGYLSARNMKVRFDSARYQSSELENKVPSMVFSIDIPEINVIGVRTTRALLDKEIVGRKLEIKNPIIDLQY
Ga0222622_1042604413300022756Groundwater SedimentMESNSHTGLKETKRRKIKIILVSILFSLIAIIGFGFWYWNTHKNEIIKTELEKAIVKNNKGFYKISYDDMKIDEVAGALSVRNLKLRFDSAGYRLAEQNGKVPPMVFNIDIPEISVAGVKTSKALLDKEIIGR
Ga0247795_101384433300022899SoilMKLNSPLEIKDTKRNTIKIIFISISISILAIIGFGFWYWNTHKNKIIKTELEKAIVKSNKGFYKVSYDDMKIDESAGALSIHNMKLRFDSASYQSFERDGKAPSMVFNIDIPEINVVGVKTTKALLDKEIIGRKLEVKNPVIDLQYTYKGKDSIRNVPTQEIYREILGKMDMIQI
Ga0247801_107035113300023064SoilIVLFEVMRSNFGSNEEGKRKRRIKIVLGSVLVFVLAIIGFGFLYWNTHKNKIIKTELEKAIVKNNKGFYKISYDDMKIDETAGYLSARNMKVRFDSARYQSSELENKVPSMVFNIDIPEINVIGVRTTRALLDKEIVGRKLEIKNPIIDLQYTYKGKDAIRNVPTQEIYRQILGDMDLIQIDSVLI
Ga0247800_108078713300023263SoilMRSNSGSNEEGKRKRRVKIVLVSILVFVLAIIGFGFLYWNTHKNKIIKTELEKAIVKNNKGFYKISYDDMKIDETSGYLSARNMKVRFDSARYQSSELENKVPSMVFNIDIPEINVIGVRTTRALLDKEIVGRKLEIKNPIIDLQYTY
Ga0247772_115522813300023264Plant LitterGSVLVFVLAIIGFGFLYWNTHKNKIIKTELEKAIVKNNKGFYKISYDDMKIDETAGYLSARNMKVRFDSARYQSSELENKVPSMVFNIDIPEINVIGVRTTRALLDKEIVGRKLEIKNPIIDLQYTYKGKDAIRNVPTQEIYRQILGDMDMIQIDSVLITGAQIRTS
Ga0247780_104647823300023265Plant LitterMRSNSGSNEEGKRKRRVKIVLVSILVFVLAIIGFGFLYWNTHKNKIIKTELEKAIVKNNKGFYKISYDDMKIDETSGYLSARNMKVRFDSARYQTSELENKVPSMVFNIDIPEINVIGVRTTRALLDKEIVGRKLEIKNPIIDLQYTYKGKDAVRNVPT
Ga0247794_1000499353300024055SoilMRSNFGSKEEGKRKRRIKIVLVSVLVFVLAIIGFGFLYWNTHKNKIIKTELEKAIVKNNKGFYKISYDDMKIDETSGYLSARNMKVRFDSARYQASELENKVPSMVFNIDIPEINVIGVRTTRALLDKEIVGRKLEIKNPIIDLQYTYKG
Ga0207681_1178484923300025923Switchgrass RhizosphereMRSNSGSNEERKRKRRIKIVLVSVLVFVLAIVGFGFFYWNTHKNKIIKTELEKAIVKNNKGFYKISYDDMKIDETSGYLSARNMKVRFDSARYQSSELKNKVPSIVFNIDIPEINVIGVRTTRALLDKEIVGRKLE
Ga0207650_1189985113300025925Switchgrass RhizosphereAIIGFGFWYWNTHKNKIIKTELEKAIVKSNKGFYKVSYDDMKIDESAGALSIHNMKLRFDSASYQSFERNGKAPSMVFNIDIPEINVVGVKTTKALLDKEIIGRKLEVKNPVIDLQYTYKGKDSIRNVPTQEIYREILGNMDMIQIDSVLITGAQLRTSSRNTGKLI
Ga0207659_1014883443300025926Miscanthus RhizosphereMRSNFVSKKEGKSRRRVKIVLVSILVFVMAIIGIGFLYWNTHKNKIIKTELEKAIVKNNKGFYKISYDDMKIDETAGYLSAHNMKVRFDSARYQSSELENKVPSMVFSIDIPEINVIGVRTTRALLDKEIVGRKLEIKNPIIDLQYTYKGKDAIRNVP
Ga0207712_1068631823300025961Switchgrass RhizosphereMRLNSESKIKRERRGRIKMVLISILVFVLAIVGFGLFYWTTHKNKIVKTELEKAIVKNNNGFYKISYDDMKIDETAGYLSVRNMKVRFDSARYQSSELENKVPSMVFNIDIPEINVVGVRTTRALLDKEIVGRKLEIKNPIIDLQYTYKGE
Ga0207712_1082107613300025961Switchgrass RhizosphereMRSNFVSKKEGKSRRRVKIVLVSILVFVLAIIGIGFLYWNTHKNKIIKTELEKAIVKNNKGFYKISYDDMKIDETAGYLSARNMKVRFDSARYQSSELENKVPSMVFSIDIPEINVIGVRTTRALLDKEIVGRKLEIKNPIIDLQYTYKGKDAIRN
Ga0207648_1195692213300026089Miscanthus RhizosphereMRSNFGSNKEGKRKRRGKIVLVSILVFVLSIIGFGFLYWNTHKNKIIKTELEKAIVKNNKGFYKISYDDMKIDETAGYLSVRNMKVRFDSARYQSSELENKVPSMVFNIDIPEINVIGVRTTRALLDKEI
Ga0207676_1217039913300026095Switchgrass RhizosphereMRSNSGSNEEGKRKRRIKIVLVSVLVFVLAIIGFGFLYWNTHKNKIIKTELEKAIVKNNKGFYKISYDDMKIDETAGYLSAHNMKVRFDSARYQSSELENKVPSMVFSIDIPEINVIGVRTTRALLDKEIVGRKLEIKNP
Ga0209481_1056286913300027880Populus RhizosphereMKLNSSSPVKITKGNTIKIVLISISFLLLAIIGFGFFYWNTHKNKIIKTELEKAIVKSNKGFYKISYDDMKIDETAGYLSAHNMKVRFDSARYQTSELENKIPSMVFNIDIPEINVVGVKTTRSLLDKEIIGRKLEVKNPVIDLQYTYKGKDS
Ga0310888_1023209913300031538SoilMMAAGFLYWNTHKNKIIKTELEKAIVKSNKGFYKVNYDDMKIDESAGSLSIRNMKLRFDSSIYQSFVEKGGKVPSMIFNIEIPEINVVGVKTTRALLDKEIIGRRLEIKNPVIDLQYTYKGKDSIRNAPTQEIYRQILGNMDMIQIDS
Ga0310888_1028178923300031538SoilMASNSESKVKRKGRNRIKIVLISILFFVVAVTCFGFFYWTTHKNKIIKTELEKAIVKNNNGFYHVSYDDMKIDEVVGSLSVRNMKLQFDSLRYQSSEKENKTPSMVFDIYIPEISVVGVRTARALLDKEIVGRKLEIKNPIIDLQYTYKGKDSIRNVPTQEVYRQILGNMDMIQIDS
Ga0310886_1029616223300031562SoilMKLNSPVKSTKRNSRKIVLISISFSLVAIIASGFLYWNTHKNKIIKTELEKALVKSNKGFYKVSYDDMKIDEAAGSLSIRNMKLRFDSSNYESFVAKGGKAPSMVFNIDIPEINIGGVKTTRALLDKEIIGRRLEIKNPVIDLQYTYKGKDSIRNV
Ga0310907_1075007713300031847SoilMRSNSGSNEERKRKRRIKIVLVSVLVFVLAIVGFGFFYWNTHKNKIIKTELEKAIVKNNKGFYKISYDDMKIDETSGYLSARNMKVRFDSARYQLSELKNKVPSIVFNIDIPEINVIGVRTTRALLDKEIVGRK
Ga0310904_1058367913300031854SoilMRSNSGSNEERKRKRRIKIVLVSILVFVVAIIGFGFLYWNTHKNKIIKTELEKAIVKNNKGFYKISYDDMKIDETSGYLSARNMKVRFDSARYQASELENKVPSMVFNIDIPEINVIGVRTT
Ga0310901_1051050023300031940SoilMRSNSELKVKRETRGRIKIVLISILLFILAIVGFGFFYWNTHKNKIVKTELEKAIVKNNNGFYKISYDDMKIDETAGYVSVRNMKVRFDSSRYQSSQLENKVPSMVFNIDIPEINVVGVRTTRALLDKEIVGRKLEIKNPIIDLQYT
Ga0310884_1073654313300031944SoilMRSNSELKVKRETRGRIKIVLISILLFILAIVGFGFFYWNTHKNKIVKTELEKAIVKNNNGFYKISYDDMKIDETAGYLSVRNMKVRFDSSRYQSSQLENKVPSMVFNIDIPEINVVGVRTTRALLDKEIVGRKLEIKNPIIDLQYTY
Ga0310897_1056081113300032003SoilERKRKRRIKIVLVSVLVFVLAIVGFGFFYWNTHKNKIIKTELEKAIVKNNKGFYKISYDDMKIDETSGYLSARNMKVRFDSARYQASELENKVPSMVFNIDIPEINVIGVRTTRALLDKEIVGRKLEIKNPIIDLQYTYKGKDAIRNVPTQEIYRQILGDMDMIQIDSVLITGAQIRTSNRNSGKV
Ga0310895_1008733013300032122SoilMRSNSELKVKRETRGRIKIVLISILLFILAIVGFGFFYWNTHKNKIVKTELEKAIVKNNNGFYKISYDDMKIDETAGYLSVRNMKVRFDSARYQSSQLENKVPSMVFNIDIPEINVVGVRTTRALLDKEIVGRKLEI
Ga0310896_1009628313300032211SoilMRSNSELKVKRETRGRIKIVLISILLFILAIVGFGFFYWNTHKNKIVKTELEKAIVKNNNGFYKISYDDMKIDETAGYLSVRNMKVRFDSSRYQSSQLENKVPSMVFNIDIPEIS
Ga0310896_1094466213300032211SoilIVLVSVLVFVLAIVGFGFFYWNTHKNKIIKTELEKAIVKNNKGFYKISYDDMKIDETSGYLSARNMKVRFDSARYQSSELKNKVPSIVFNIDIPEINVIGVRTTRALLDKEIVGRKLEIKNPIIDLQYTYKGKDATRKVPTQEIYRQILGDMDMIQIDSVLITGAQ


 ⦗Top⦘


© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.