| Basic Information | |
|---|---|
| Family ID | F101164 |
| Family Type | Metagenome |
| Number of Sequences | 102 |
| Average Sequence Length | 46 residues |
| Representative Sequence | LIEFKDLQSDDPNIQGELDMLKELNPIFLRIEELPDDYEMDIDHDH |
| Number of Associated Samples | 67 |
| Number of Associated Scaffolds | 102 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | No |
| Most common taxonomic group | Unclassified |
| % of genes with valid RBS motifs | 79.41 % |
| % of genes near scaffold ends (potentially truncated) | 16.67 % |
| % of genes from short scaffolds (< 2000 bps) | 82.35 % |
| Associated GOLD sequencing projects | 61 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.38 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Unclassified (50.980 % of family members) |
| NCBI Taxonomy ID | N/A |
| Taxonomy | N/A |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lake (24.510 % of family members) |
| Environment Ontology (ENVO) | Unclassified (80.392 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Water (non-saline) (80.392 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 28.38% β-sheet: 0.00% Coil/Unstructured: 71.62% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.38 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 102 Family Scaffolds |
|---|---|---|
| PF07883 | Cupin_2 | 19.61 |
| PF00596 | Aldolase_II | 5.88 |
| PF01327 | Pep_deformylase | 3.92 |
| PF00268 | Ribonuc_red_sm | 1.96 |
| PF01844 | HNH | 1.96 |
| PF07460 | NUMOD3 | 0.98 |
| PF10902 | WYL_2 | 0.98 |
| PF00149 | Metallophos | 0.98 |
| PF13640 | 2OG-FeII_Oxy_3 | 0.98 |
| PF02796 | HTH_7 | 0.98 |
| PF00085 | Thioredoxin | 0.98 |
| PF01467 | CTP_transf_like | 0.98 |
| COG ID | Name | Functional Category | % Frequency in 102 Family Scaffolds |
|---|---|---|---|
| COG0242 | Peptide deformylase | Translation, ribosomal structure and biogenesis [J] | 3.92 |
| COG0208 | Ribonucleotide reductase beta subunit, ferritin-like domain | Nucleotide transport and metabolism [F] | 1.96 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| Unclassified | root | N/A | 50.98 % |
| All Organisms | root | All Organisms | 49.02 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300003277|JGI25908J49247_10170230 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiaceae → Polynucleobacter → Polynucleobacter antarcticus | 504 | Open in IMG/M |
| 3300005580|Ga0049083_10100053 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiaceae → Polynucleobacter → Polynucleobacter antarcticus | 1005 | Open in IMG/M |
| 3300005581|Ga0049081_10070418 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1315 | Open in IMG/M |
| 3300005581|Ga0049081_10172102 | Not Available | 785 | Open in IMG/M |
| 3300005581|Ga0049081_10184854 | Not Available | 752 | Open in IMG/M |
| 3300005581|Ga0049081_10287845 | Not Available | 568 | Open in IMG/M |
| 3300005581|Ga0049081_10335059 | Not Available | 515 | Open in IMG/M |
| 3300005582|Ga0049080_10070515 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1198 | Open in IMG/M |
| 3300006484|Ga0070744_10014843 | All Organisms → Viruses → Predicted Viral | 2310 | Open in IMG/M |
| 3300006484|Ga0070744_10152432 | Not Available | 663 | Open in IMG/M |
| 3300007559|Ga0102828_1038611 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1088 | Open in IMG/M |
| 3300007603|Ga0102921_1200548 | Not Available | 717 | Open in IMG/M |
| 3300007974|Ga0105747_1245512 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales | 598 | Open in IMG/M |
| 3300008107|Ga0114340_1001283 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 15653 | Open in IMG/M |
| 3300008113|Ga0114346_1008564 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 7166 | Open in IMG/M |
| 3300008448|Ga0114876_1014312 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 4347 | Open in IMG/M |
| 3300008459|Ga0114865_1189165 | Not Available | 584 | Open in IMG/M |
| 3300008996|Ga0102831_1207200 | Not Available | 648 | Open in IMG/M |
| 3300008996|Ga0102831_1233646 | Not Available | 607 | Open in IMG/M |
| 3300009051|Ga0102864_1219935 | Not Available | 516 | Open in IMG/M |
| 3300009068|Ga0114973_10653521 | Not Available | 537 | Open in IMG/M |
| 3300009152|Ga0114980_10028808 | All Organisms → Viruses → Predicted Viral | 3439 | Open in IMG/M |
| 3300009152|Ga0114980_10406301 | Not Available | 781 | Open in IMG/M |
| 3300009155|Ga0114968_10097918 | All Organisms → Viruses → Predicted Viral | 1797 | Open in IMG/M |
| 3300009158|Ga0114977_10302902 | Not Available | 910 | Open in IMG/M |
| 3300009159|Ga0114978_10002057 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 16735 | Open in IMG/M |
| 3300009159|Ga0114978_10006137 | Not Available | 9548 | Open in IMG/M |
| 3300009159|Ga0114978_10169879 | Not Available | 1393 | Open in IMG/M |
| 3300009159|Ga0114978_10187298 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1314 | Open in IMG/M |
| 3300009161|Ga0114966_10317997 | Not Available | 936 | Open in IMG/M |
| 3300009163|Ga0114970_10409280 | Not Available | 752 | Open in IMG/M |
| 3300009163|Ga0114970_10555554 | Not Available | 621 | Open in IMG/M |
| 3300009164|Ga0114975_10298253 | Not Available | 893 | Open in IMG/M |
| 3300009180|Ga0114979_10197964 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1218 | Open in IMG/M |
| 3300011010|Ga0139557_1071090 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiaceae → Polynucleobacter → Polynucleobacter antarcticus | 582 | Open in IMG/M |
| 3300011010|Ga0139557_1085060 | Not Available | 525 | Open in IMG/M |
| 3300011268|Ga0151620_1263428 | Not Available | 510 | Open in IMG/M |
| 3300012012|Ga0153799_1041660 | Not Available | 859 | Open in IMG/M |
| 3300012017|Ga0153801_1011182 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1630 | Open in IMG/M |
| 3300012666|Ga0157498_1021739 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 999 | Open in IMG/M |
| 3300013004|Ga0164293_10091213 | Not Available | 2358 | Open in IMG/M |
| 3300013005|Ga0164292_10532430 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 766 | Open in IMG/M |
| 3300013372|Ga0177922_10149704 | Not Available | 771 | Open in IMG/M |
| 3300013372|Ga0177922_10430769 | Not Available | 586 | Open in IMG/M |
| 3300013372|Ga0177922_10780697 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 786 | Open in IMG/M |
| 3300017701|Ga0181364_1008676 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales | 1727 | Open in IMG/M |
| 3300017723|Ga0181362_1004044 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 3123 | Open in IMG/M |
| 3300017736|Ga0181365_1068662 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiaceae → Polynucleobacter → Polynucleobacter antarcticus | 875 | Open in IMG/M |
| 3300017761|Ga0181356_1102837 | Not Available | 928 | Open in IMG/M |
| 3300017761|Ga0181356_1104631 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales | 918 | Open in IMG/M |
| 3300017774|Ga0181358_1038466 | Not Available | 1846 | Open in IMG/M |
| 3300017774|Ga0181358_1179765 | Not Available | 704 | Open in IMG/M |
| 3300017778|Ga0181349_1002034 | Not Available | 8716 | Open in IMG/M |
| 3300017778|Ga0181349_1067297 | Not Available | 1379 | Open in IMG/M |
| 3300017784|Ga0181348_1058036 | All Organisms → Viruses → Predicted Viral | 1572 | Open in IMG/M |
| 3300017784|Ga0181348_1121033 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales | 1005 | Open in IMG/M |
| 3300017785|Ga0181355_1086996 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales | 1301 | Open in IMG/M |
| 3300019784|Ga0181359_1003326 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales | 4902 | Open in IMG/M |
| 3300019784|Ga0181359_1033414 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales | 1990 | Open in IMG/M |
| 3300019784|Ga0181359_1092667 | Not Available | 1118 | Open in IMG/M |
| 3300019784|Ga0181359_1096148 | Not Available | 1092 | Open in IMG/M |
| 3300019784|Ga0181359_1161366 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 759 | Open in IMG/M |
| 3300020151|Ga0211736_10113951 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Methylococcales → unclassified Methylococcales → Methylococcales bacterium | 1451 | Open in IMG/M |
| 3300020151|Ga0211736_10212931 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 715 | Open in IMG/M |
| 3300020159|Ga0211734_10006362 | Not Available | 1167 | Open in IMG/M |
| 3300020159|Ga0211734_10524707 | All Organisms → cellular organisms → Bacteria | 2440 | Open in IMG/M |
| 3300020161|Ga0211726_10553769 | Not Available | 1308 | Open in IMG/M |
| 3300020161|Ga0211726_10883738 | All Organisms → Viruses → Predicted Viral | 1698 | Open in IMG/M |
| 3300020161|Ga0211726_10997690 | Not Available | 829 | Open in IMG/M |
| 3300020161|Ga0211726_11014089 | Not Available | 1687 | Open in IMG/M |
| 3300020162|Ga0211735_10727837 | Not Available | 642 | Open in IMG/M |
| 3300020172|Ga0211729_10234126 | Not Available | 908 | Open in IMG/M |
| 3300020172|Ga0211729_10861339 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 1353 | Open in IMG/M |
| 3300020205|Ga0211731_10877347 | Not Available | 1213 | Open in IMG/M |
| 3300022190|Ga0181354_1210460 | Not Available | 574 | Open in IMG/M |
| 3300022190|Ga0181354_1212583 | Not Available | 570 | Open in IMG/M |
| 3300022407|Ga0181351_1139461 | Not Available | 886 | Open in IMG/M |
| 3300022407|Ga0181351_1255874 | Not Available | 542 | Open in IMG/M |
| 3300022407|Ga0181351_1272671 | Not Available | 513 | Open in IMG/M |
| 3300023174|Ga0214921_10002750 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 28033 | Open in IMG/M |
| 3300023174|Ga0214921_10013338 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 9669 | Open in IMG/M |
| 3300023179|Ga0214923_10221234 | Not Available | 1095 | Open in IMG/M |
| 3300024346|Ga0244775_11296649 | Not Available | 564 | Open in IMG/M |
| 3300027608|Ga0208974_1101922 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 765 | Open in IMG/M |
| 3300027631|Ga0208133_1023114 | Not Available | 1595 | Open in IMG/M |
| 3300027759|Ga0209296_1160881 | Not Available | 999 | Open in IMG/M |
| 3300027763|Ga0209088_10052995 | All Organisms → Viruses → Predicted Viral | 1965 | Open in IMG/M |
| 3300027782|Ga0209500_10014806 | All Organisms → Viruses → Predicted Viral | 4678 | Open in IMG/M |
| 3300027782|Ga0209500_10244799 | Not Available | 786 | Open in IMG/M |
| 3300027798|Ga0209353_10138942 | Not Available | 1087 | Open in IMG/M |
| 3300027798|Ga0209353_10398327 | Not Available | 565 | Open in IMG/M |
| 3300027963|Ga0209400_1065928 | All Organisms → Viruses → Predicted Viral | 1801 | Open in IMG/M |
| 3300028394|Ga0304730_1118880 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1112 | Open in IMG/M |
| 3300031787|Ga0315900_10101638 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2797 | Open in IMG/M |
| 3300031857|Ga0315909_10613297 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 724 | Open in IMG/M |
| 3300033996|Ga0334979_0000284 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 39988 | Open in IMG/M |
| 3300033996|Ga0334979_0034415 | All Organisms → Viruses → Predicted Viral | 3354 | Open in IMG/M |
| 3300034068|Ga0334990_0132496 | All Organisms → Viruses → Predicted Viral | 1357 | Open in IMG/M |
| 3300034082|Ga0335020_0403875 | Not Available | 658 | Open in IMG/M |
| 3300034104|Ga0335031_0194091 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1379 | Open in IMG/M |
| 3300034117|Ga0335033_0164659 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1223 | Open in IMG/M |
| 3300034119|Ga0335054_0324394 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 898 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Freshwater Lake | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lake | 24.51% |
| Freshwater Lake | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake | 19.61% |
| Freshwater | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater | 16.67% |
| Freshwater | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater | 11.76% |
| Freshwater Lentic | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lentic | 7.84% |
| Estuarine | Environmental → Aquatic → Marine → Intertidal Zone → Estuary → Estuarine | 4.90% |
| Estuarine | Environmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine | 3.92% |
| Freshwater, Plankton | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater, Plankton | 1.96% |
| Freshwater Lake | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake | 1.96% |
| Freshwater | Environmental → Aquatic → Freshwater → Unclassified → Unclassified → Freshwater | 1.96% |
| Freshwater | Environmental → Aquatic → Freshwater → Ice → Unclassified → Freshwater | 1.96% |
| Freshwater, Surface Ice | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater, Surface Ice | 0.98% |
| Freshwater | Environmental → Aquatic → Freshwater → Lotic → Unclassified → Freshwater | 0.98% |
| Estuary Water | Environmental → Aquatic → Marine → Coastal → Unclassified → Estuary Water | 0.98% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300003277 | Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM15.SD | Environmental | Open in IMG/M |
| 3300005580 | Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG MI27MSRF | Environmental | Open in IMG/M |
| 3300005581 | Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG ER78MSRF | Environmental | Open in IMG/M |
| 3300005582 | Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG ER15MSRF | Environmental | Open in IMG/M |
| 3300006484 | Estuarine microbial communities from the Columbia River estuary, USA - metaG S.535 | Environmental | Open in IMG/M |
| 3300007559 | Estuarine microbial communities from the Columbia River estuary - Freshwater metaG S.541 | Environmental | Open in IMG/M |
| 3300007603 | Estuarine microbial communities from the Columbia River estuary - metaG 1568-02 | Environmental | Open in IMG/M |
| 3300007974 | Coastal water column microbial communities from Columbia River Estuary, Oregon, USA - CMOP_DNA_1460C_0.2um | Environmental | Open in IMG/M |
| 3300008107 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE2, Sample E2014-0046-3-NA | Environmental | Open in IMG/M |
| 3300008113 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE4, Sample E2014-0050-3-NA | Environmental | Open in IMG/M |
| 3300008448 | Freshwater viral communities during cyanobacterial harmful algal blooms (CHABs) in Western Lake Erie, USA - August 4, 2014 all contigs | Environmental | Open in IMG/M |
| 3300008459 | Freshwater viral communities during cyanobacterial harmful algal blooms (CHABs) in Western Lake Erie, USA - July 8, 2014 all contigs | Environmental | Open in IMG/M |
| 3300008996 | Estuarine microbial communities from the Columbia River estuary - Freshwater metaG S.747 | Environmental | Open in IMG/M |
| 3300009051 | Estuarine microbial communities from the Columbia River estuary - metaG 1449B-02 | Environmental | Open in IMG/M |
| 3300009068 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_140807_MF_MetaG | Environmental | Open in IMG/M |
| 3300009152 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140806_EF_MetaG | Environmental | Open in IMG/M |
| 3300009155 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130807_EF_MetaG | Environmental | Open in IMG/M |
| 3300009158 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130805_MF_MetaG | Environmental | Open in IMG/M |
| 3300009159 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140212_EF_MetaG | Environmental | Open in IMG/M |
| 3300009161 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130207_XF_MetaG | Environmental | Open in IMG/M |
| 3300009163 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_140205_XF_MetaG | Environmental | Open in IMG/M |
| 3300009164 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130626_EF_MetaG | Environmental | Open in IMG/M |
| 3300009180 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140625_EF_MetaG | Environmental | Open in IMG/M |
| 3300011010 | Freshwater microbial communities from Western Basin Lake Erie, Ontario, Canada - Station 970 - Surface Ice | Environmental | Open in IMG/M |
| 3300011268 | Sub-surface freshwater microbial communities from San Francisco Estuary Delta, California, USA . Combined Assembly of Gp0173482, Gp0175554, Gp0175555 | Environmental | Open in IMG/M |
| 3300012012 | Freshwater microbial communities from Eastern Basin Lake Erie, Ontario, Canada - Station 879 - Top - Depth 1m | Environmental | Open in IMG/M |
| 3300012017 | Freshwater microbial communities from Central Basin Lake Erie, Ontario, Canada - Station 1208 - Top - Depth 1m | Environmental | Open in IMG/M |
| 3300012666 | Freshwater microbial communities from Central Basin Lake Erie, Ontario, Canada - Station 1208 - Surface Ice version 2 | Environmental | Open in IMG/M |
| 3300013004 | Eutrophic lake water microbial communities from Lake Mendota, Wisconsin, USA - GEODES118 metaG | Environmental | Open in IMG/M |
| 3300013005 | Eutrophic lake water microbial communities from Lake Mendota, Wisconsin, USA - GEODES117 metaG | Environmental | Open in IMG/M |
| 3300013372 | Freshwater microbial communities from Lake Erie, Ontario, Canada. Combined Assembly of 10 SPs | Environmental | Open in IMG/M |
| 3300017701 | Freshwater viral communities from Lake Michigan, USA - Fa13.ND.MM110.S.N | Environmental | Open in IMG/M |
| 3300017723 | Freshwater viral communities from Lake Michigan, USA - Su13.ND.MM110.S.N | Environmental | Open in IMG/M |
| 3300017736 | Freshwater viral communities from Lake Michigan, USA - Fa13.ND.MM110.D.N | Environmental | Open in IMG/M |
| 3300017761 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM110.S.N | Environmental | Open in IMG/M |
| 3300017774 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM110.S.D | Environmental | Open in IMG/M |
| 3300017778 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM110.S.D | Environmental | Open in IMG/M |
| 3300017784 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM110.D.N | Environmental | Open in IMG/M |
| 3300017785 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM15.D.N | Environmental | Open in IMG/M |
| 3300019784 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM15.S.D | Environmental | Open in IMG/M |
| 3300020151 | Freshwater lake microbial communities from Lake Erken, Sweden - P4710_202 megahit1 | Environmental | Open in IMG/M |
| 3300020159 | Freshwater lake microbial communities from Lake Erken, Sweden - P4710_108 megahit1 | Environmental | Open in IMG/M |
| 3300020161 | Freshwater lake microbial communities from Lake Erken, Sweden - P4710_101 megahit1 | Environmental | Open in IMG/M |
| 3300020162 | Freshwater lake microbial communities from Lake Erken, Sweden - P4710_201 megahit1 | Environmental | Open in IMG/M |
| 3300020172 | Freshwater lake microbial communities from Lake Erken, Sweden - P4710_102 megahit1 | Environmental | Open in IMG/M |
| 3300020205 | Freshwater lake microbial communities from Lake Erken, Sweden - P4710_103 megahit1 | Environmental | Open in IMG/M |
| 3300022190 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM15.S.N | Environmental | Open in IMG/M |
| 3300022407 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM15.S.D | Environmental | Open in IMG/M |
| 3300023174 | Freshwater microbial communities from Lake Lanier, Atlanta, Georgia, United States - LL-1505 | Environmental | Open in IMG/M |
| 3300023179 | Freshwater microbial communities from Lake Lanier, Atlanta, Georgia, United States - LL-1510 | Environmental | Open in IMG/M |
| 3300024346 | Whole water sample coassembly | Environmental | Open in IMG/M |
| 3300027608 | Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG ER15MSRF (SPAdes) | Environmental | Open in IMG/M |
| 3300027631 | Estuarine microbial communities from the Columbia River estuary, USA - metaG S.535 (SPAdes) | Environmental | Open in IMG/M |
| 3300027759 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130206_EF_MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027763 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140625_EF_MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027782 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140212_EF_MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027798 | Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM15.SD (SPAdes) | Environmental | Open in IMG/M |
| 3300027963 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130807_EF_MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300028394 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130628_MF_MetaG (v2) | Environmental | Open in IMG/M |
| 3300031787 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 12 MA114 | Environmental | Open in IMG/M |
| 3300031857 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 2 MA125 | Environmental | Open in IMG/M |
| 3300033996 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME20Jul2016-rr0004 | Environmental | Open in IMG/M |
| 3300034068 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME13Apr2016-rr0031 | Environmental | Open in IMG/M |
| 3300034082 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME05Jun2015-rr0088 | Environmental | Open in IMG/M |
| 3300034104 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME02Aug2005-rr0120 | Environmental | Open in IMG/M |
| 3300034117 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME18Jun2014-rr0124 | Environmental | Open in IMG/M |
| 3300034119 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME21Jul2015-rr0166 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| JGI25908J49247_101702302 | 3300003277 | Freshwater Lake | LIEFKDLQSDDPIIQLELEMLQQLNPIFLRTEELPEDYDILKDEQC* |
| Ga0049083_101000534 | 3300005580 | Freshwater Lentic | LIEFKDLQSDDPIIQLELEMLQQLNPIFLRTEELPEDYDILKDKQC* |
| Ga0049081_100704183 | 3300005581 | Freshwater Lentic | LIEFKDLQSDDSDIQKTLEMLQELNPIFLRTEELPNDYEMDIDHGH* |
| Ga0049081_101721023 | 3300005581 | Freshwater Lentic | MINFKDLQSDDPNIQGELDMLKELNPIFLRIEELPDDYEIPESYYGAYGA* |
| Ga0049081_101848543 | 3300005581 | Freshwater Lentic | MINFKDLQSDDPIIQGELDMLKELNPVFLRIEELPDDYEMSIDHGH* |
| Ga0049081_102878453 | 3300005581 | Freshwater Lentic | LIEFKDLQSDDPNIQGELDMLKELNPIFLRIEELPDDYEM |
| Ga0049081_103350592 | 3300005581 | Freshwater Lentic | MINFKDLQSDDPNIQGELDMLKELNPIFLRIEELPDDYEMDIEHDH* |
| Ga0049080_100705154 | 3300005582 | Freshwater Lentic | LIEFKDLQSDDPIIQKELEMLQQLNPIFLRIEELPDDYEMFGDEK* |
| Ga0070744_100148436 | 3300006484 | Estuarine | LIEFKDLQSDDSNIQKTLEMLQELNPIFLRTEELPNDYEMDIDHDH* |
| Ga0070744_101524321 | 3300006484 | Estuarine | MIEFKDLQSDDPIIQGELDMLKELNPIFLRIEELPDDYEMDMSNVH* |
| Ga0102828_10386115 | 3300007559 | Estuarine | LIEFKDLQSDDSNIQKTLEMLQELNPIFLRIEELPDDYEMNIDHDH* |
| Ga0102921_12005482 | 3300007603 | Estuarine | MINFKDLQSDDPIIQGELDMLKELNPIFLRIEELPDDYEYTTNTND* |
| Ga0105747_12455122 | 3300007974 | Estuary Water | LIEFKDLQSDDPNIQGELDMLKELNPVFLRIEELPDDYEYTTNTND* |
| Ga0114340_10012836 | 3300008107 | Freshwater, Plankton | MIEFKDLQSDDPIIQGELDMLKELNPIFLRIEDLPDDYEMPKEYNHGH* |
| Ga0114346_10085646 | 3300008113 | Freshwater, Plankton | MIEFKDLQSDDPIIQGELDMLKELNPIFLRIEENA* |
| Ga0114876_10143121 | 3300008448 | Freshwater Lake | MIEFKDLSSNDEYIQKELDMLKELNPVFLRIEELPDDYEMDISNVTLL* |
| Ga0114865_11891653 | 3300008459 | Freshwater Lake | MINFKDLQSDDPNIQEELDMLQQLNPVFLRIEELPDDYEYTTNTND* |
| Ga0102831_12072002 | 3300008996 | Estuarine | RGGTLIEFKDLQSDDPNIQKELEMLQQLNPIFLRIEELPDDYEMNIDHDH* |
| Ga0102831_12336463 | 3300008996 | Estuarine | MINFKDLQSDDPNIQEELDMLKELNPIFLRIEELPDDYEYTTNTND* |
| Ga0102864_12199351 | 3300009051 | Estuarine | MINFKDLQSDDPNIQGELDMLKELNPIFLRIEELPDD |
| Ga0114973_106535212 | 3300009068 | Freshwater Lake | MINFKDLQSDDPIIQGELDMLKELNPIFLRIEELPDDYEMDIEHDH* |
| Ga0114980_100288082 | 3300009152 | Freshwater Lake | MINFKDLQSDDPNIQGELDMLKELNPIFLRIEELPDDYEMDIDHDH* |
| Ga0114980_104063013 | 3300009152 | Freshwater Lake | LIEFKDLQSDDSNIQKTLEMLQELNPIFLRTEELPDDYEMDIDHDH* |
| Ga0114968_100979185 | 3300009155 | Freshwater Lake | LIEFKDLQSDDSNIQKTLEMLQELNPIFLRIEELPDDYEMDIDHDH* |
| Ga0114977_103029023 | 3300009158 | Freshwater Lake | LIEFKDLQSDDLNIQKTLEMLQELNPIFLRTEELPDDYEMDIDHDH* |
| Ga0114978_1000205720 | 3300009159 | Freshwater Lake | LIEFKDLQSDDPIIQGELDMLKELNPIFLRIEDLPDDYEMSIDHDH* |
| Ga0114978_1000613710 | 3300009159 | Freshwater Lake | MIEFKDLQSDDPIIQGKLDMLKELNPIFLRIEELPEDYEMTPYHDH* |
| Ga0114978_101698793 | 3300009159 | Freshwater Lake | LIEFKDLQSDDPIIQKELEMLQQLNPIFLRIEELPNDYEMDIDHDH* |
| Ga0114978_101872986 | 3300009159 | Freshwater Lake | LIEFKDLQSDDLAIQKTLEMLQELNPIFLRIEELPDDYEMDIDHDH* |
| Ga0114966_103179973 | 3300009161 | Freshwater Lake | LIEFKDLQSDDLNIQKTLEMLQELNPIFLRIEELPDDYEMDIDHDH* |
| Ga0114970_104092804 | 3300009163 | Freshwater Lake | LIEFKDLQSDDSNIQKTLEMLQELNPIFLRIEELPDDYEMDIDHVH* |
| Ga0114970_105555541 | 3300009163 | Freshwater Lake | LIEFKDLQSDDSNIQKTLEMLQELNPIFLRIEELPNDYEMDIDHDH* |
| Ga0114975_102982535 | 3300009164 | Freshwater Lake | LIEFKDLQSDDLNIQKTLEMLQELNPIFLRIEELPNDYEMDIDHDH* |
| Ga0114979_101979641 | 3300009180 | Freshwater Lake | LIEFKDLQSDDLNIQKTLEMLQELNPIFLRTEELPNDYEMDIDHDH* |
| Ga0139557_10710903 | 3300011010 | Freshwater | LIEFKDLQSDDPIIQLELEMLQQLNPIFLRTEELSEDYDILNDEQC* |
| Ga0139557_10850601 | 3300011010 | Freshwater | LIEFKDLQSDDPNIQGELDMLKELNPIFLRIEELPDDYEMDIDHDH* |
| Ga0151620_12634282 | 3300011268 | Freshwater | MIEFKDLQSDDPNIQGELDMLKELNPVFLRIEELPDDYEMTID |
| Ga0153799_10416603 | 3300012012 | Freshwater | MINFKDLQSDDPNIQGELDMLKELNPIFLRIEELPDDYEIPESYYGA* |
| Ga0153801_10111822 | 3300012017 | Freshwater | MINFKDLQSDDPNIQGELDMLKELNPIFLRIEELPDDYEMDIGHDH* |
| Ga0157498_10217393 | 3300012666 | Freshwater, Surface Ice | MINFKDLQSDDPNIQEELDMLKELNPIFLRIEELPDDYEILESYYGA* |
| Ga0164293_100912132 | 3300013004 | Freshwater | MIEFKDLQSDDPIIQGELDMLKELNPVFLRIEELPDDYEMTPYHDH* |
| Ga0164292_105324301 | 3300013005 | Freshwater | KTAKEPRGGTLIEFKDLQSDDPNIQGELDMLKELNPIFLRIEELPDDYEMSINHGH* |
| Ga0177922_101497042 | 3300013372 | Freshwater | MINFKDLQSDDPNIQGELDMLKELNPIFLRIEELPDDYEMDMSNVH* |
| Ga0177922_104307692 | 3300013372 | Freshwater | MINFKDLQSDDPIIQGELDMLKELNPIFLRIEELP |
| Ga0177922_107806971 | 3300013372 | Freshwater | LIEFKDLQSDDPNIQKELEMLQQLNPIFLRIEELPDDYEMSIDHDH* |
| Ga0181364_10086765 | 3300017701 | Freshwater Lake | MINFKDLQSDDPNIQGELDMLKELNPIFLRIEELPDDYEYTTNTND |
| Ga0181362_10040447 | 3300017723 | Freshwater Lake | MINFKDLQSDDPNIQEELDMLQQLNPVFLRIEELPDDYEYTT |
| Ga0181365_10686623 | 3300017736 | Freshwater Lake | LIEFKDLQSDDSIIQLELEMLQQLNPIFLRTEELPEDYDIFKDKQC |
| Ga0181356_11028375 | 3300017761 | Freshwater Lake | MNRIEFKDIFSDDELIQKELDMLKELNPVFLRIEELPEDYEMDNSKVDLL |
| Ga0181356_11046312 | 3300017761 | Freshwater Lake | MINFKDLQSDDPNIQEELDMLKELNPIFLRIEELPDDYEILESYYGA |
| Ga0181358_10384661 | 3300017774 | Freshwater Lake | LIEFKDLQSDDPNIQKELDMLQQLNPIFLRIEELPDDYEYT |
| Ga0181358_11797654 | 3300017774 | Freshwater Lake | MNRIEFKDIFSDDELIQKELDMLKELNPVFLRIEELPKDYEIDISKVNLL |
| Ga0181349_100203410 | 3300017778 | Freshwater Lake | MINFKDLQSDDPNIQKEIDMLKELNPIFLRIEELPDDYKMNIDHDH |
| Ga0181349_10672971 | 3300017778 | Freshwater Lake | QLSYKSQRMINFKDLQSDDPNIQGELDMLKELNPIFLRIEELPDDYEMSINHGH |
| Ga0181348_10580361 | 3300017784 | Freshwater Lake | MINFKDLQSDDPNIQKEIDMLKELNPIFLRIEELPDDYEYTTITND |
| Ga0181348_11210333 | 3300017784 | Freshwater Lake | MINFKDLQSDDPTIQKELDMLQQLNPVFLRIEELPDDYEYTTITND |
| Ga0181355_10869964 | 3300017785 | Freshwater Lake | LIEFKDLQSDDPIIQKELEMLQQLNPIFLRIEELPDDYEYTTITND |
| Ga0181359_10033265 | 3300019784 | Freshwater Lake | MINFKDLQSDDPNIQEELDMLQQLNPVFLRIEELPDDYEYTTNTND |
| Ga0181359_10334143 | 3300019784 | Freshwater Lake | LIEFKDLQSDDPIIQKELDMLQQLNPIFLRIEELPDDYEYTTIIND |
| Ga0181359_10926672 | 3300019784 | Freshwater Lake | MINFKDLQSDDPNIQKEIDMLKELNPIFLRIEELPDDYKMDIDHDH |
| Ga0181359_10961483 | 3300019784 | Freshwater Lake | LIEFKDLQSDDPIIQLELEMLQQLNPIFLRTEELPEDYDILKDKQC |
| Ga0181359_11613662 | 3300019784 | Freshwater Lake | MIEFKVLSSNEEHIQKELDMLKELNPVFLRIEELPEDYEMDNSKVDLL |
| Ga0211736_101139512 | 3300020151 | Freshwater | LIEFKDLQSDDPIIQGELDMLKELNPIFLRIEDLPDDYEMSIDHDH |
| Ga0211736_102129313 | 3300020151 | Freshwater | DDPIIQGELDMLKELNPIFLRIEELPGDYEMPKEYNHGH |
| Ga0211734_100063623 | 3300020159 | Freshwater | MIEFKDLQSDDPIIQGELDMLKELNPIFLRIEDLPDDYEMIPHHDH |
| Ga0211734_105247072 | 3300020159 | Freshwater | MIEFKDLQSDDPIIQGELDMLKELNPIFLRIEDLPDDYEMMPHHDH |
| Ga0211726_105537692 | 3300020161 | Freshwater | MINFKDLVSDDEHIQRELDMLKELNPIFLRIEELPDDYEMPKEYGPWTLM |
| Ga0211726_108837387 | 3300020161 | Freshwater | VTEFKDLVSDDEHIQRELDMLKELNPIFLRIEELPDDYEMPKEYGPW |
| Ga0211726_109976903 | 3300020161 | Freshwater | MIEFKDLQSDDPDIQGELDMLKELNPIFLRIEDLPDDYEMSIDHDH |
| Ga0211726_110140894 | 3300020161 | Freshwater | LIEFKDLQSDDPDIQGELDMLKELNPIFLRIEELPDDYEMPESYYGA |
| Ga0211735_107278373 | 3300020162 | Freshwater | LIEFKDLQSDDLAIQKTLEMLQELNPIFLRIEELPDDEMDIDHGH |
| Ga0211729_102341263 | 3300020172 | Freshwater | MINFKDLVSDDEHIQRELDMLKELNPIFLRIEELPEDYEMPEEYNHGH |
| Ga0211729_108613393 | 3300020172 | Freshwater | LIEFKDLQSDDPIIQGELDMLKELNPIFLRIEELPDDYEMMPHHDH |
| Ga0211731_108773474 | 3300020205 | Freshwater | LIEFKDLQSDDPIIQGELDMLKELNPIFLRIEDLPDDYEMDMSNVH |
| Ga0181354_12104604 | 3300022190 | Freshwater Lake | MNRIEFKDIFSDDELIQKELDMLKELNPVFLRIEELPKDYEI |
| Ga0181354_12125833 | 3300022190 | Freshwater Lake | LIEFKDLQSDDPIIQKELDMLQQLNPIFLRIEELPDDYEYTTNTND |
| Ga0181351_11394611 | 3300022407 | Freshwater Lake | LIEFKDLQSDDPNIQKELDMLQQLNPIFLRIEELPDDYE |
| Ga0181351_12558741 | 3300022407 | Freshwater Lake | LIEFKDLQSDDPIIQKELEMLQQLNPIFLRIEELPDDYEMFGDEK |
| Ga0181351_12726713 | 3300022407 | Freshwater Lake | QEKMINFKDLQSDDPNIQGELDMLKELNPIFLRIEELPDDYEMSINHGH |
| Ga0214921_1000275040 | 3300023174 | Freshwater | LIEFKDLQSDDLNIQKTLEMLQELNPIFLRIEELPNDYEMDIDHDH |
| Ga0214921_1001333819 | 3300023174 | Freshwater | MKHQKMIEFKDLQSDDPIIQGELDMLKELNPIFLRTEELPDDYEMTPHHDH |
| Ga0214923_102212342 | 3300023179 | Freshwater | LIEFKDLQSDDLNIQKTLEMLQELNPIFLRIEELPNDYEMDIDHEH |
| Ga0244775_112966492 | 3300024346 | Estuarine | MINFKDLQSDDPNIQEELDMLKELNPIFLRIEELPDDYEIPEFYYGA |
| Ga0208974_11019223 | 3300027608 | Freshwater Lentic | MINFKDLQSDDPNIQEELDMLKELNPIFLRIEELPDDYEIPESYYGA |
| Ga0208133_10231143 | 3300027631 | Estuarine | LIEFKDLQSDDSNIQKTLEMLQELNPIFLRTEELPNDYEMDIDHDH |
| Ga0209296_11608815 | 3300027759 | Freshwater Lake | LIEFKDLQSDDLNIQKTLEMLQELNPIFLRTEELPNDYEMDIDHDH |
| Ga0209088_100529952 | 3300027763 | Freshwater Lake | MINFKDLQSDDPNIQGELDMLKELNPIFLRIEELPDDYEMDIDHDH |
| Ga0209500_100148063 | 3300027782 | Freshwater Lake | MIEFKDLQSDDPIIQGKLDMLKELNPIFLRIEELPEDYEMTPYHDH |
| Ga0209500_102447994 | 3300027782 | Freshwater Lake | LIEFKDLQSDDLAIQKTLEMLQELNPIFLRIEELPDDYEMDIDHDH |
| Ga0209353_101389423 | 3300027798 | Freshwater Lake | LIEFKDLQSDDPIIQLELEMLQQLNPIFLRTEELPEDYDILKDEQC |
| Ga0209353_103983271 | 3300027798 | Freshwater Lake | LIEFKDLQSDDPNIQGELDMLQQLNPVFLRIEELPDDYEYTTNTND |
| Ga0209400_10659282 | 3300027963 | Freshwater Lake | LIEFKDLQSDDSNIQKTLEMLQELNPIFLRIEELPDDYEMDIDHDH |
| Ga0304730_11188805 | 3300028394 | Freshwater Lake | LIEFKDLQSDDSNIQKTLEMLQELNPIFLRIEELPNDYEMDIDHDH |
| Ga0315900_101016381 | 3300031787 | Freshwater | DLQSDDPIIQGELDMLKELNPIFLRIEDLPDDYEMPKEYNHGH |
| Ga0315909_106132972 | 3300031857 | Freshwater | MIEFKDLQSDDPIIQGELDMLKELNPIFLRIEDLPDDYEMPKEYNHGH |
| Ga0334979_0000284_3606_3746 | 3300033996 | Freshwater | MIEFKDLQSDDPIIQGELDMLKELNPVFLRIEELPDDYEMTPYHDH |
| Ga0334979_0034415_1770_1910 | 3300033996 | Freshwater | MINFKDLQSDDPNIQGELDMLKELNPIFLRIEELPDDYEMDIGHDH |
| Ga0334990_0132496_3_107 | 3300034068 | Freshwater | MIEFKDLQSDDPIIQGELDMLKELNPVFLRIEELP |
| Ga0335020_0403875_3_110 | 3300034082 | Freshwater | MINFKDLQSDDPNIQGELDMLKELNPIFLRIEELPD |
| Ga0335031_0194091_397_537 | 3300034104 | Freshwater | MINFKDLQSDDPNIQGELDMLKELNPIFLRIEELPDDYEMSINHGH |
| Ga0335033_0164659_445_585 | 3300034117 | Freshwater | MINFKDLQSDDPNIQGELDMLKELNPVFLRIEELPDDYEMDIDHDH |
| Ga0335054_0324394_499_639 | 3300034119 | Freshwater | MINFKDLQSDDPIIQGELDMLKELNPTFLRIEELPDDYEMDIGHDH |
| ⦗Top⦘ |