| Basic Information | |
|---|---|
| Family ID | F101188 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 102 |
| Average Sequence Length | 42 residues |
| Representative Sequence | MEGLYDYKGWFWDDVNQRFYRWHELKILMQERELKKQKENAR |
| Number of Associated Samples | 84 |
| Number of Associated Scaffolds | 102 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 0.00 % |
| % of genes near scaffold ends (potentially truncated) | 27.45 % |
| % of genes from short scaffolds (< 2000 bps) | 80.39 % |
| Associated GOLD sequencing projects | 74 |
| AlphaFold2 3D model prediction | No |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (41.176 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine (29.412 % of family members) |
| Environment Ontology (ENVO) | Unclassified (70.588 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Saline → Water (saline) (81.373 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 69.05% β-sheet: 0.00% Coil/Unstructured: 30.95% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 102 Family Scaffolds |
|---|---|---|
| PF00959 | Phage_lysozyme | 3.92 |
| PF08291 | Peptidase_M15_3 | 0.98 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 60.78 % |
| Unclassified | root | N/A | 39.22 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300000101|DelMOSum2010_c10046392 | All Organisms → cellular organisms → Archaea → Euryarchaeota → unclassified Euryarchaeota → Euryarchaeota archaeon | 2212 | Open in IMG/M |
| 3300000115|DelMOSum2011_c10200229 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium TMED104 | 556 | Open in IMG/M |
| 3300000116|DelMOSpr2010_c10167342 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium TMED104 | 735 | Open in IMG/M |
| 3300000117|DelMOWin2010_c10179475 | Not Available | 669 | Open in IMG/M |
| 3300001450|JGI24006J15134_10051165 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium TMED104 | 1686 | Open in IMG/M |
| 3300001450|JGI24006J15134_10080872 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium TMED104 | 1216 | Open in IMG/M |
| 3300001450|JGI24006J15134_10095985 | Not Available | 1074 | Open in IMG/M |
| 3300001450|JGI24006J15134_10098198 | Not Available | 1057 | Open in IMG/M |
| 3300001450|JGI24006J15134_10131275 | Not Available | 848 | Open in IMG/M |
| 3300001450|JGI24006J15134_10168721 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium TMED104 | 698 | Open in IMG/M |
| 3300001472|JGI24004J15324_10089173 | Not Available | 816 | Open in IMG/M |
| 3300001589|JGI24005J15628_10085238 | Not Available | 1099 | Open in IMG/M |
| 3300004831|Ga0069134_157602 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium TMED104 | 853 | Open in IMG/M |
| 3300005346|Ga0074242_10440218 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium TMED104 | 1234 | Open in IMG/M |
| 3300005512|Ga0074648_1206375 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium TMED104 | 543 | Open in IMG/M |
| 3300006025|Ga0075474_10001404 | All Organisms → cellular organisms → Bacteria | 10012 | Open in IMG/M |
| 3300006026|Ga0075478_10042827 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium TMED104 | 1494 | Open in IMG/M |
| 3300006029|Ga0075466_1054882 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium TMED104 | 1165 | Open in IMG/M |
| 3300006467|Ga0099972_10024311 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium TMED104 | 615 | Open in IMG/M |
| 3300006802|Ga0070749_10138755 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium TMED104 | 1420 | Open in IMG/M |
| 3300006810|Ga0070754_10036108 | All Organisms → cellular organisms → Archaea → Euryarchaeota → unclassified Euryarchaeota → Euryarchaeota archaeon | 2716 | Open in IMG/M |
| 3300006867|Ga0075476_10332936 | Not Available | 527 | Open in IMG/M |
| 3300006916|Ga0070750_10057054 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium TMED104 | 1879 | Open in IMG/M |
| 3300006916|Ga0070750_10074196 | All Organisms → cellular organisms → Archaea → Euryarchaeota → unclassified Euryarchaeota → Euryarchaeota archaeon | 1606 | Open in IMG/M |
| 3300006919|Ga0070746_10072847 | All Organisms → cellular organisms → Archaea → Euryarchaeota → unclassified Euryarchaeota → Euryarchaeota archaeon | 1750 | Open in IMG/M |
| 3300006920|Ga0070748_1174172 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium TMED104 | 794 | Open in IMG/M |
| 3300006921|Ga0098060_1021847 | All Organisms → cellular organisms → Archaea → Euryarchaeota → unclassified Euryarchaeota → Euryarchaeota archaeon | 1984 | Open in IMG/M |
| 3300006990|Ga0098046_1032196 | All Organisms → cellular organisms → Archaea → Euryarchaeota → unclassified Euryarchaeota → Euryarchaeota archaeon | 1278 | Open in IMG/M |
| 3300007276|Ga0070747_1267042 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium TMED104 | 592 | Open in IMG/M |
| 3300007344|Ga0070745_1271237 | Not Available | 610 | Open in IMG/M |
| 3300007540|Ga0099847_1046533 | Not Available | 1371 | Open in IMG/M |
| 3300007540|Ga0099847_1211413 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium TMED104 | 564 | Open in IMG/M |
| 3300007778|Ga0102954_1108845 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium TMED104 | 782 | Open in IMG/M |
| 3300007960|Ga0099850_1393575 | Not Available | 514 | Open in IMG/M |
| 3300009000|Ga0102960_1127498 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium TMED104 | 921 | Open in IMG/M |
| 3300009027|Ga0102957_1345695 | Not Available | 549 | Open in IMG/M |
| 3300009149|Ga0114918_10098068 | All Organisms → cellular organisms → Archaea → Euryarchaeota → unclassified Euryarchaeota → Euryarchaeota archaeon | 1826 | Open in IMG/M |
| 3300009149|Ga0114918_10191343 | Not Available | 1194 | Open in IMG/M |
| 3300009422|Ga0114998_10158888 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium TMED104 | 1086 | Open in IMG/M |
| 3300009428|Ga0114915_1022780 | All Organisms → cellular organisms → Archaea → Euryarchaeota → unclassified Euryarchaeota → Euryarchaeota archaeon | 2219 | Open in IMG/M |
| 3300009526|Ga0115004_10057305 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium TMED104 | 2468 | Open in IMG/M |
| 3300010148|Ga0098043_1067591 | Not Available | 1072 | Open in IMG/M |
| 3300010149|Ga0098049_1281285 | Not Available | 503 | Open in IMG/M |
| 3300010150|Ga0098056_1263233 | Not Available | 571 | Open in IMG/M |
| 3300010153|Ga0098059_1243880 | Not Available | 693 | Open in IMG/M |
| 3300010297|Ga0129345_1099259 | Not Available | 1080 | Open in IMG/M |
| 3300011254|Ga0151675_1016168 | All Organisms → cellular organisms → Bacteria | 1613 | Open in IMG/M |
| 3300011258|Ga0151677_1048441 | All Organisms → cellular organisms → Archaea → Euryarchaeota → unclassified Euryarchaeota → Euryarchaeota archaeon | 1446 | Open in IMG/M |
| 3300013010|Ga0129327_10118799 | All Organisms → cellular organisms → Archaea → Euryarchaeota → unclassified Euryarchaeota → Euryarchaeota archaeon | 1307 | Open in IMG/M |
| 3300017708|Ga0181369_1026575 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium TMED104 | 1382 | Open in IMG/M |
| 3300017709|Ga0181387_1048405 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium TMED104 | 845 | Open in IMG/M |
| 3300017737|Ga0187218_1070256 | Not Available | 856 | Open in IMG/M |
| 3300017757|Ga0181420_1081312 | Not Available | 1010 | Open in IMG/M |
| 3300017759|Ga0181414_1129355 | Not Available | 662 | Open in IMG/M |
| 3300017772|Ga0181430_1105528 | Not Available | 836 | Open in IMG/M |
| 3300017773|Ga0181386_1046377 | Not Available | 1404 | Open in IMG/M |
| 3300017779|Ga0181395_1103566 | Not Available | 911 | Open in IMG/M |
| 3300017781|Ga0181423_1122724 | Not Available | 1010 | Open in IMG/M |
| 3300017824|Ga0181552_10120511 | All Organisms → cellular organisms → Archaea → Euryarchaeota → unclassified Euryarchaeota → Euryarchaeota archaeon | 1430 | Open in IMG/M |
| 3300017824|Ga0181552_10203530 | Not Available | 1021 | Open in IMG/M |
| 3300017991|Ga0180434_10119992 | All Organisms → Viruses → Predicted Viral | 2173 | Open in IMG/M |
| 3300018775|Ga0188848_1035919 | All Organisms → cellular organisms → Bacteria | 518 | Open in IMG/M |
| 3300019751|Ga0194029_1003867 | All Organisms → cellular organisms → Archaea → Euryarchaeota → unclassified Euryarchaeota → Euryarchaeota archaeon | 1974 | Open in IMG/M |
| 3300020169|Ga0206127_1245452 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium TMED104 | 623 | Open in IMG/M |
| 3300020174|Ga0181603_10245591 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium TMED104 | 716 | Open in IMG/M |
| 3300020176|Ga0181556_1112026 | Not Available | 1206 | Open in IMG/M |
| 3300020404|Ga0211659_10375677 | Not Available | 619 | Open in IMG/M |
| 3300021335|Ga0213867_1075697 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium TMED104 | 1240 | Open in IMG/M |
| 3300021389|Ga0213868_10301170 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium TMED104 | 918 | Open in IMG/M |
| 3300021958|Ga0222718_10068329 | Not Available | 2182 | Open in IMG/M |
| 3300021958|Ga0222718_10201259 | Not Available | 1087 | Open in IMG/M |
| 3300021958|Ga0222718_10232781 | Not Available | 987 | Open in IMG/M |
| 3300022158|Ga0196897_1038301 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium TMED104 | 572 | Open in IMG/M |
| 3300022178|Ga0196887_1006531 | Not Available | 4053 | Open in IMG/M |
| 3300022200|Ga0196901_1037808 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium TMED104 | 1854 | Open in IMG/M |
| 3300022928|Ga0255758_10187487 | Not Available | 975 | Open in IMG/M |
| 3300025048|Ga0207905_1004679 | All Organisms → cellular organisms → Archaea → Euryarchaeota → unclassified Euryarchaeota → Euryarchaeota archaeon | 2606 | Open in IMG/M |
| 3300025070|Ga0208667_1001399 | All Organisms → cellular organisms → Bacteria | 8889 | Open in IMG/M |
| 3300025084|Ga0208298_1007662 | Not Available | 2833 | Open in IMG/M |
| 3300025098|Ga0208434_1019433 | All Organisms → cellular organisms → Archaea → Euryarchaeota → unclassified Euryarchaeota → Euryarchaeota archaeon | 1719 | Open in IMG/M |
| 3300025099|Ga0208669_1025483 | All Organisms → cellular organisms → Archaea → Euryarchaeota → unclassified Euryarchaeota → Euryarchaeota archaeon | 1480 | Open in IMG/M |
| 3300025120|Ga0209535_1001559 | All Organisms → cellular organisms → Bacteria | 15548 | Open in IMG/M |
| 3300025120|Ga0209535_1027339 | All Organisms → cellular organisms → Archaea → Euryarchaeota → unclassified Euryarchaeota → Euryarchaeota archaeon | 2756 | Open in IMG/M |
| 3300025120|Ga0209535_1056578 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium TMED104 | 1632 | Open in IMG/M |
| 3300025137|Ga0209336_10046036 | Not Available | 1376 | Open in IMG/M |
| 3300025137|Ga0209336_10068561 | Not Available | 1056 | Open in IMG/M |
| 3300025151|Ga0209645_1001744 | Not Available | 10693 | Open in IMG/M |
| 3300025276|Ga0208814_1006269 | All Organisms → cellular organisms → Archaea → Euryarchaeota → unclassified Euryarchaeota → Euryarchaeota archaeon | 4536 | Open in IMG/M |
| 3300025508|Ga0208148_1011612 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium TMED104 | 2675 | Open in IMG/M |
| 3300025671|Ga0208898_1003088 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 9931 | Open in IMG/M |
| 3300025759|Ga0208899_1179239 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium TMED104 | 694 | Open in IMG/M |
| 3300027687|Ga0209710_1221365 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium TMED104 | 631 | Open in IMG/M |
| (restricted) 3300027861|Ga0233415_10386338 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium TMED104 | 669 | Open in IMG/M |
| 3300028125|Ga0256368_1001212 | All Organisms → cellular organisms → Archaea → Euryarchaeota → unclassified Euryarchaeota → Euryarchaeota archaeon | 3165 | Open in IMG/M |
| 3300028125|Ga0256368_1025377 | Not Available | 1054 | Open in IMG/M |
| 3300031519|Ga0307488_10110688 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium TMED104 | 1985 | Open in IMG/M |
| 3300031519|Ga0307488_10328818 | All Organisms → cellular organisms → Archaea → Euryarchaeota → unclassified Euryarchaeota → Euryarchaeota archaeon | 972 | Open in IMG/M |
| 3300031519|Ga0307488_10339399 | All Organisms → cellular organisms → Bacteria | 951 | Open in IMG/M |
| 3300031605|Ga0302132_10432899 | Not Available | 588 | Open in IMG/M |
| 3300032373|Ga0316204_10462051 | Not Available | 952 | Open in IMG/M |
| 3300034374|Ga0348335_004610 | All Organisms → cellular organisms → Bacteria | 8721 | Open in IMG/M |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Marine | Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine | 29.41% |
| Aqueous | Environmental → Aquatic → Marine → Coastal → Unclassified → Aqueous | 22.55% |
| Seawater | Environmental → Aquatic → Marine → Strait → Unclassified → Seawater | 7.84% |
| Salt Marsh | Environmental → Aquatic → Marine → Intertidal Zone → Salt Marsh → Salt Marsh | 4.90% |
| Marine | Environmental → Aquatic → Marine → Neritic Zone → Unclassified → Marine | 3.92% |
| Sackhole Brine | Environmental → Aquatic → Marine → Coastal → Unclassified → Sackhole Brine | 2.94% |
| Estuarine Water | Environmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine Water | 2.94% |
| Deep Ocean | Environmental → Aquatic → Marine → Oceanic → Unclassified → Deep Ocean | 1.96% |
| Deep Subsurface | Environmental → Aquatic → Marine → Oceanic → Sediment → Deep Subsurface | 1.96% |
| Marine | Environmental → Aquatic → Marine → Coastal → Unclassified → Marine | 1.96% |
| Seawater | Environmental → Aquatic → Marine → Coastal → Unclassified → Seawater | 1.96% |
| Freshwater To Marine Saline Gradient | Environmental → Aquatic → Marine → Coastal → Unclassified → Freshwater To Marine Saline Gradient | 1.96% |
| Sea-Ice Brine | Environmental → Aquatic → Marine → Coastal → Unclassified → Sea-Ice Brine | 1.96% |
| Pond Water | Environmental → Aquatic → Non-Marine Saline And Alkaline → Saline → Unclassified → Pond Water | 1.96% |
| Freshwater Lake | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lake | 0.98% |
| Freshwater | Environmental → Aquatic → Freshwater → River → Unclassified → Freshwater | 0.98% |
| Seawater | Environmental → Aquatic → Marine → Inlet → Unclassified → Seawater | 0.98% |
| Marine | Environmental → Aquatic → Marine → Coastal → Sediment → Marine | 0.98% |
| Microbial Mat | Environmental → Aquatic → Marine → Coastal → Sediment → Microbial Mat | 0.98% |
| Surface Seawater | Environmental → Aquatic → Marine → Coastal → Unclassified → Surface Seawater | 0.98% |
| Marine | Environmental → Aquatic → Marine → Unclassified → Unclassified → Marine | 0.98% |
| Seawater | Environmental → Aquatic → Marine → Pelagic → Unclassified → Seawater | 0.98% |
| Water | Environmental → Aquatic → Non-Marine Saline And Alkaline → Saline → Unclassified → Water | 0.98% |
| Saline Water And Sediment | Environmental → Aquatic → Non-Marine Saline And Alkaline → Saline → Sediment → Saline Water And Sediment | 0.98% |
| Saline Water And Sediment | Environmental → Aquatic → Non-Marine Saline And Alkaline → Saline → Epilimnion → Saline Water And Sediment | 0.98% |
| Hypersaline Lake Sediment | Environmental → Aquatic → Non-Marine Saline And Alkaline → Hypersaline → Sediment → Hypersaline Lake Sediment | 0.98% |
| Visualization |
|---|
| Powered by ApexCharts |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300000101 | Marine microbial communities from Delaware Coast, sample from Delaware MO Early Summer May 2010 | Environmental | Open in IMG/M |
| 3300000115 | Marine microbial communities from Delaware Coast, sample from Delaware MO Summer July 2011 | Environmental | Open in IMG/M |
| 3300000116 | Marine microbial communities from Delaware Coast, sample from Delaware MO Spring March 2010 | Environmental | Open in IMG/M |
| 3300000117 | Marine microbial communities from Delaware Coast, sample from Delaware MO Winter December 2010 | Environmental | Open in IMG/M |
| 3300001450 | Marine viral communities from the Pacific Ocean - LP-53 | Environmental | Open in IMG/M |
| 3300001472 | Marine viral communities from the Pacific Ocean - LP-32 | Environmental | Open in IMG/M |
| 3300001589 | Marine viral communities from the Pacific Ocean - LP-40 | Environmental | Open in IMG/M |
| 3300004831 | Marine surface microbial communities from the North Atlantic Ocean - filtered matter | Environmental | Open in IMG/M |
| 3300005346 | Saline sediment microbial community from Etoliko Lagoon, Greece | Environmental | Open in IMG/M |
| 3300005512 | Saline surface water microbial communities from Etoliko Lagoon, Greece - halocline_water | Environmental | Open in IMG/M |
| 3300006025 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_22_D_<0.8_DNA | Environmental | Open in IMG/M |
| 3300006026 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_29_D_<0.8_DNA | Environmental | Open in IMG/M |
| 3300006029 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_20_<0.8_DNA | Environmental | Open in IMG/M |
| 3300006467 | Coastal sediment microbial communities from Rhode Island, USA: Combined Assembly of Gp0121717, Gp0123912, Gp0123935 | Environmental | Open in IMG/M |
| 3300006802 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_18 | Environmental | Open in IMG/M |
| 3300006810 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Sep_01 | Environmental | Open in IMG/M |
| 3300006867 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_22_N_<0.8_DNA | Environmental | Open in IMG/M |
| 3300006916 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_24 | Environmental | Open in IMG/M |
| 3300006919 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Mar_21 | Environmental | Open in IMG/M |
| 3300006920 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_12 | Environmental | Open in IMG/M |
| 3300006921 | Marine viral communities from the Subarctic Pacific Ocean - 21_ETSP_OMZ_AT15319 metaG | Environmental | Open in IMG/M |
| 3300006990 | Marine viral communities from the Subarctic Pacific Ocean - 11B_ETSP_OMZ_AT15265_CsCl metaG | Environmental | Open in IMG/M |
| 3300007276 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Mar_31 | Environmental | Open in IMG/M |
| 3300007344 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Mar_4 | Environmental | Open in IMG/M |
| 3300007540 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1504_2 Viral MetaG | Environmental | Open in IMG/M |
| 3300007778 | Water microbial communities from South San Francisco under conditions of wetland restoration - Salt Pond MetaG R2A_C_H2O_MG | Environmental | Open in IMG/M |
| 3300007960 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_1D Viral MetaG | Environmental | Open in IMG/M |
| 3300009000 | Salt pond water microbial communities from South San Francisco under conditions of wetland restoration - Salt Pond MetaG SF2_B_H2O_MG | Environmental | Open in IMG/M |
| 3300009027 | Salt pond water microbial communities from South San Francisco under conditions of wetland restoration - Salt Pond MetaG SF2_A_H2O_MG | Environmental | Open in IMG/M |
| 3300009149 | Deep subsurface microbial communities from Baltic Sea to uncover new lineages of life (NeLLi) - Landsort_02402 metaG | Environmental | Open in IMG/M |
| 3300009422 | Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB4_138 | Environmental | Open in IMG/M |
| 3300009428 | Marine viral communities from the Global Malaspina Expedition - Malaspina viral metaG Antarct_55 | Environmental | Open in IMG/M |
| 3300009526 | Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB11_90 | Environmental | Open in IMG/M |
| 3300010148 | Marine viral communities from the Subarctic Pacific Ocean - 9B_ETSP_OMZ_AT15188_CsCl metaG | Environmental | Open in IMG/M |
| 3300010149 | Marine viral communities from the Subarctic Pacific Ocean - 13B_ETSP_OMZ_AT15268_CsCl metaG | Environmental | Open in IMG/M |
| 3300010150 | Marine viral communities from the Subarctic Pacific Ocean - 17B_ETSP_OMZ_AT15314_CsCl metaG | Environmental | Open in IMG/M |
| 3300010153 | Marine viral communities from the Subarctic Pacific Ocean - 20_ETSP_OMZ_AT15318 metaG | Environmental | Open in IMG/M |
| 3300010297 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_20_0.8_DNA | Environmental | Open in IMG/M |
| 3300011254 | Seawater microbial communities from Japan Sea near Toyama Prefecture, Japan - 2015_1, 0.02 | Environmental | Open in IMG/M |
| 3300011258 | Seawater microbial communities from Japan Sea near Toyama Prefecture, Japan - 2015_1, permeate | Environmental | Open in IMG/M |
| 3300013010 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Spr_31_0.8_DNA | Environmental | Open in IMG/M |
| 3300017708 | Marine viral communities from the Subarctic Pacific Ocean - Lowphox_04 viral metaG | Environmental | Open in IMG/M |
| 3300017709 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 10 SPOT_SRF_2010-04-27 | Environmental | Open in IMG/M |
| 3300017737 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 14 SPOT_SRF_2010-08-11 (version 2) | Environmental | Open in IMG/M |
| 3300017757 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 43 SPOT_SRF_2013-05-22 | Environmental | Open in IMG/M |
| 3300017759 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 37 SPOT_SRF_2012-11-28 | Environmental | Open in IMG/M |
| 3300017772 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 53 SPOT_SRF_2014-04-10 | Environmental | Open in IMG/M |
| 3300017773 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 9 SPOT_SRF_2010-03-24 | Environmental | Open in IMG/M |
| 3300017779 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 18 SPOT_SRF_2010-12-16 | Environmental | Open in IMG/M |
| 3300017781 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 46 SPOT_SRF_2013-08-14 | Environmental | Open in IMG/M |
| 3300017824 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 011501BT metaG (megahit assembly) | Environmental | Open in IMG/M |
| 3300017991 | Hypersaline lake sediment archaeal communities from the Salton Sea, California, USA - SS_1_D_2 metaG | Environmental | Open in IMG/M |
| 3300018775 | Metatranscriptome of marine microbial communities from Baltic Sea - GS679_0p8 | Environmental | Open in IMG/M |
| 3300019751 | Freshwater microbial communities from the Broadkill River, Lewes, Delaware, United States ? IW18Oct16_MG | Environmental | Open in IMG/M |
| 3300020169 | Pelagic subsurface seawater microbial communities from Kabeltonne, Helgoland, North Sea - Helgoland_Spring_Bloom_20160419_1 | Environmental | Open in IMG/M |
| 3300020174 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 041409US metaG (spades assembly) | Environmental | Open in IMG/M |
| 3300020176 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 011505AT metaG (spades assembly) | Environmental | Open in IMG/M |
| 3300020404 | Marine microbial communities from Tara Oceans - TARA_B100000900 (ERX555954-ERR598978) | Environmental | Open in IMG/M |
| 3300021335 | Coastal seawater microbial communities near Pivers Island, North Carolina, United States - PICO540 | Environmental | Open in IMG/M |
| 3300021389 | Coastal seawater microbial communities near Pivers Island, North Carolina, United States - PICO127 | Environmental | Open in IMG/M |
| 3300021958 | Estuarine water microbial communities from San Francisco Bay, California, United States - C33_27D | Environmental | Open in IMG/M |
| 3300022158 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Aug_31 (v3) | Environmental | Open in IMG/M |
| 3300022178 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Mar_31 (v3) | Environmental | Open in IMG/M |
| 3300022200 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1504_1 Viral MetaG (v3) | Environmental | Open in IMG/M |
| 3300022928 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 011513CT metaG | Environmental | Open in IMG/M |
| 3300025048 | Marine viral communities from the Subarctic Pacific Ocean - LP-49 (SPAdes) | Environmental | Open in IMG/M |
| 3300025070 | Marine viral communities from the Subarctic Pacific Ocean - 11B_ETSP_OMZ_AT15265_CsCl metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025084 | Marine viral communities from the Subarctic Pacific Ocean - 14B_ETSP_OMZ_AT15311_CsCl metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025098 | Marine viral communities from the Subarctic Pacific Ocean - 13_ETSP_OMZ_AT15268 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025099 | Marine viral communities from the Subarctic Pacific Ocean - 21_ETSP_OMZ_AT15319 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025120 | Marine viral communities from the Pacific Ocean - LP-28 (SPAdes) | Environmental | Open in IMG/M |
| 3300025137 | Marine viral communities from the Pacific Ocean - LP-32 (SPAdes) | Environmental | Open in IMG/M |
| 3300025151 | Marine viral communities from the Pacific Ocean - ETNP_6_30 (SPAdes) | Environmental | Open in IMG/M |
| 3300025276 | Marine viral communities from the Global Malaspina Expedition - Malaspina viral metaG Antarct_55 (SPAdes) | Environmental | Open in IMG/M |
| 3300025508 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_20_<0.8_DNA (SPAdes) | Environmental | Open in IMG/M |
| 3300025671 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Mar_4 (SPAdes) | Environmental | Open in IMG/M |
| 3300025759 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_24 (SPAdes) | Environmental | Open in IMG/M |
| 3300027687 | Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB4_138 (SPAdes) | Environmental | Open in IMG/M |
| 3300027861 (restricted) | Seawater microbial communities from Saanich Inlet, British Columbia, Canada - Na_anoxic_12_MG | Environmental | Open in IMG/M |
| 3300028125 | Sea-ice brine viral communities from Beaufort Sea near Barrow, Alaska, United States - SB | Environmental | Open in IMG/M |
| 3300031519 | Sea-ice brine microbial communities from Beaufort Sea near Barrow, Alaska, United States - SB 0.2 | Environmental | Open in IMG/M |
| 3300031605 | Marine microbial communities from Western Arctic Ocean, Canada - CB9_32.1 | Environmental | Open in IMG/M |
| 3300032373 | Microbial mat bacterial communities from mineral coupon in-situ incubated in ocean water Damariscotta River, Maine, United States - 6-month pyrrhotite 2 | Environmental | Open in IMG/M |
| 3300034374 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Aug_31 (v4) | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
Note: Some of these sequences are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| DelMOSum2010_100463923 | 3300000101 | Marine | MELSNVYKGWFWDDVNQRMYRWHDLELLMKERKLSKNKTT* |
| DelMOSum2011_102002292 | 3300000115 | Marine | MEGLYDYKGWFWDDVNQRFYRWHELKILMQERELKKQKNARI* |
| DelMOSpr2010_101673423 | 3300000116 | Marine | MXLSNVYKGWFWDDVNQRMYRWHDXELLMKERKLSKXKTT* |
| DelMOWin2010_101794752 | 3300000117 | Marine | MEGLYDYKGWFWDDINKRFYRWHELKILMQERELKKQKENAR* |
| JGI24006J15134_100511652 | 3300001450 | Marine | MEALNDYKGWFWDDVNQRMYRWHDLELLMKERKLTKQKENAREK* |
| JGI24006J15134_100808722 | 3300001450 | Marine | MELSNVYKGWFWDDVNQRMYRWHDLELLMKERELSKNKTT* |
| JGI24006J15134_100959853 | 3300001450 | Marine | MELSNVYKGWFWDNVNQRMYRWHDLELLMKERKLSKNKTT* |
| JGI24006J15134_100981981 | 3300001450 | Marine | VYKGWFWDDVNQRMYRWHDLELLMKERKLSKNKKT* |
| JGI24006J15134_101312752 | 3300001450 | Marine | MELSNVYKGWFWDDVNQRMYRWHDLELLMKERKLSKNKNGK* |
| JGI24006J15134_101687212 | 3300001450 | Marine | MEALNDYKGWFWDDVNQRMYRWHDLELLMKERKLTKQKENEEHK* |
| JGI24004J15324_100891731 | 3300001472 | Marine | SNVYKGWFWDDVNQRMYRWHDLELLMKERKLSKNKTT* |
| JGI24005J15628_100852382 | 3300001589 | Marine | MELSNVYKGWFWDXVNQRMYRWHDLELLMKERKLSKNKTT* |
| Ga0069134_1576022 | 3300004831 | Surface Seawater | MKELYDNKGWFWDDVNQKMYRWHDLQLLMQERELKKQKENGRQK* |
| Ga0074242_104402183 | 3300005346 | Saline Water And Sediment | MEGLYDYKGWFWDDVNQRFYRWHELKILMQERELKKQKENAR* |
| Ga0074648_12063752 | 3300005512 | Saline Water And Sediment | MEGLYDYKGWFWDDVNKRFYRWHELKILMQERELKKQKENAR* |
| Ga0075474_100014046 | 3300006025 | Aqueous | MEQSQDYKGWFWDDVNQKMYRWHDLQLLMQERELKKQKENGRQK* |
| Ga0075478_100428273 | 3300006026 | Aqueous | MEGLYDYKGWFWDDVNQRFYRWHELKILMRERELKKQKNEESRNSK* |
| Ga0075466_10548822 | 3300006029 | Aqueous | MEGLYDYKGWFWDDVNQRFYRWHELKILMRERELKKQKNEEFRNSK* |
| Ga0099972_100243112 | 3300006467 | Marine | MEGLYDYKGCFWDDVNQRFYRWHELKILMQERELKKQKNEESRNSK* |
| Ga0070749_101387552 | 3300006802 | Aqueous | MEVLNDYKGWFWDDVNQRMYRWHDLELLMKERKLKKQK* |
| Ga0070754_100361081 | 3300006810 | Aqueous | INHMEGLYDYKGWFWDDVNQRFYRWHELKILMQERELKKQKENAR* |
| Ga0075476_103329362 | 3300006867 | Aqueous | MEGLYDYKGWFWDDVNQRFYRWHELKILMQERELKKQKENAK* |
| Ga0070750_100570544 | 3300006916 | Aqueous | MEVLNDYKGWFWDDVNQRMYRWHDLELLMKERKLTKQKENEEHK* |
| Ga0070750_100741962 | 3300006916 | Aqueous | MEGLYDYKGWFWDDVNKRFYRWHELKILIQERELKKQKENAR* |
| Ga0070746_100728473 | 3300006919 | Aqueous | YKGWFWDDVNQRFYRWHELKILMQERELKKQKENGRQK* |
| Ga0070748_11741722 | 3300006920 | Aqueous | MEGLYDYKGWFWDDVNQKMYRWYDLQLLMQERELKKQKENGR* |
| Ga0098060_10218471 | 3300006921 | Marine | DYKGWFWDDVNQKMYRWHDLQLLMQERELKKQKENAK* |
| Ga0098046_10321961 | 3300006990 | Marine | MEQSQDYKGWFWDDVNQKMYRWHDLQLLMQERELKKQKENARQK* |
| Ga0070747_12670422 | 3300007276 | Aqueous | MEGLYDYKGWFWDDVNQRFYRWHELKILMQERELKKQKNEESRNSK* |
| Ga0070745_12712372 | 3300007344 | Aqueous | MEGLYDYKGWFWDDVNQRFYRWHELKILMQEREIKKQKENAR* |
| Ga0099847_10465331 | 3300007540 | Aqueous | KGWFWDDVNKRFYRWHELKILMQERELKKQKENAR* |
| Ga0099847_12114132 | 3300007540 | Aqueous | MELSNVYKGWFWDDVNQRMYRWHDLELLMKERKLSKNK |
| Ga0102954_11088451 | 3300007778 | Water | MEGLYDYKGWFWDDVNQRFYRWHELKVLMQERELKKQKENAR* |
| Ga0099850_13935751 | 3300007960 | Aqueous | DYKGWFWDDVNKRFYRWHELKILMQERELKKQKENAR* |
| Ga0102960_11274982 | 3300009000 | Pond Water | MEGLYDYKGWFWDDVNQRFYRWHELKILMQEREPKKQKENAR* |
| Ga0102957_13456952 | 3300009027 | Pond Water | MEVLYDYKCWFWDDVNKRLYRWHELKILMQERELKKQKENAR* |
| Ga0114918_100980681 | 3300009149 | Deep Subsurface | INHMEGLYDYKGWFWDDVNQRFYRWHELKILMRERELKKQKENAR* |
| Ga0114918_101913433 | 3300009149 | Deep Subsurface | MEGLYDYKGWFWDDVNKRMYRWHELELLMKERELKKEKENEEHK* |
| Ga0114998_101588883 | 3300009422 | Marine | MELSNVYKGWFWDDENQRMYRWHDLELLMKERKLSKNKTT* |
| Ga0114915_10227803 | 3300009428 | Deep Ocean | MELSNVYKGWFWDDVNKRMYRWHDLELLMKERKLSKNKNGK* |
| Ga0115004_100573052 | 3300009526 | Marine | MELFNVYKGWFWDDVNQRMYRWHDLELLMKERKLSKNKTT* |
| Ga0098043_10675912 | 3300010148 | Marine | MKELYDNKGWFWDDVNQKMYRWHDLELLLRERELKKQKENGRQK* |
| Ga0098049_12812851 | 3300010149 | Marine | MEQSQDYKGWFWDDVNQKMYRWHDLQLLMRERELKKQKENGRQK* |
| Ga0098056_12632332 | 3300010150 | Marine | YKGWYWDDVNKQMYRWHDLRLLMQERELKKQKENGKEK* |
| Ga0098059_12438802 | 3300010153 | Marine | MEQSQDYKGWFWDDVNQKMYRWHDLQLLMQERELKKQKENAK* |
| Ga0129345_10992591 | 3300010297 | Freshwater To Marine Saline Gradient | LYDYKGWFWDDVNKRFYRWHELKILMQERELKKQKENAR* |
| Ga0151675_10161684 | 3300011254 | Marine | MEQSKDYKGWHWDHVNKQMYRWHDLQLLMQERELKKQKENGRQK* |
| Ga0151677_10484413 | 3300011258 | Marine | KGWHWDHVNKQMYRWHDLQLLMQERELKKQKENGRQK* |
| Ga0129327_101187993 | 3300013010 | Freshwater To Marine Saline Gradient | MEGLYDYKGWFWDDVNQRFYRWHELKILMRERELKKQKNEESTNSK* |
| Ga0181369_10265752 | 3300017708 | Marine | MKELYDNKGWFWDDVNQKMYRWHDLELLLRERELKKQKENGRQK |
| Ga0181387_10484053 | 3300017709 | Seawater | MKELYDNKGWFWDDVNQKMYRWHDLQLLMQERELKKQKENARQK |
| Ga0187218_10702561 | 3300017737 | Seawater | KQMKELYDNKGWFWDDVNQKMYRWHDLQLLMQERELKKQKENARQK |
| Ga0181420_10813122 | 3300017757 | Seawater | KQMEQSQDYKGWFWDDVNQKMYRWHDLRLLMQERELKKQKENGRQK |
| Ga0181414_11293552 | 3300017759 | Seawater | MEQSQDYKGRFWDDVNQKMYRWHDLQLLMQERELKKQKENAK |
| Ga0181430_11055282 | 3300017772 | Seawater | EQSQDYKGWFWDDVNQKMYRWHDLQLLMQERELKKQKENGRQK |
| Ga0181386_10463772 | 3300017773 | Seawater | MEELYDNKGWFWDDVNQKMYRWHDLQLLMQERELKKQKENARQK |
| Ga0181395_11035662 | 3300017779 | Seawater | MKELYDNKGWFWDDVNQKMYRWHDLQLLMQERELKKQKENAK |
| Ga0181423_11227242 | 3300017781 | Seawater | MEQSKDYKGWFWDDVNQKMYRWHDLQLLMQERELKKQKENAK |
| Ga0181552_101205111 | 3300017824 | Salt Marsh | MEGLYDYKGWFWDDVNQRFYRWHELKILMRERELKKQKNEESRNSK |
| Ga0181552_102035302 | 3300017824 | Salt Marsh | MEGLYDYKGWFWDDVNKRFYRWHELKILMQERELKKQKENAR |
| Ga0180434_101199922 | 3300017991 | Hypersaline Lake Sediment | MEGLYDYKGWFWDDVNQRFYRWHELKILMRERELKKQKENAR |
| Ga0188848_10359191 | 3300018775 | Freshwater Lake | MEGLYDYKGWFWDDVNQRMYRWHELEILMKERKIKKEREDANKL |
| Ga0194029_10038672 | 3300019751 | Freshwater | MEQSQDYKGWFWDDVNQKMYRWHDLQLLMQERELKKQKENGRQK |
| Ga0206127_12454521 | 3300020169 | Seawater | MKELYDNKGWFWDDVNQKMYRWHDLQLLMQERELKKQKENGRQK |
| Ga0181603_102455913 | 3300020174 | Salt Marsh | MEGLYDYKGWFWDDVNKRFYRWHELKILIQERELKKQKENAR |
| Ga0181556_11120262 | 3300020176 | Salt Marsh | NHMEGLYDYKGWFWDDVNKRFYRWHELKILMQERELKKQKENAR |
| Ga0211659_103756772 | 3300020404 | Marine | MEQSQDYKGWFWDDVNQKMYRWHDLRLLMQERELKKQKENGRQK |
| Ga0213867_10756973 | 3300021335 | Seawater | MEGLYDYKGCFWDDVNQRFYRWHELKILMQERELKKQKNEESRNSK |
| Ga0213868_103011702 | 3300021389 | Seawater | MEGLYDYKGWFWDDINKRFYRWHELKILMRERELKKQKENAR |
| Ga0222718_100683292 | 3300021958 | Estuarine Water | MEELYDNKGWFWDDVNQKMYRWYDLQLLMQERELKKQKENARQK |
| Ga0222718_102012591 | 3300021958 | Estuarine Water | MEGLYDYKGWFWDDVNQRFYRWHELKVLMQERELKKQKENAR |
| Ga0222718_102327811 | 3300021958 | Estuarine Water | INHMEGLYDYKGWFWDDVNQRFYRWHELKILMQERELKKQKENAR |
| Ga0196897_10383013 | 3300022158 | Aqueous | MEGLYDYKGWFWDDVNQRFYRWHELKILMQERELKKQNNEESR |
| Ga0196887_10065314 | 3300022178 | Aqueous | MEVLNDYKGWFWDDVNQRMYRWHDLELLMKERKLKKQK |
| Ga0196901_10378083 | 3300022200 | Aqueous | MEGLYDYKGWFWDDVNKRFYRWHELKILMQERELKKQKENGRQK |
| Ga0255758_101874872 | 3300022928 | Salt Marsh | GLYDYKGWFWDDVNKRFYRWHELKILMQERELKKQKENAR |
| Ga0207905_10046793 | 3300025048 | Marine | MELSNVYKGWFWDDVNQRMYRWHDLELLMKERKLSKNKTT |
| Ga0208667_10013992 | 3300025070 | Marine | MEQSQDYKGWFWDDVNQKMYRWHDLQLLMQERELKKQKENARQK |
| Ga0208298_10076623 | 3300025084 | Marine | MEQSQDYKGWFWDDVNQKMYRWHDLQLLMRERELKKQKENGRQK |
| Ga0208434_10194333 | 3300025098 | Marine | IKQMEQSQDYKGWFWDDVNQKMYRWHDLQLLMQERELKKQKENGRQK |
| Ga0208669_10254833 | 3300025099 | Marine | MEQSQDYKGWFWDDVNQKMYRWHDLQLLMQERELKKQKENAK |
| Ga0209535_10015597 | 3300025120 | Marine | MEALNDYKGWFWDDVNQRMYRWHDLELLMKERKLTKQKENAREK |
| Ga0209535_10273392 | 3300025120 | Marine | MEALNDYKGWFWDDVNQRMYRWHDLELLMKERKLTKQKENEEHK |
| Ga0209535_10565782 | 3300025120 | Marine | MELSNVYKGWFWDDVNQRMYRWHDLELLMKERELSKNKTT |
| Ga0209336_100460361 | 3300025137 | Marine | MELSNVYKGWFWDDVNQRMYRWHDLELLMKERKLSKNKNGK |
| Ga0209336_100685612 | 3300025137 | Marine | NVYKGWFWDDVNQRMYRWHDLELLMKERKLSKNKKT |
| Ga0209645_10017446 | 3300025151 | Marine | MEQSKDYKGWYWDDVNKQMYRWHDLQLLMQEREIKKQKENGRQK |
| Ga0208814_10062694 | 3300025276 | Deep Ocean | MELSNVYKGWFWDDVNKRMYRWHDLELLMKERELSKNKTT |
| Ga0208148_10116124 | 3300025508 | Aqueous | MEGLYDYKGWFWDDVNQRFYRWHELKILMRERELKKQKNEEFRNSK |
| Ga0208898_10030883 | 3300025671 | Aqueous | MEGLYDYKGWFWDDVNQRFYRWHELKILMQERELKKQKENAR |
| Ga0208899_10253912 | 3300025759 | Aqueous | MEGLYDYKGWFWDDVNQRFYRWHELKILMQERELKKQNNEESRNSK |
| Ga0208899_11792393 | 3300025759 | Aqueous | MELSNVYKGWFWDDVNQRMYRWHDLELLMKERKLSKN |
| Ga0209710_12213653 | 3300027687 | Marine | MELSNVYKGWFWDDVNQRMYRWHDLELLMKERKLS |
| (restricted) Ga0233415_103863382 | 3300027861 | Seawater | MEQSKDYKGWHWDHVNKQMYRWHDLQLLMQERELKKQKENGRQK |
| Ga0256368_10012124 | 3300028125 | Sea-Ice Brine | MEGLYDYKGWFWDDVNQRMYRWHDLEILMKEREIKKQQQKNAEQ |
| Ga0256368_10253771 | 3300028125 | Sea-Ice Brine | MELSNVYKGWFWDDVNQRMYRWHDLELLMKERKLSKNKKT |
| Ga0307488_101106883 | 3300031519 | Sackhole Brine | MEALNDYKGWFWDDVNQRMYRWHDLELLMKERKLTKQKENEEHKSK |
| Ga0307488_103288181 | 3300031519 | Sackhole Brine | EALNDYKGWFWDDVNQRMYRWHDLELLMKERKLTKQKENEEHK |
| Ga0307488_103393992 | 3300031519 | Sackhole Brine | MEGLYDYKGWFWDDVNQRMYRWHDLEILMKERKIKKEREDANKLKNEGSDV |
| Ga0302132_104328992 | 3300031605 | Marine | MELSNVYKGWFWDNVNQRMYRWHDLELLMKERKLSKNKTT |
| Ga0316204_104620512 | 3300032373 | Microbial Mat | MEVLNDYKGWFWDDVNQRMYRWHDLELLMKERKLTKQKENEEHK |
| Ga0348335_004610_8607_8720 | 3300034374 | Aqueous | DYKGWFWDDVNQRFYRWHELKILMQERELKKQKENAR |
| ⦗Top⦘ |