 |
Bioinformatics & Integrated Biology Lab Institute for Fundamental Biomedical Research Biomedical Sciences Research Center "Alexander Fleming" |
| Basic Information | |
|---|---|
| Family ID | F101125 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 102 |
| Average Sequence Length | 44 residues |
| Representative Sequence | MSENGTGMETPPNNQPSGAVTSQEAGRKNPSQGKFKSGI |
| Number of Associated Samples | 90 |
| Number of Associated Scaffolds | 102 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Unclassified |
| % of genes with valid RBS motifs | 72.00 % |
| % of genes near scaffold ends (potentially truncated) | 24.51 % |
| % of genes from short scaffolds (< 2000 bps) | 21.57 % |
| Associated GOLD sequencing projects | 87 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.15 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Unclassified (97.059 % of family members) |
| NCBI Taxonomy ID | N/A |
| Taxonomy | N/A |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Aquatic → Freshwater → River → Unclassified → Freshwater (25.490 % of family members) |
| Environment Ontology (ENVO) | Unclassified (43.137 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Water (non-saline) (74.510 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Fibrous | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 5.97% β-sheet: 0.00% Coil/Unstructured: 94.03% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.15 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 102 Family Scaffolds |
|---|---|---|
| PF00085 | Thioredoxin | 2.94 |
| PF09834 | DUF2061 | 0.98 |
| PF01923 | Cob_adeno_trans | 0.98 |
| PF13640 | 2OG-FeII_Oxy_3 | 0.98 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| Unclassified | root | N/A | 97.06 % |
| All Organisms | root | All Organisms | 2.94 % |
| Visualization |
|---|
| Powered by ApexCharts |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Freshwater | Environmental → Aquatic → Freshwater → River → Unclassified → Freshwater | 25.49% |
| Freshwater Lake | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lake | 12.75% |
| Freshwater, Plankton | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater, Plankton | 11.76% |
| Freshwater | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater | 10.78% |
| Freshwater | Environmental → Aquatic → Freshwater → Unclassified → Unclassified → Freshwater | 8.82% |
| Aqueous | Environmental → Aquatic → Marine → Coastal → Unclassified → Aqueous | 4.90% |
| Freshwater Lentic | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lentic | 3.92% |
| Freshwater Lake | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake | 3.92% |
| Freshwater To Marine Saline Gradient | Environmental → Aquatic → Marine → Coastal → Unclassified → Freshwater To Marine Saline Gradient | 2.94% |
| Freshwater Lake | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake | 1.96% |
| Freshwater | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater | 1.96% |
| Freshwater | Environmental → Aquatic → Freshwater → Lentic → Epilimnion → Freshwater | 0.98% |
| Freshwater And Sediment | Environmental → Aquatic → Freshwater → Lentic → Epilimnion → Freshwater And Sediment | 0.98% |
| Freshwater | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater | 0.98% |
| Freshwater And Sediment | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater And Sediment | 0.98% |
| Marine Plankton | Environmental → Aquatic → Freshwater → Lotic → Unclassified → Marine Plankton | 0.98% |
| Freshwater | Environmental → Aquatic → Freshwater → Lotic → Unclassified → Freshwater | 0.98% |
| Water Bodies | Environmental → Aquatic → Freshwater → Unclassified → Unclassified → Water Bodies | 0.98% |
| Estuarine | Environmental → Aquatic → Marine → Intertidal Zone → Estuary → Estuarine | 0.98% |
| Estuarine | Environmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine | 0.98% |
| Estuarine Water | Environmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine Water | 0.98% |
| Deep Subsurface Sediment | Environmental → Terrestrial → Deep Subsurface → Unclassified → Unclassified → Deep Subsurface Sediment | 0.98% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 2035265000 | Freshwater microbial communities from Swedish Lakes - surface of Lake Erken | Environmental | Open in IMG/M |
| 3300000736 | Freshwater microbial communities from dead zone in Lake Erie, Canada - CCB epilimnion July 2011 | Environmental | Open in IMG/M |
| 3300001851 | Marine plankton microbial communities from the Amazon River plume, Atlantic Ocean - RCM31, ROCA_DNA206_0.2um_MCP-S_C_3b | Environmental | Open in IMG/M |
| 3300003412 | Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM110.DD | Environmental | Open in IMG/M |
| 3300004054 | Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MM15.SN (v2) | Environmental | Open in IMG/M |
| 3300005418 | Freshwater lake microbial communities from Lake Erie, under a cyanobacterial bloom - NOAA_Erie_Diel3S_1000h metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300005517 | Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MM15.SN (version 4) | Environmental | Open in IMG/M |
| 3300005581 | Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG ER78MSRF | Environmental | Open in IMG/M |
| 3300005662 | Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MLB.SD (version 4) | Environmental | Open in IMG/M |
| 3300006484 | Estuarine microbial communities from the Columbia River estuary, USA - metaG S.535 | Environmental | Open in IMG/M |
| 3300006641 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_0.19_D_>0.8_DNA | Environmental | Open in IMG/M |
| 3300006802 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_18 | Environmental | Open in IMG/M |
| 3300006917 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_0.19_N_<0.8_DNA | Environmental | Open in IMG/M |
| 3300007304 | Freshwater lake microbial communities from Lake Erie, under a cyanobacterial bloom - NOAA_Erie_Diel1S_2200h metaT (Metagenome Metatranscriptome) (version 2) | Environmental | Open in IMG/M |
| 3300008107 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE2, Sample E2014-0046-3-NA | Environmental | Open in IMG/M |
| 3300008110 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, Sample E2014-0048-3-NA | Environmental | Open in IMG/M |
| 3300008111 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE4, Sample E2014-0050-C-NA | Environmental | Open in IMG/M |
| 3300008113 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE4, Sample E2014-0050-3-NA | Environmental | Open in IMG/M |
| 3300008119 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE4, Sample E2014-0110-C-NA | Environmental | Open in IMG/M |
| 3300008120 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, Sample E2014-0108-3-NA | Environmental | Open in IMG/M |
| 3300008259 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, sample HABS-E2014-0132-C-NA | Environmental | Open in IMG/M |
| 3300008266 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, Sample HABS-E2014-0108-C-NA | Environmental | Open in IMG/M |
| 3300008448 | Freshwater viral communities during cyanobacterial harmful algal blooms (CHABs) in Western Lake Erie, USA - August 4, 2014 all contigs | Environmental | Open in IMG/M |
| 3300008510 | Microbial Communities in Water bodies, Singapore - Site RA | Environmental | Open in IMG/M |
| 3300008953 | Freshwater microbial communities from Lake Lanier in Georgia, USA - LL_1007_MT4 | Environmental | Open in IMG/M |
| 3300009159 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140212_EF_MetaG | Environmental | Open in IMG/M |
| 3300009180 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140625_EF_MetaG | Environmental | Open in IMG/M |
| 3300010354 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_0.6_0.8_DNA | Environmental | Open in IMG/M |
| 3300010370 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_0.6_0.2_DNA | Environmental | Open in IMG/M |
| 3300011268 | Sub-surface freshwater microbial communities from San Francisco Estuary Delta, California, USA . Combined Assembly of Gp0173482, Gp0175554, Gp0175555 | Environmental | Open in IMG/M |
| 3300011381 | Freshwater lake microbial communities from Lake Erie, under a cyanobacterial bloom - NOAA_Erie_Diel7S_1600h metaT (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300012017 | Freshwater microbial communities from Central Basin Lake Erie, Ontario, Canada - Station 1208 - Top - Depth 1m | Environmental | Open in IMG/M |
| 3300012706 | Eutrophic lake water microbial communities from Lake Mendota, Wisconsin, USA - GEODES159 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300012721 | Eutrophic lake water microbial communities from Lake Mendota, Wisconsin, USA - GEODES139 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300012723 | Eutrophic lake water microbial communities from Lake Mendota, Wisconsin, USA - GEODES129 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300012724 | Eutrophic lake water microbial communities from Lake Mendota, Wisconsin, USA - GEODES138 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300012726 | Eutrophic lake water microbial communities from Lake Mendota, Wisconsin, USA - GEODES115 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300012730 | Eutrophic lake water microbial communities from Lake Mendota, Wisconsin, USA - GEODES126 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300012968 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_0.6_0.2_RNA1 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300012970 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_0.6_0.2_RNA2 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300013310 | Eutrophic lake water microbial communities from Lake Mendota, Wisconsin, USA - GEODES153 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300017701 | Freshwater viral communities from Lake Michigan, USA - Fa13.ND.MM110.S.N | Environmental | Open in IMG/M |
| 3300020541 | Freshwater microbial communities from Lake Mendota, WI - 26AUG2009 deep hole epilimnion (SPAdes) | Environmental | Open in IMG/M |
| 3300021091 | Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015055 Kigoma Offshore 40m | Environmental | Open in IMG/M |
| 3300021962 | Estuarine water microbial communities from San Francisco Bay, California, United States - C33_649D | Environmental | Open in IMG/M |
| 3300024278 | Freshwater microbial communities from Mississippi River, Louisiana, United States - Miss_Law_RepC_8d | Environmental | Open in IMG/M |
| 3300024481 | Metatranscriptome of freshwater microbial communities from Altamaha River, Georgia, United States - Atl_Cont_RepC_0h (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300024484 | Metatranscriptome of freshwater microbial communities from Altamaha River, Georgia, United States - Atl_Cont_RepB_8h (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300024501 | Freshwater microbial communities from Mississippi River, Louisiana, United States - Miss_Miss_RepB_8d | Environmental | Open in IMG/M |
| 3300024541 | Metatranscriptome of freshwater microbial communities from Altamaha River, Georgia, United States - Atl_Miss_RepC_8d (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300024552 | Metatranscriptome of freshwater microbial communities from Altamaha River, Georgia, United States - Atl_Atl_RepA_8d (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300024565 | Metatranscriptome of freshwater microbial communities from Altamaha River, Georgia, United States - Atl_Atlam_RepC_8h (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300024572 | Metatranscriptome of freshwater microbial communities from Altamaha River, Georgia, United States - Atl_Yuk_RepB_8h (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300024855 | Metatranscriptome of freshwater microbial communities from Altamaha River, Georgia, United States - Atl_Yuk_RepC_8d (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300026569 | Metatranscriptome of freshwater microbial communities from Altamaha River, Georgia, United States - Atl_Cont_RepA_8d (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300026570 | Metatranscriptome of freshwater microbial communities from Altamaha River, Georgia, United States - Atl_Colum_RepB_8h (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300026571 | Metatranscriptome of freshwater microbial communities from Altamaha River, Georgia, United States - Atl_UVDOM_RepB_8d (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300026572 | Metatranscriptome of freshwater microbial communities from Altamaha River, Georgia, United States - Atl_Atl_RepB_8h (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300027126 | Freshwater microbial communities from Columbia River, Oregon, United States - Colum_Atlam_RepC_8d | Environmental | Open in IMG/M |
| 3300027278 | Estuarine microbial communities from the Columbia River estuary - Freshwater metaG S.703 (SPAdes) | Environmental | Open in IMG/M |
| 3300027396 | Freshwater microbial communities from Altamaha River, Georgia, United States - Atl_Cont_RepC_8h | Environmental | Open in IMG/M |
| 3300027488 | Freshwater microbial communities from Columbia River, Oregon, United States - Colum_Cont_RepA_8d | Environmental | Open in IMG/M |
| 3300027489 | Freshwater microbial communities from Columbia River, Oregon, United States - Colum_Law_RepC_8d | Environmental | Open in IMG/M |
| 3300027491 | Freshwater microbial communities from Columbia River, Oregon, United States - Colum_Atlam_RepB_8d | Environmental | Open in IMG/M |
| 3300027508 | Freshwater microbial communities from Columbia River, Oregon, United States - Colum_Yuk_RepA_8h | Environmental | Open in IMG/M |
| 3300027581 | Freshwater lake microbial communities from Lake Michigan, USA - Fa13.BD.MM110.SN (SPAdes) | Environmental | Open in IMG/M |
| 3300027621 | Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG MI27MSRF (SPAdes) | Environmental | Open in IMG/M |
| 3300027627 | Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG SU08MSRF (SPAdes) | Environmental | Open in IMG/M |
| 3300027656 | Freshwater lake microbial communities from Lake Michigan, USA - Fa13.BD.MM110.SD (SPAdes) | Environmental | Open in IMG/M |
| 3300027659 | Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG ER78MSRF (SPAdes) | Environmental | Open in IMG/M |
| 3300027688 | Freshwater lake microbial communities from Lake Michigan, USA - Fa13.BD.MM110.DN (SPAdes) | Environmental | Open in IMG/M |
| 3300027782 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140212_EF_MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027793 | Freshwater lake microbial communities from Lake Erie, under a cyanobacterial bloom - NOAA_Erie_Diel1S_2200h metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027805 | Freshwater and sediment microbial communities from dead zone in Sandusky Bay, Ohio, USA (SPAdes) | Environmental | Open in IMG/M |
| 3300027973 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140806_EF_MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300028027 | Subsurface sediment microbial communities from gas well in West Virginia, United States - MSEEL Well Study Marcellus 3H_FC | Environmental | Open in IMG/M |
| 3300028067 | Freshwater microbial communities from Mississippi River, Louisiana, United States - Miss_Miss_RepC_8h | Environmental | Open in IMG/M |
| 3300028103 | Freshwater microbial communities from Altamaha River, Georgia, United States - Atl_Yuk_RepC_8d | Environmental | Open in IMG/M |
| 3300028286 | Metatranscriptome of freshwater microbial communities from Altamaha River, Georgia, United States - Atl_Cont_RepA_8h (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300028530 | Metatranscriptome of freshwater microbial communities from Altamaha River, Georgia, United States - Atl_Miss_RepA_8d (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031758 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 12 MA123 | Environmental | Open in IMG/M |
| 3300031784 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 4 MA112 | Environmental | Open in IMG/M |
| 3300031857 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 2 MA125 | Environmental | Open in IMG/M |
| 3300031951 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 12 MA120 | Environmental | Open in IMG/M |
| 3300032093 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 12 MA117 | Environmental | Open in IMG/M |
| 3300032116 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 2 MA119 | Environmental | Open in IMG/M |
| 3300034108 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME24Jun2014-rr0157 | Environmental | Open in IMG/M |
| 3300034280 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME10Aug2009-rr0048 | Environmental | Open in IMG/M |
| 3300034284 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME08Jul2016-rr0075 | Environmental | Open in IMG/M |
| 3300034356 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME17Jun2014-rr0152 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| ErSWdraft_5394980 | 2035265000 | Freshwater | MSENGTGMATPPNNQPSGAVTSQEAARKKPTQGKFRSGITTPRPPTKVRQQI |
| JGI12547J11936_10402511 | 3300000736 | Freshwater And Sediment | MSENGTGMATPPNNQPSGAVTSQETARKKPTQGKFRSGITTPRPPTKVDTNRH |
| RCM31_102529674 | 3300001851 | Marine Plankton | MSDGTPAPTPINESSGAVTSQEVGRKKPSQGKFRSGIADQRSM |
| JGI25912J50252_100456061 | 3300003412 | Freshwater Lake | MSENGTGMATPPNNQPSGAVTSQEAARKKPTQGKFRSGIT |
| Ga0063232_101323561 | 3300004054 | Freshwater Lake | MSENGTGMATPPNNQPSGAVTSQEAARKKPTQGKFRSGITTPRPPTKVDTN |
| Ga0068881_10157963 | 3300005418 | Freshwater Lake | MSDNGTGMDTPPNSQPSGAVTSQEATRKNPSQGKFRSGFSGPRPATKIDTNK |
| Ga0070374_106925493 | 3300005517 | Freshwater Lake | MSENGTGMATPPNNQPSGAVTSQEAARKKPTQGKFRSGITTPR |
| Ga0049081_100539288 | 3300005581 | Freshwater Lentic | MDSPPTDQPSGAVTAAEVGRKKPSQGKFRSGIQEKRPIKIDRNRHGIRRETTI |
| Ga0078894_107533834 | 3300005662 | Freshwater Lake | MATPPNNQPSGAVTSQEAARKNPSQGKFKSGFSSPRPPTKVDTNKHG |
| Ga0070744_102469041 | 3300006484 | Estuarine | MSDNGTGMDTPPNSQPSGAVTSQEAARKNPSQGKFRS |
| Ga0075471_102784346 | 3300006641 | Aqueous | MVPPPNSEPSGAVTSQEVGRKKPSQGKFRSGIQDKRSI |
| Ga0070749_106648381 | 3300006802 | Aqueous | MSDNGTGMATPPNNEPSGAVTSQEVGRKKPSQGKFRSGINDKRTMRVD |
| Ga0075472_100225679 | 3300006917 | Aqueous | MNNGTGMDTPPNTQPSGAVTSQEATRKNPSQGKFKSGIS |
| Ga0102689_10317701 | 3300007304 | Freshwater Lake | MSDNGTGMDTPPNSQPSGAVTSQEATRKNPSQGKFRSGFSGPRPATKIDTNKHGI |
| Ga0102689_17662151 | 3300007304 | Freshwater Lake | MSNGTGMDTPPNNQPSGAVTSQEVGRKKSSQGKFRSTVQNQRALTRIDTNKHGIRR |
| Ga0114340_12294263 | 3300008107 | Freshwater, Plankton | MSDINGTGMSAPANNEPAGAVTSREATRKKPQQGKFRSGIQ |
| Ga0114340_12684581 | 3300008107 | Freshwater, Plankton | LTNGTGMDTPPNNTPSGAVTSQEAGRKSPSQGKFKSGINNQRSLTRIDTNKHGIR |
| Ga0114343_10920061 | 3300008110 | Freshwater, Plankton | VSDNGTGMATPPNNQPSGAVTSQEAARKNPSQGKFRSGVNGPRPATKIDRN |
| Ga0114343_11822491 | 3300008110 | Freshwater, Plankton | MSDNGTGMDTPPNSQPSGAVTSQEATRKNPSQGKFRSGFSGP |
| Ga0114344_12371281 | 3300008111 | Freshwater, Plankton | MNNGTGMDTPPNNTPSGAVTSQEATRKNPSQGKSKS |
| Ga0114346_13021171 | 3300008113 | Freshwater, Plankton | MSNNGTGMDTPPNNQPSGAVTSQEATRKNPSQGKFKSGFSGPKPP |
| Ga0114354_11978493 | 3300008119 | Freshwater, Plankton | MSDNGTGMDTPPNSQPSGAVTSQEATRKNPSQGKFRSGFSGPRPATKIDTNKH |
| Ga0114355_11374065 | 3300008120 | Freshwater, Plankton | MSNNGTGMDTPPNNQPSGAVTSQEAARKNPSQGKFRS |
| Ga0114841_10419275 | 3300008259 | Freshwater, Plankton | MNNGTGMETPPNNQPSGAVTSQEAGRKNPSQGRFKSGISKPAVKIDTNKH |
| Ga0114363_10319651 | 3300008266 | Freshwater, Plankton | MSNNGTGMDTPPNNQPSGAVTSQEATRKNPSQGKFRSGFSGPRPATKIDTNKHG |
| Ga0114363_10642806 | 3300008266 | Freshwater, Plankton | VSDNGTGMTTPPNNQPSGAVTSQEAARKNPSQGKFKSGFSGPRPATKIDT |
| Ga0114363_12026781 | 3300008266 | Freshwater, Plankton | MNNGTGMDTPPNNEPSGAVTSAEATRKKPSQGKFRSGINDRPPMKIDTNRHGI |
| Ga0114876_10404401 | 3300008448 | Freshwater Lake | MNNGTGMDTPPNNEPSGAVTSAEATRKKPSQGKFRSGINDR |
| Ga0110928_10381923 | 3300008510 | Water Bodies | MSNGTGMDTPPNNAPAGAVTSQEATRKNPTQGKFK |
| Ga0104241_10036391 | 3300008953 | Freshwater | VSDNGTGMATPPNTQPSGAVTSQEAARKNPSQGKFRSGVNGPRP |
| Ga0114978_100854836 | 3300009159 | Freshwater Lake | MSENGTGMATPPNNQPSGAVTSQEAARKKPTQGKFRSGI |
| Ga0114979_104947373 | 3300009180 | Freshwater Lake | MSENGTGMATPPNNEPAGAVTSQEVGRKKPNQGEFRSGING |
| Ga0129333_109806304 | 3300010354 | Freshwater To Marine Saline Gradient | MSNGTGMETPPNNTPAGAVTSEEATRKNPSQGKFKSGFKKPPTKIDR |
| Ga0129336_103525601 | 3300010370 | Freshwater To Marine Saline Gradient | MSNNGTGMDTPPNNTPSGAVTSQEAARKNPSQGRF |
| Ga0129336_104775734 | 3300010370 | Freshwater To Marine Saline Gradient | MSDNGTGMETPPNSQPSGAVTSQEATRKNPSQNRFRSGVNK |
| Ga0151620_11553121 | 3300011268 | Freshwater | VSDNGTGMATPPNTQPSGAVTSQEAARKNPSQGKFRSGVNGPRPATKIDRNKHGIRR |
| Ga0102688_16426461 | 3300011381 | Freshwater Lake | MNNGTGMDTPPNNTPSGAVTSQEATRKNPSQGKFRSGVSGPRPATKIDTNKHGIRR |
| Ga0153801_10765171 | 3300012017 | Freshwater | MESPPNNEPSGAVTSQEVGRKKPSQGKFRSGVSNQRSMTRIDTNKHGIRRET |
| Ga0157627_10242026 | 3300012706 | Freshwater | MSDNGTGMDTPPNSEPSGAVTSQEVGRKKPSQGKFHSGPRPPTKIDQN |
| Ga0157612_12354533 | 3300012721 | Freshwater | MSENGTGMATPPNNEPAGAVTSQEVGRKKPNQGKFRSGINGPRPATKIDTNKHGI |
| Ga0157604_12985814 | 3300012723 | Freshwater | MSDNGTGMDTPPNSEPSGAVTSQEVGRKKPSQGKFHSG |
| Ga0157611_11084831 | 3300012724 | Freshwater | MSDNGTGMDTPPNSEPSGAVTSQEVGRKKPSQGKFHSGPRP |
| Ga0157597_11048121 | 3300012726 | Freshwater | MSDNGTGMDTPPNSQPSGAVTSQEATRKNPSQGKFRS |
| Ga0157602_11376745 | 3300012730 | Freshwater | MSDNGTGMDTPPNSEPSGAVTSQEVGRKKPSQGKFHSGPRPPTKIDQ |
| Ga0129337_14127351 | 3300012968 | Aqueous | MNNGTGMDTPPNNQPSGAVTSQEAGRKNPSQGKFK |
| Ga0129338_14762471 | 3300012970 | Aqueous | MNGTGMDSPPSSEPSGAVTAAEVGRKKPSQGKFRSGIKNDRPAMRIDTNRHGIRRE |
| Ga0157622_11989444 | 3300013310 | Freshwater | MSDNGTGMDTPPNSEPSGAVTSQEVGRKKPSQGKFHSGPRPPTKIDQNK |
| Ga0181364_10196286 | 3300017701 | Freshwater Lake | MSENGTGMATPPNNQPSGAVTSQEAARKKPTQGKFRSGITTPRPPTKVDTNK |
| Ga0208359_10636871 | 3300020541 | Freshwater | MSDNGTGMDTPPNSQPSGAVTSQEATRKNPSQGKFRSGFSGPRPA |
| Ga0194133_101978461 | 3300021091 | Freshwater Lake | MDNNGTGMATPPNSTPSGAVTSQEVGRKKPIQGKFKS |
| Ga0222713_101931911 | 3300021962 | Estuarine Water | MSNNGTGMDTPPNSQPSGAVTSQEATRKNPSQGKFRSGF |
| Ga0255215_10643003 | 3300024278 | Freshwater | MNNGTGMDSPPTDQPSGAVTAAEVGRKKPSQGKFRSGIQEKRPIKIDRNRH |
| Ga0256330_10017111 | 3300024481 | Freshwater | MSENGTGMSTPPNNQPAGAVTSQEVGRKNPSQGKFKSGVGKPA |
| Ga0256332_11364183 | 3300024484 | Freshwater | MVTPPNNEPSGAVTSDQVGRKKPSQNRFKSGIQDKRSVIIDRNRHG |
| Ga0255208_10371521 | 3300024501 | Freshwater | MNNGTGMDSPPTDQPSGAVTAAEVGRKKPSQGKFKSGIQE |
| Ga0256343_10913761 | 3300024541 | Freshwater | MSENGTGMSTPPNNQPAGAVTSQEVGRKNPSQGKFKS |
| Ga0256345_10448975 | 3300024552 | Freshwater | MVPPPNSEPSGAVTSQEVGRKKPSQGKFRSGIQDKRSIVVDRNRHGIRRETT |
| Ga0255273_10148651 | 3300024565 | Freshwater | MSNGTGMETPPNNQPSGAVTSQEAGRKNPSQGKFKSGI |
| Ga0255273_10946491 | 3300024565 | Freshwater | MSNGTGMVPPPNSEPSGAVTSQEVGRKNPSQGKFRSG |
| Ga0255268_10473544 | 3300024572 | Freshwater | MSNGTGMETPPNNQPSGAVTSQEAGRKNPSQGKFKSGIGKPAV |
| Ga0255281_11255211 | 3300024855 | Freshwater | MSDNGTGMQTPPNNSPAGAVTSQEVGRKNPSQGKFKSG |
| Ga0255277_11462053 | 3300026569 | Freshwater | MSENGTGMETPPNNQPSGAVTSQEAGRKNPSQGKFKSGIGKPAV |
| Ga0255277_11714933 | 3300026569 | Freshwater | MSDNGTGMDTPAVNTPSGAVTSQEAARKNQKQGGFRSGINSGKPSMRIDRNRHGIR |
| Ga0255274_10748251 | 3300026570 | Freshwater | MSENGTGMETPPNNQPSGAVTSQEAGRKNPSQGKFKSGI |
| Ga0255274_11553531 | 3300026570 | Freshwater | MVTPPNNEPSGAVTSDQVGRKKPSQNRFKSGIQDKRSVII |
| Ga0255289_10856523 | 3300026571 | Freshwater | MSDNGTGMQTPPNNSPAGAVTSQEVGRKNPSQGKFKSGIGNKPAVKIDTNKHGIR |
| Ga0255270_11850431 | 3300026572 | Freshwater | MSENGTGMETPPNNQPSGAVTSQEAGRKNPSQGKFKSG |
| Ga0255098_10336681 | 3300027126 | Freshwater | MSENGTGMATPPNNQPSGAVTSQEVERKKPTQGKFKSGFSGPRPPTKVDTN |
| Ga0208439_10758693 | 3300027278 | Estuarine | MNNGTGMDTPPNNTPSGAVTSQEVGRKNPSQGKFR |
| Ga0255146_10131175 | 3300027396 | Freshwater | MSENGTGMETPPNNQPSGAVTSQEAGRKNPSQGKFKSGIGKPAVK |
| Ga0255084_10653593 | 3300027488 | Freshwater | MDTPPNNTPSGAVTSQEATRRNPSQGKFRSGINGPRPATKIDTNKHGIRRET |
| Ga0255095_10719931 | 3300027489 | Freshwater | MSENGTGMATPPNNQPSGAVTSQEVERKKPTQGKFKSGFSGP |
| Ga0255097_10740524 | 3300027491 | Freshwater | MNNGTGMDTPPNNTPSGAVTSQEVGRKNPSQGKFRSGVN |
| Ga0255072_10533871 | 3300027508 | Freshwater | MATPPNNQPSGAVTSQEAARKNPSQGKFRSGVNGPRPATKIDRN |
| Ga0209651_11019034 | 3300027581 | Freshwater Lake | MSENGTGMATPPNNQPSGAVTSQEAARKKPTQGKFRSGITTPRPPTKVDTNKHGI |
| Ga0208951_10347621 | 3300027621 | Freshwater Lentic | MSENGTGMATPPNNQPSGAVTSQEAARKKPTQGKSRSG |
| Ga0208942_11949533 | 3300027627 | Freshwater Lentic | MSDINGTGMSLPVNTTPSGAVTSEEATRKNPKQSGFRSG |
| Ga0209357_11951753 | 3300027656 | Freshwater Lake | MSENGTGMATPPNNEPAGAVTSQEVGRKKPNQGKFRSGINGPRPATRVD |
| Ga0208975_10487171 | 3300027659 | Freshwater Lentic | MNNGTGMDSPPTDQPSGAVTAAEVGRKKPSQGKFRSGIQEKRPIKID |
| Ga0209553_10253521 | 3300027688 | Freshwater Lake | MSENGTGMATPPNNQPSGAVTSQEAARKKPTQGKFRSGITTPRPPTKVDTNKHGIR |
| Ga0209500_100553641 | 3300027782 | Freshwater Lake | MSENGTGMATPPNNQPSGAVTSQEAARKKPTQGKFRSG |
| Ga0209972_102983594 | 3300027793 | Freshwater Lake | MNNGTGMDTPPNNQPSGAVTSQEAGRKNPSQGKFKS |
| Ga0209229_102584011 | 3300027805 | Freshwater And Sediment | VSDNGTGMATPPNNQPSGAVTSQEAARKNPSQGKFR |
| Ga0209298_100851801 | 3300027973 | Freshwater Lake | MSENGTGMATPPNNEPAGAVTSQEVGRKKPNQGKFRSGINGPRPATK |
| Ga0247722_101554131 | 3300028027 | Deep Subsurface Sediment | MSDDGTGMVTPPNSEPSGAVTSQEVGRKKPSQGKFHSGPRPPTKI |
| Ga0255192_10515184 | 3300028067 | Freshwater | MNNGTGMDSPPTDQPSGAVTAAEVGRKKPSQGKFKSGIQEKRPIKIDRNR |
| Ga0255172_10621171 | 3300028103 | Freshwater | MSENGTGMSTPPNNQPAGAVTSQEVGRKNPSQGKFK |
| Ga0256331_11516561 | 3300028286 | Freshwater | MNDNGTGMVTPPNNEPSGAVTSDQVGRKKPSQNRFKSGIQDKRSVIIDRNRHGIR |
| Ga0255279_10681591 | 3300028530 | Freshwater | MSNGTGMVPPPNSEPSGAVTSQEVGRKKPSQGKFRSGIQDKRSIVVDRNRHGIR |
| Ga0315907_103427421 | 3300031758 | Freshwater | MSNGTGMDTPPNNQPSGAVTSQEVGRKKSSQGKFRSTVQNQRALTRIDTN |
| Ga0315907_106516084 | 3300031758 | Freshwater | MSDNGTGMATPPNNQPSGAVTSQEATRKKPSQGKFKSGTKPLTRIDTNK |
| Ga0315899_104212886 | 3300031784 | Freshwater | VSDNGTGMATPPNNQPSGAVTSQEAARKNPSQGKF |
| Ga0315909_102384815 | 3300031857 | Freshwater | MNNNGTGMDTPPNNEPSGAVTSQEVSRKNPSQGKFRSGVQNQRAMTRIDTNKHGIR |
| Ga0315909_102841316 | 3300031857 | Freshwater | MDTPPNSQPSGAVTAQEATRKNPSQGKFRSGFSGPRPAT |
| Ga0315904_102808061 | 3300031951 | Freshwater | VSDNGTGMTTPPNNQPSGAVTSQEAARKNPSQGKLRSG |
| Ga0315904_105214291 | 3300031951 | Freshwater | MSDVNGTGMSAPANNEPAGAVTSREATRKKPQQGKFRSGIQ |
| Ga0315902_104544274 | 3300032093 | Freshwater | MSNGTGMDTPPNNQPSGAVTSQEVGRKKSSQGKFRSTVQNQRALTRIDTNK |
| Ga0315903_111370062 | 3300032116 | Freshwater | MSNGTGMVPPPNSEPSGAVTSQEVGRKKPSQGKFRSGIQD |
| Ga0335050_0319894_595_729 | 3300034108 | Freshwater | MSNNGTGMDTPPNNTPSGAVTSQEAARKNPSQGRFKSGIGAKRPP |
| Ga0334997_0722651_497_604 | 3300034280 | Freshwater | MSENGTGMATPPVSEPSGAVTSRETPRKYPKQGTRS |
| Ga0335013_0202020_3_116 | 3300034284 | Freshwater | MSDINGTGMEAPPNPSPAGAVTSREATRKNPKQGLRPG |
| Ga0335048_0212457_2_136 | 3300034356 | Freshwater | MDTPPNSQPSGAVTSQEATRKNPSQGKFRSGFSGPRPATKIDTNK |
| ⦗Top⦘ |
|
Bioinformatics & Integrated Biology Lab Institute for Fundamental Biomedical Research Biomedical Sciences Research Center "Alexander Fleming" |