NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F101112

Metagenome / Metatranscriptome Family F101112

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F101112
Family Type Metagenome / Metatranscriptome
Number of Sequences 102
Average Sequence Length 96 residues
Representative Sequence SVKLKTRDGELRVRALTPTAPLGAFSLPDARSSIRAALMRIAQDEVFDNWLMRRENSALQWTTCRRDWLPAVGPLELSSSLPFLALAS
Number of Associated Samples 96
Number of Associated Scaffolds 102

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 7.84 %
% of genes near scaffold ends (potentially truncated) 93.14 %
% of genes from short scaffolds (< 2000 bps) 95.10 %
Associated GOLD sequencing projects 93
AlphaFold2 3D model prediction Yes
3D model pTM-score0.26

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (99.020 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil
(27.451 % of family members)
Environment Ontology (ENVO) Unclassified
(35.294 % of family members)
Earth Microbiome Project Ontology (EMPO) Free-living → Non-saline → Soil (non-saline)
(50.000 % of family members)



 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      


 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 29.31%    β-sheet: 12.07%    Coil/Unstructured: 58.62%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  
pTM-score: 0.26
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.


 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 102 Family Scaffolds
PF03459TOBE 50.98
PF13489Methyltransf_23 7.84
PF01925TauE 4.90
PF08241Methyltransf_11 1.96
PF00072Response_reg 0.98
PF13565HTH_32 0.98
PF13090PP_kinase_C 0.98
PF00005ABC_tran 0.98
PF00528BPD_transp_1 0.98

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 102 Family Scaffolds
COG0730Sulfite exporter TauE/SafE/YfcA and related permeases, UPF0721 familyInorganic ion transport and metabolism [P] 4.90


 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms99.02 %
UnclassifiedrootN/A0.98 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
2124908045|KansclcFeb2_ConsensusfromContig56551All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium640Open in IMG/M
3300000550|F24TB_11276356All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium576Open in IMG/M
3300000891|JGI10214J12806_13018126All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium614Open in IMG/M
3300000956|JGI10216J12902_113195885All Organisms → cellular organisms → Bacteria1324Open in IMG/M
3300004114|Ga0062593_101467188All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium733Open in IMG/M
3300004156|Ga0062589_101609642All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium644Open in IMG/M
3300004157|Ga0062590_101699302All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium643Open in IMG/M
3300004479|Ga0062595_101450604All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium629Open in IMG/M
3300005168|Ga0066809_10096676All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium718Open in IMG/M
3300005177|Ga0066690_11064332All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium504Open in IMG/M
3300005329|Ga0070683_100688908All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium979Open in IMG/M
3300005334|Ga0068869_101009560All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium725Open in IMG/M
3300005347|Ga0070668_101388390All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium640Open in IMG/M
3300005440|Ga0070705_100909411All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium708Open in IMG/M
3300005459|Ga0068867_100504438All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium1040Open in IMG/M
3300005526|Ga0073909_10510098All Organisms → cellular organisms → Bacteria583Open in IMG/M
3300005549|Ga0070704_101931999All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium547Open in IMG/M
3300005578|Ga0068854_101042849All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium726Open in IMG/M
3300005718|Ga0068866_10548001All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium773Open in IMG/M
3300006575|Ga0074053_11899426All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium822Open in IMG/M
3300006844|Ga0075428_101649389All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium670Open in IMG/M
3300006854|Ga0075425_101709343All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium708Open in IMG/M
3300006880|Ga0075429_101200679All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium662Open in IMG/M
3300006881|Ga0068865_100127672All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales1901Open in IMG/M
3300006894|Ga0079215_11385593All Organisms → cellular organisms → Bacteria548Open in IMG/M
3300006903|Ga0075426_11458310All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium520Open in IMG/M
3300006969|Ga0075419_10460886All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium878Open in IMG/M
3300009137|Ga0066709_104013152All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium535Open in IMG/M
3300009162|Ga0075423_12623774All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium551Open in IMG/M
3300009162|Ga0075423_12880003All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium527Open in IMG/M
3300009174|Ga0105241_11837105All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium592Open in IMG/M
3300010037|Ga0126304_10342819All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia993Open in IMG/M
3300010047|Ga0126382_10606535All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium902Open in IMG/M
3300010323|Ga0134086_10113408All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium966Open in IMG/M
3300010333|Ga0134080_10488270All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium583Open in IMG/M
3300010371|Ga0134125_13041742All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium508Open in IMG/M
3300010371|Ga0134125_13105959All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium503Open in IMG/M
3300010373|Ga0134128_11070057All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium891Open in IMG/M
3300010400|Ga0134122_12484791All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium567Open in IMG/M
3300011106|Ga0151489_1371647All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium577Open in IMG/M
3300012204|Ga0137374_10968545All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium618Open in IMG/M
3300012355|Ga0137369_11109476All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium516Open in IMG/M
3300012360|Ga0137375_11259354All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium561Open in IMG/M
3300012901|Ga0157288_10234604All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium606Open in IMG/M
3300012904|Ga0157282_10235617All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium611Open in IMG/M
3300012910|Ga0157308_10000815All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales5611Open in IMG/M
3300012911|Ga0157301_10462308All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium506Open in IMG/M
3300012951|Ga0164300_10863753All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium568Open in IMG/M
3300012972|Ga0134077_10257993All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium723Open in IMG/M
3300012988|Ga0164306_11905885All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium517Open in IMG/M
3300012989|Ga0164305_11795854All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium553Open in IMG/M
3300014325|Ga0163163_12857753All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium539Open in IMG/M
3300014969|Ga0157376_12836411All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium524Open in IMG/M
3300014969|Ga0157376_12981635All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium512Open in IMG/M
3300015372|Ga0132256_100590946All Organisms → cellular organisms → Bacteria1224Open in IMG/M
3300017659|Ga0134083_10491190All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium548Open in IMG/M
3300018028|Ga0184608_10160332All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium974Open in IMG/M
3300018028|Ga0184608_10176946All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium929Open in IMG/M
3300018061|Ga0184619_10310365All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium722Open in IMG/M
3300018072|Ga0184635_10416716All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium506Open in IMG/M
3300018075|Ga0184632_10457530All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium528Open in IMG/M
3300018076|Ga0184609_10075462All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium1483Open in IMG/M
3300019255|Ga0184643_1261946All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium576Open in IMG/M
3300019362|Ga0173479_10272392All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium756Open in IMG/M
3300019869|Ga0193705_1099374All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium533Open in IMG/M
3300020005|Ga0193697_1096179All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium710Open in IMG/M
3300020018|Ga0193721_1004233All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales3740Open in IMG/M
3300021510|Ga0222621_1095902All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium629Open in IMG/M
3300022694|Ga0222623_10095315All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium1156Open in IMG/M
3300023071|Ga0247752_1044621All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium684Open in IMG/M
3300024055|Ga0247794_10114381All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium815Open in IMG/M
3300025327|Ga0209751_11349100All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium508Open in IMG/M
3300025935|Ga0207709_10134140All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales1692Open in IMG/M
3300025937|Ga0207669_11877831All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium512Open in IMG/M
3300025938|Ga0207704_10907623All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium741Open in IMG/M
3300025949|Ga0207667_11920317All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium554Open in IMG/M
3300025981|Ga0207640_10093589All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria2088Open in IMG/M
3300026088|Ga0207641_12640736All Organisms → cellular organisms → Bacteria500Open in IMG/M
3300026116|Ga0207674_10009302All Organisms → cellular organisms → Bacteria11254Open in IMG/M
3300026552|Ga0209577_10529343All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium765Open in IMG/M
3300027880|Ga0209481_10654262All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium545Open in IMG/M
3300028380|Ga0268265_10791173All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium924Open in IMG/M
3300028716|Ga0307311_10209335All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium573Open in IMG/M
3300028717|Ga0307298_10026172All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales1534Open in IMG/M
3300028718|Ga0307307_10025774All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium1649Open in IMG/M
3300028722|Ga0307319_10152792Not Available749Open in IMG/M
3300028755|Ga0307316_10143295All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium849Open in IMG/M
3300028778|Ga0307288_10422902All Organisms → cellular organisms → Bacteria544Open in IMG/M
3300028791|Ga0307290_10061483All Organisms → cellular organisms → Bacteria1359Open in IMG/M
3300028796|Ga0307287_10079063All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium1232Open in IMG/M
3300028811|Ga0307292_10472188All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium537Open in IMG/M
3300028814|Ga0307302_10140108All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium1168Open in IMG/M
3300028819|Ga0307296_10316057All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium852Open in IMG/M
3300028876|Ga0307286_10047833All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales → Mycobacteriaceae → Mycobacterium → Mycobacterium tuberculosis complex → Mycobacterium tuberculosis1445Open in IMG/M
3300028878|Ga0307278_10078315All Organisms → cellular organisms → Bacteria1489Open in IMG/M
3300028878|Ga0307278_10466534All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium552Open in IMG/M
3300028878|Ga0307278_10508649All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium526Open in IMG/M
3300031170|Ga0307498_10032716All Organisms → cellular organisms → Bacteria1293Open in IMG/M
3300031184|Ga0307499_10167687All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium656Open in IMG/M
3300031901|Ga0307406_10066046All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria2353Open in IMG/M
3300032126|Ga0307415_101070707All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium753Open in IMG/M
3300032205|Ga0307472_100789374All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium866Open in IMG/M



 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil27.45%
Populus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere7.84%
Groundwater SedimentEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment5.88%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Soil4.90%
Miscanthus RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere4.90%
Terrestrial SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil3.92%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil3.92%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil3.92%
Corn RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere3.92%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil2.94%
Vadose Zone SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil2.94%
Groundwater SedimentEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment1.96%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil1.96%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere1.96%
Switchgrass RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere1.96%
RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere1.96%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere1.96%
Groundwater SedimentEnvironmental → Aquatic → Freshwater → Sediment → Unclassified → Groundwater Sediment0.98%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil0.98%
Serpentine SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Serpentine Soil0.98%
Surface SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil0.98%
Agricultural SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil0.98%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil0.98%
Hardwood Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil0.98%
SoilEnvironmental → Terrestrial → Soil → Loam → Grasslands → Soil0.98%
Corn RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere0.98%
SoilEnvironmental → Terrestrial → Soil → Loam → Unclassified → Soil0.98%
Switchgrass RhizosphereHost-Associated → Plants → Roots → Rhizosphere → Soil → Switchgrass Rhizosphere0.98%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere0.98%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere0.98%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere0.98%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere0.98%
Arabidopsis RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Arabidopsis Rhizosphere0.98%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
2124908045Soil microbial communities from Great Prairies - Kansas assembly 1 01_01_2011EnvironmentalOpen in IMG/M
3300000550Amended soil microbial communities from Kansas Great Prairies, USA - BrdU amended with acetate total DNA F2.4 TB clc assemlyEnvironmentalOpen in IMG/M
3300000891Soil microbial communities from Great Prairies - Wisconsin, Continuous corn soilEnvironmentalOpen in IMG/M
3300000956Soil microbial communities from Great Prairies - Kansas, Native Prairie soilEnvironmentalOpen in IMG/M
3300004114Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of AARS Block 5EnvironmentalOpen in IMG/M
3300004156Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Combined assembly of AARS Block 1EnvironmentalOpen in IMG/M
3300004157Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - - Combined assembly of AARS Block 2EnvironmentalOpen in IMG/M
3300004479Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of All WPAsEnvironmentalOpen in IMG/M
3300005168Soil and rhizosphere microbial communities from Laval, Canada - mgLPCEnvironmentalOpen in IMG/M
3300005177Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_139EnvironmentalOpen in IMG/M
3300005329Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaGEnvironmentalOpen in IMG/M
3300005334Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2Host-AssociatedOpen in IMG/M
3300005347Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaGHost-AssociatedOpen in IMG/M
3300005440Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaGEnvironmentalOpen in IMG/M
3300005459Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2Host-AssociatedOpen in IMG/M
3300005526Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire. - Coalmine Soil_Cen17_06102014_R1EnvironmentalOpen in IMG/M
3300005549Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaGEnvironmentalOpen in IMG/M
3300005578Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2Host-AssociatedOpen in IMG/M
3300005718Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2Host-AssociatedOpen in IMG/M
3300006575Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtLAA (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300006844Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2Host-AssociatedOpen in IMG/M
3300006854Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD4Host-AssociatedOpen in IMG/M
3300006880Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3Host-AssociatedOpen in IMG/M
3300006881Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2Host-AssociatedOpen in IMG/M
3300006894Agricultural soil microbial communities from Utah to study Nitrogen management - NC ControlEnvironmentalOpen in IMG/M
3300006903Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD5Host-AssociatedOpen in IMG/M
3300006969Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD3Host-AssociatedOpen in IMG/M
3300009137Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_158EnvironmentalOpen in IMG/M
3300009162Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD2Host-AssociatedOpen in IMG/M
3300009174Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaGHost-AssociatedOpen in IMG/M
3300010037Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot25EnvironmentalOpen in IMG/M
3300010047Tropical forest soil microbial communities from Panama - MetaG Plot_30EnvironmentalOpen in IMG/M
3300010323Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Glu_40cm_2_24_1 metaGEnvironmentalOpen in IMG/M
3300010333Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Met_40cm_2_24_1 metaGEnvironmentalOpen in IMG/M
3300010371Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-1EnvironmentalOpen in IMG/M
3300010373Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-4EnvironmentalOpen in IMG/M
3300010400Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-2EnvironmentalOpen in IMG/M
3300011106Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtLMC (Metagenome Metatranscriptome) (version 2)EnvironmentalOpen in IMG/M
3300012204Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_100_16 metaGEnvironmentalOpen in IMG/M
3300012355Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_113_16 metaGEnvironmentalOpen in IMG/M
3300012360Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_113_16 metaGEnvironmentalOpen in IMG/M
3300012901Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S119-311C-1EnvironmentalOpen in IMG/M
3300012904Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S029-104C-1EnvironmentalOpen in IMG/M
3300012910Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S198-509B-2EnvironmentalOpen in IMG/M
3300012911Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S088-202R-2EnvironmentalOpen in IMG/M
3300012951Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_226_MGEnvironmentalOpen in IMG/M
3300012972Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_40cm_5_24_1 metaGEnvironmentalOpen in IMG/M
3300012988Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_242_MGEnvironmentalOpen in IMG/M
3300012989Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_237_MGEnvironmentalOpen in IMG/M
3300014325Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaGHost-AssociatedOpen in IMG/M
3300014969Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaGHost-AssociatedOpen in IMG/M
3300015372Soil combined assemblyHost-AssociatedOpen in IMG/M
3300017659Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Met_40cm_5_24_1 metaGEnvironmentalOpen in IMG/M
3300018028Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_30_coexEnvironmentalOpen in IMG/M
3300018061Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_60_b1EnvironmentalOpen in IMG/M
3300018072Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_30_b2EnvironmentalOpen in IMG/M
3300018075Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3-1_50_b1EnvironmentalOpen in IMG/M
3300018076Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_60_coexEnvironmentalOpen in IMG/M
3300019255Metatranscriptome of groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_60 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300019362Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S104-311B-1 (version 2)EnvironmentalOpen in IMG/M
3300019869Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U3m2EnvironmentalOpen in IMG/M
3300020005Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L3m2EnvironmentalOpen in IMG/M
3300020018Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U2s2EnvironmentalOpen in IMG/M
3300021510Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM2_5_coexEnvironmentalOpen in IMG/M
3300022694Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM2_30_coexEnvironmentalOpen in IMG/M
3300023071Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-S019-104C-5EnvironmentalOpen in IMG/M
3300024055Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-S046-202B-6EnvironmentalOpen in IMG/M
3300025327Soil microbial communities from Rifle, Colorado - Rifle CSP2_sed 13_1 (SPAdes)EnvironmentalOpen in IMG/M
3300025935Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025937Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025938Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300025949Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300025981Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026088Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026116Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026552Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_109 (SPAdes)EnvironmentalOpen in IMG/M
3300027880Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD3 (SPAdes)Host-AssociatedOpen in IMG/M
3300028380Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300028716Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_198EnvironmentalOpen in IMG/M
3300028717Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_158EnvironmentalOpen in IMG/M
3300028718Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_194EnvironmentalOpen in IMG/M
3300028722Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_368EnvironmentalOpen in IMG/M
3300028755Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_356EnvironmentalOpen in IMG/M
3300028778Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_142EnvironmentalOpen in IMG/M
3300028791Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_144EnvironmentalOpen in IMG/M
3300028796Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_141EnvironmentalOpen in IMG/M
3300028811Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_149EnvironmentalOpen in IMG/M
3300028814Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_183EnvironmentalOpen in IMG/M
3300028819Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_153EnvironmentalOpen in IMG/M
3300028876Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_140EnvironmentalOpen in IMG/M
3300028878Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_117EnvironmentalOpen in IMG/M
3300031170Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 12_SEnvironmentalOpen in IMG/M
3300031184Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 13_SEnvironmentalOpen in IMG/M
3300031901Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2Host-AssociatedOpen in IMG/M
3300032126Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2Host-AssociatedOpen in IMG/M
3300032205Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_05EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap



 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
KansclcFeb2_085382402124908045SoilRGVAIEGLAPASVFRIPGHRWMKVKTREGVLRVRALTPTAPLGAFSLGDASASIRTALIRISQDAVFDNWIMRRESSALQWTTCRRDWLPAVGPLELTSSLPFLALAS
F24TB_1127635623300000550SoilAPSWLGHRSRGVAIEGLAPAPVFRISGRGWVKVKTRDGILRVRTLSPTAPLGAFSLRDAWSSIRAALVQHAQDAVFDNWLMRRESAALQWTTCRRDWLPAVGPLELTTELPFLALAS*
JGI10214J12806_1301812613300000891SoilPVFRISGHGWARVKTRDGIIHVRALTPTAPLGAFSLGDAWSSIRAALVRDAQGSVFDNWLMRRESAALQWTTCRKDWLPAVGPLELTTELPFLALAS*
JGI10216J12902_11319588513300000956SoilATPAASWLGHRRRGVAIEGLAPGSVFRLPGHRWVKLKTREGELKVRALTPTAPLGAFSLGDASASIRTALIRISQDAVFDNWLMRRESSALQWTTCRRDWLPAVGPLELTSSLPFLALAS
Ga0062593_10146718813300004114SoilWARVKTRDGIIHVRALTPTAPLGAFSLGDAWSSIRAALVRDAQGSVFDNWLMRRESAALQWTTCRKDWLPAVGPLELTTELPFLALAS*
Ga0062589_10160964223300004156SoilIEGMAPASVFQIPGHRWVKLKTREGEFRVRAVTATAPLGAFSISDARSSIRAALMHISQDEVFDNWLMSRENSALQWSTCRRDWLPAVGPLELSSSLPFLALAS*
Ga0062590_10169930223300004157SoilIEGMAPASVFQIPGHRWVKLKTREGEFRVRAVTATAPLGAFSISDARSSIRAALMHIAQDEVFDNWLMSRENSALQWSTCRRDWLPAVGPLELSSSLPFLALAS*
Ga0062595_10145060423300004479SoilAPGSVFRIPGRRWVKLKTRDGELRVRALTPTAPLGAFSISDAASSIRAALMRIAQDEVFDNWLTSRESSAVQWTTCRRDWLPAIGPNELSSSLPFLALAS*
Ga0066809_1009667623300005168SoilKVKTREGELRVRALTPTAPLGAFSLADAGSSIRAALMRIAQDEVFDNWLMSRENSALQWTTCRRDWLPAVGPLELSSSLPFLALAS*
Ga0066690_1106433213300005177SoilRGVAIEGMAPEAVFGIPTGRRVTLHTREGVLHVRAVGPTAPLGAFTIDAARSSIRAALVHLAKDQAFDNWLVQQESSALAWTTCRRDWLPAVGPLELTTELPFLELAL*
Ga0070683_10068890813300005329Corn RhizosphereEGEFRVRAVTATAPLGAFSISDARSSIRAALMRISQDEVFDNWLMSRENSALQWSTCRRDWLPAVGPLELSSSLPFLALAS*
Ga0068869_10100956013300005334Miscanthus RhizosphereSVFQIPGHRWVKLKTREGEFRVRAVTATAPLGAFSISDARSSIRAALMRISQDEVFDNWLMSRENSALQWSTCRRDWLPAVGPLELSSSLPFLALAS*
Ga0070668_10138839023300005347Switchgrass RhizosphereASWLGHRKRGVAIEGMAPASVFQIPGHRWVKLNTREGEFRVRAVTATAPLGAFSISDARSSIRAALMRISQDEVFDNWLMSRENSALQWSTCRRDWLPAVGPLELSSSLPFLALAS*
Ga0070705_10090941113300005440Corn, Switchgrass And Miscanthus RhizosphereGMAPAPVFRIRGHHWVKLETREGELRVRALTAAAPLGAFSISDARSSIRAALMRISQDEVFDNWLMRRENSALQWSTCRRDWLPAVGPLELTSSLPFLALAS*
Ga0068867_10050443823300005459Miscanthus RhizosphereATVKTRDGIIHVRALTSTAPLGAFSLGDAWSSIRAALVRDAQGSVFDNWLMRRESAALQWTTCRKDWLPAVGPLELTTELPFLALAS*
Ga0073909_1051009813300005526Surface SoilLTPTAPLGAFSLGDAWSSIRAALVQDAQDSVFDNWLMRRESAALQWTTCRKDWLPAVGPLELTTELPFLALAS*
Ga0070704_10193199913300005549Corn, Switchgrass And Miscanthus RhizosphereKTHEGVFHVRALSPTSPLGAFSLASARASIRAALARIAQDQSFDNWLMHKEQGALSRTTCRRDWLPSIGTLELTSELPFLALAS*
Ga0068854_10104284923300005578Corn RhizosphereGVAIEGLAPASVFRISPGRTVTLKTHEGVFHVRAKGPTAPLGAFALSAARASIRAALVRIAQDQSFDNWLMHREQGALSRATCRRDWLPSVGTLELTSELPFLALAS*
Ga0068866_1054800113300005718Miscanthus RhizosphereSVKLKTRDGELRVRALTPTAPLGAFSLPDARSSIRAALMRIAQDEVFDNWLMRRENSALQWTTCRRDWLPAVGPLELSSSLPFLALAS*
Ga0074053_1189942613300006575SoilGWSRVKTRDGILRVRALSPTAPLGAFSLADSWSSIRAALVQDAQDSVFDNWLMRRESAALQWTTCRKDWLPAVGPLELTTELPFLALAS*
Ga0075428_10164938913300006844Populus RhizosphereALGPTAPLGAFSIQAAASSIRAALVRIAQDGVFDNWLMRRESSALAATTCRRDWLPAVGPMELPSELPFLALAS*
Ga0075425_10170934323300006854Populus RhizosphereWATVKTRDGAIRVRALTPTAPLGAFSLGDAWSSIRAALMRDAQGSVFDNWLMRRESAALQWTTCRKDWLPAVGPLELTTELPFLALAS*
Ga0075429_10120067913300006880Populus RhizosphereRLVEATPRQWWLGQRKRGLAIQGLAPAAVFGIPAHKLVTLKTQDGSMKVRALAPIAPLGAFSIQAASASIRAALVRIAQDGVFDNWLMRRESSALAGTTCRRDWLPAIGPMELANELPFLALAN*
Ga0068865_10012767213300006881Miscanthus RhizosphereRWVTLKTRDGELRVRALTPTAPLGAFSISDAASSIRAALMRIAQDEVFDNWLMRRENSALQWTTCRRDWLPAVGPLELSSSLPFLALAS*
Ga0079215_1138559323300006894Agricultural SoilLSPTAPLGAFTLPEAGASIRAALVQIAQDQVFDNWLMRREQSALAWTTCRRDWLPSLGTLELTSELPFLKLVN*
Ga0075426_1145831023300006903Populus RhizosphereISGLAPAPVFQISGHGWTSVKTRDGVVKVRALSPTAPLGAFSLGDAWSSIRAALVQDAQDSVFDNWLMRRESAALQWTTCRKDWLPQVGPLEITTELPFLALAS*
Ga0075419_1046088623300006969Populus RhizosphereFGIPAHKLVTLKTQDGSMKVRALGPIAPLGAFSIQAASASIRAALVRIAQDGVFDNWLMRRESSALAGTTCRRDWLPAIGPMELANELPFLALAN*
Ga0066709_10401315223300009137Grasslands SoilVFGIPLHRWVTLQTREGTIHVRALGPTAPLGTFSIDQATSSIRAALVRIAQDAVFDNWLMRRESAALQWTTCRRDWLPAVGPLELTTELPFLALAS*
Ga0075423_1262377423300009162Populus RhizosphereVAIEGLAPSSVFRIPRGHWVKLKTREGEVRVRALTPTAPLGAFSLADAGSSIRAALMRIAQDEVFDNWLMSRENSALQWTTCRRDWLPAVGPLELSSSLPFLALAS*
Ga0075423_1288000323300009162Populus RhizosphereRGVAIEGMAPASVFQIPGHRWVKLKTREGEFRVRAVTATAPLGAFSISDARSSIRAALMHISQDEVFDNWLMSRENSALQWSTCRRDWLPAVGPLELSSSLPFLALAS*
Ga0105241_1183710513300009174Corn RhizosphereVAIEGLAPSSVLRIPGGRSVKLKTRDGELRVRALTPTAPLGAFSLPDARSSIRAALMRIAQDEVFDNWLMRRENSALQWTTCRRDWLPAVGPLELSSSLPFLALAS*
Ga0126304_1034281913300010037Serpentine SoilLAPAGVFGIPAHKVVTLKAQDGAVKVRALGPTAPLGAFSIQAAASSIRAALVRIAQDGVFDNWLMRRESSALAATTCRRDWLPAVGPMELTSELPFLALAS*
Ga0126382_1060653513300010047Tropical Forest SoilRISGHGWVKVKTRDGVIRVRARTPTAPLGAFSLSDAWSSIRAALVQDAQDSVFDNWLMRRESAALQWTTCRKDWLPQVGPLEITTELPFLALAS*
Ga0134086_1011340813300010323Grasslands SoilLAPAPVFRVSGHGWVKVKTRDGVLRVRALTPTAPLGAFSLSDAWSSIRAALVEHAQDAVFDNWVMRRESAALQWTTCRKDWLPAVGPLELTTELPFLALAS*
Ga0134080_1048827013300010333Grasslands SoilDGVLRVRALSPTAPLGAFSLSDAWSSIRAALVEHAQDAVFDNWVMRRESAALQWTTCRKDWLPAVGPLELTTELPFLALAS*
Ga0134125_1304174213300010371Terrestrial SoilIEGMAPGSVFRIPGRRWVTLKTRDGELRVRALTPTAPLGAFSISDAASSIRAALMRIAQDEVFDNWLTSRESSAVQWTTCRRDWLPAVGPNELSSSLPFLALAS*
Ga0134125_1310595913300010371Terrestrial SoilTRDGELRVRALTPTAPLGAFSIADAASSIRVALMRIAQDEVFDNWLTSRESSAVQWTTCRRDWLPAVGPNELSSSLPFLALAS*
Ga0134128_1107005713300010373Terrestrial SoilREGELRVRALTAAAPLGAFSISDARSSIRAALMRISQDEVFDNWLMRRENSALQWSTCRRDWLPAVGPLELTSSLPFLALAS*
Ga0134122_1248479113300010400Terrestrial SoilGVAIDGLAPASIFRISGGRAVTLKTHEGVFHVRALSPTSPLGAFSLASARASIHAALARIAQDQSFDNWLMHKEQGALSRTTCRRDWLPSIGTLELSSELPFLALAS*
Ga0151489_137164723300011106SoilWLGHRSRGVAIDGLAPAPVFRISGHGWSRVKTRDGILHVRPLSPTAPLGAFSLADSWSSIRAALVQDAQDSVFDNWLMRRESAALQWTTCRKDWLPAVGPLELTTELPFLALAS*
Ga0137374_1096854513300012204Vadose Zone SoilMVHVRALSPTAPLGAFSVSAASASIRAALIRIAQDQVFDNWLMRRESSALAATTCRRDWLPAVGTLELSSALPFLELAN*
Ga0137369_1110947623300012355Vadose Zone SoilFRISGRGWAKVKTRDGVLRVRALSPPAPLGAFSLSDAWPSIRAALVQHAQDAVFDNWLMRRESAALQWTTCRKDWLPAVGPLELTTELPFLALVS*
Ga0137375_1125935413300012360Vadose Zone SoilMAPAAVFRIGRGPFVSLKTREGTLRVRALSPAAPLGAFSLSAASASIRAALVRNAQDEVFDNWLMRRETSALAFTTCRRDWLPAVGTLELTSQLPFLALAS*
Ga0157288_1023460413300012901SoilTREGELRVRALTAAAPLGAFSISDARSSIRAALMRISQDEVFDNWLMRRENSALQWSTCRRDWLPAVGPLELTSSLPFLALAS*
Ga0157282_1023561713300012904SoilMTDGLAPAPVFRISGHGWARVKTRDGIIHVRALTPTAPLGAFSLGDAWSSIRAALVRDTQGSVFDNWLMRRESAALQWTTCRKDWLPA
Ga0157308_1000081583300012910SoilAPAPVFRIRAHHWVKLETREGVLRVRALTAAAPLGAFSISDARSSIRAALMRISQDEVFDNWLMRRENSALQWSTCRRDWLPAVGPLELTSSLPFLALAS*
Ga0157301_1046230823300012911SoilGVAIEGMAPASVFQIPGHRWVKLKTREGEFRVRAVTATAPLGAFSISDARSSIRAALMHISQDEVFDNWLMSRENSALQWSTCRRDWLPAVGPLELSSSLPFLALAS*
Ga0164300_1086375313300012951SoilPAPVFRISGHGWARVKTRDGVIRVRALTPTAPLGAFSLGDAWSSIRAALIQDAQGSVFDNWLMRRESAALQWTTCRKDWLPAVGPLELTTELPFLALAS*
Ga0134077_1025799313300012972Grasslands SoilMAPAAVFRISGRRAVTLHTHEGIIRVRALSPTAPLGAFSLSSASASIRAALGRIAQDQAFDNWLMHRESSALSSTTCRRDWLPSVGTLELTSELPFLALAN*
Ga0164306_1190588513300012988SoilISGHGWSRVKTRDGILRVRALSPTAPLGAFSLADSWSSIRAALVQDAQDSVFDNWLMRRESAALQWTTCRKDWLPAVGPLELTTELPFLALAS*
Ga0164305_1179585423300012989SoilPLTPTAPLGAFSLADAPPSIRAALMRIAQDEVFDNWLMRRENSALQWTTCRRDWLPAVGPLELSSSLPFLALAS*
Ga0163163_1285775313300014325Switchgrass RhizospherePIFRISGHGWVRVKTRDGVIRVRALTPTAPLGAFSLNDAWSSIRAALIEDAQGSVFDNWLMRHESAALQWTTCRKDWLPAVGPLELTTELPFLALAS*
Ga0157376_1283641113300014969Miscanthus RhizosphereGWVRVKTRDGVIRVRALTPTAPLGAFSLNDAWSSIRAALIEDAQGSVFDNWLMRHESAALQWTTCRKDWLPAVGPLELTTELPFLALAS*
Ga0157376_1298163513300014969Miscanthus RhizosphereVKTRDGMIRVRALTPTAPLGAFSLNDAWSSIRAALIQDAQGSVFDNWLMRRESAALQWTTCRKDWLPAVGPLELATELPFLALAS*
Ga0132256_10059094613300015372Arabidopsis RhizosphereHGWVRVKTRDGMIRVRALTPTAPLGAFSLNDAWSSIRAALVQDAQESVFDNWLMRRESAALQWTTCRKDWLPAVGPLELTTELPFLALAS*
Ga0134083_1049119023300017659Grasslands SoilLRVRVLSPTAPLGAFSLSDAWSSIRAALVQHAQDAVFDNWLMRRESAALQWTTCRRDWLPAVGPLELTTELPFLALAS
Ga0184608_1016033223300018028Groundwater SedimentGVLHVRAVGPTAPLGAFALGRARSSIRAALVRASQDQVFDNWLMQREASALQMTTCRRDWLPAVGPLELGNELPFLELAL
Ga0184608_1017694613300018028Groundwater SedimentIDGLAPAPVFRIPGHGWTRVKTRDGVIRVRALTPTAPLGAFSLGDAWSSIRAALVQDAQGSVFDNWLMRRESAALQWTTCRKDWLPAVGPLELTTELPFLALAS
Ga0184619_1031036513300018061Groundwater SedimentMAPAAVFRIARGPFVNLKTREGTLRVRALSPAAPLGAFSLSAASASIRAALVRNAQDDVFDTWLMRRETSELGATTCRRDWLPAVGTLELTSQLPFLDLAS
Ga0184635_1041671623300018072Groundwater SedimentWLGHRSRGVAIDGLAPAPVFRISGHGWTRVKTRDGVIRVRALTPTAPLGAFSLGDAWSSIRAALVQDAQGSVFDNWLMHRESAALQWTTCRKDWLPAVGPLELTTELPFLALAS
Ga0184632_1045753013300018075Groundwater SedimentSRGVAIDGLAPAPVFRISGHGWTRVKTRDGVIRVRALTPTALLGAFSLGDAWSSIRAALVRDAQGSVFDNWLMRRESAALQWTTCRRDWLPAVGPLELTTELPFLALAS
Ga0184609_1007546213300018076Groundwater SedimentVAIQGMAPAAVFRIARGPFVNLKTREGTLRVRALSPAAPLGAFSLSAASASIRAALVRNAQDAVFDNWLMRRETSALAFTTCRRDWLPAVGTLELMSQLPFLALAS
Ga0184643_126194613300019255Groundwater SedimentTATLNTREGVLHVRAAGPTAPLGAFAFGKARSSIRAALVRASQDQVFDNWLMQREASALQMTTCRRDWLPAVGPLELGNELPFLGLAL
Ga0173479_1027239213300019362SoilSWLGHRKRGVAIEGMAPAPVFRIRGHHWVKLETREGELRVRALTAAAPLGAFSISDARSSIRAALMRISQDEVFDNWLMRRENSALQWSTCRRDWLPAVGPLELTSSLPFLALAS
Ga0193705_109937423300019869SoilGAKLQTREGPLHVRALSPTAPLGAFSLSAASASIRAALARNARDGVFDNWLMQRESSALAFTTCRRDWLPAVGTLELTSQLPFLELAN
Ga0193697_109617913300020005SoilGHRIRGVAIDGLAPAPVFRISGHGWTRVKTRDGVIRVRALTPTAPLGAFSLGDAWSSIRAALVQDAQGSVFDNWLMRRESAALQWTTCRKDWLPAVGPLELTTELPFLALAS
Ga0193721_100423353300020018SoilGVAIEGMAPAAVFRIPTGKTATVNTREGVLHVRAAGPTAPLGAFALGRARSSIRAALVRASQDQVFDNWLMQREASALQMTTCRRDWLPAVGPLELGNELPFLGLAL
Ga0222621_109590223300021510Groundwater SedimentPVFRISGHGWTRVKTRDGVIRVRALTPTAPLGAFSLGDAWSSIRAALVQDAQGSVFDNWLMRRESAALQWTTCRKDWLPAVGPLELTTELPFLALAS
Ga0222623_1009531513300022694Groundwater SedimentWLGHRTRGVAIQGMAPAAVFRIARGPFVKLKTREGTLRVRALSPAAPLGAFSLSRASASIRAALVRHAQDEVFDNWLMRRETSALGFTTCRRDWLPAVGTLELTSQLPFLELAS
Ga0247752_104462123300023071SoilSGGRAVTLKTHEGVFHVRALSPTSPLGAFSLASARASIRAALARIAQDQSFDNWLMHKEQGALSRTTCRRDWLPSIGTLELTSELPFLALAS
Ga0247794_1011438113300024055SoilVPAPSWLGHRKRGVAIEGMAPAPVFRIRGHHWVKLETREGELRVRALTAAAPLGAFSISDARSSIRAALMRISQDEVFDNWLMSRENSALQWSTCRRDWLPAVGPLELSSSLPFLALAS
Ga0209751_1134910013300025327SoilHRGVAIEGLAPASVFRIPVNRFSALRTLEGAMRVRALGPTAPLGAFSLATATASIRAALVRIAQEQAFDNWLMRRESSALSVTTCRRDWLPSPGTLELTSELPFLQLAN
Ga0207709_1013414033300025935Miscanthus RhizosphereVAIEGLAPSSVLRIPGGRSVKLKTRDGELSVRALTPTAPLGAFSLADARSSIRAALMRIAQDEVFDNWLMRRENSALQWTTCRRDWLPAVGPLELSSSLPFLALAS
Ga0207669_1187783123300025937Miscanthus RhizosphereTVKTRDGVIHVRALTPTAPLGAFSLGDAWSSIRAALVRDAQGSVFDNWLMRRESAALQWTTCRKDWLPAVGPLELTTELPFLALAS
Ga0207704_1090762323300025938Miscanthus RhizosphereGRRGRGVAIEGLAPSSVLRIPGGRSVKLKTRDGELRVRALTPTAPLGAFSLADARSSIRAALMRIAQDEVFDNWLMRRENSALQWTTCRRDWLPAVGPLELSSSLPFLALAS
Ga0207667_1192031713300025949Corn RhizosphereRAVTATAPLGAFSISDARSSIRAALMHISQDEVFDNWLMSRENSALQWSTCRRDWLPAVGPLELSSSLPFLALAS
Ga0207640_1009358923300025981Corn RhizosphereMAPASVFQIPGHRWVKLKTREGEFRVRAVTATAPLGAFSISDARSSIRAALMHISQDEVFDNWPMSRENSALQWSTCRRDWLPAVGPLELSSSLPFLALAS
Ga0207641_1264073613300026088Switchgrass RhizosphereVRALTPTAPLGAFSLNDAWSSIRAALIEDAQGSVFDNWLMRHESAALQWTTCRKDWLPAVGPLELTTELPFLALAS
Ga0207674_1000930213300026116Corn RhizosphereGELRVRALTPTAPLGAFSLADAGSSIRAALMRIAQDEVFDNWLMSRENSALQWTTCRRDWLPAVGPLELSSSLPFLALAS
Ga0209577_1052934313300026552SoilGVLHVRAVGPTAPLGAFTIDAARSSIRAALVHLAKDQAFDNWLVQQESSALAWTTCRRDWLPAVGPLELTTELPFLELAL
Ga0209481_1065426223300027880Populus RhizosphereGIPAHKLVTLKTQDGSMKVRALGPIAPLGAFSIQAASASIRAALVRIAQDGVFDNWLMRRESSALAGTTCRRDWLPAIGPMELANELPFLALAN
Ga0268265_1079117323300028380Switchgrass RhizosphereVAIEGMAPASVFQIPGHRWVKLKTREGEFRVRAVTATAPLGAFSISDARSSIRAALMHIAQDEVFDNWLMSRENSALQWSTCRRDWLPAVGPLELSSSLPFLALAS
Ga0307311_1020933523300028716SoilRISGHGRTRVKTRDGVIRVRALTPTAPLGAFSLGDAWSSIRAALVQDAQGSVFDNWLMRRESAALQWTTCRKDWLPAVGPLELTTELPFLALAS
Ga0307298_1002617233300028717SoilNTREGVLHVRAVGPTAPLGAFALGRARSSIRAALVRASQDQVFDNWLMQREASALQMTTCRRDWLPAVGPLELGNELPFLELAL
Ga0307307_1002577423300028718SoilVKTRDGVIRVRALTPTAPLGAFSLGDAWSSIRAALVQDAQGSVFDNWLMRRESAALQWTTCRKDWLPAVGPLELTTELPFLALAS
Ga0307319_1015279223300028722SoilPLRVRALSPTAQLGAFSLSAASASIRAALARNARDGVFDNWLMQRESSALAFTTCRRDWLPAVGTLELTSQLPFLELAN
Ga0307316_1014329523300028755SoilFRISGHSWTRVKTRDGIIRVRALTPTAPLGAFSLGDAWSSIRAALVQDAQGSVFDNWLMRRESAALQWTTCRKDWLPAVGPLELTTELPFLALAS
Ga0307288_1042290213300028778SoilRVRALTPTAPLGAFSLGDAWSSIRAALVQDAQGSVFDNWLMRRESAALQWTTCRKDWLPAVGPLELTTELPFLALAS
Ga0307290_1006148313300028791SoilGVAIDGLAPAPVFRISGHGRTRVKTRDGVIRVRALTPTAPLGAFSLGDAWSSIRAALVQDAQGSVFDNWLMRRESAALQWTTCRKDWLPAVGPLELTTELPFLALAS
Ga0307287_1007906323300028796SoilVAIESMAPAAVFRIPTGKTATVNTREGVLHVRAVGPTAPLGAFALGRARSSIRAALVRASQDQVFDNWLMQREASALQMTTCRRDWLPAVGPLELGNELPFLELAL
Ga0307292_1047218823300028811SoilRWVKLKTRDGELHVRALTPTAPLGAFSISDAASSIRAALMRIAQDEVFDNWLTSRESSAVQWTTCRRDWLPAVGPNELSSSLPFLALAS
Ga0307302_1014010823300028814SoilGGRGAKLQTREGPLHVRALSPTAPLGAFSLSAASASIRAALARNARDGVFDNWLMQRESSALAFTTCRRDWLPAVGTLELTSQLPFLELAN
Ga0307296_1031605723300028819SoilWLGHRSRGVAIQGMAPAAVFRIARGPFVNLKTREGTLRVRALSPGAPLGAFSLSAASASIRAALVRNAQDEVFDNWLMRREANALAATTCRRDWLPAVGTLELTSQLPFLALAS
Ga0307286_1004783323300028876SoilAPSWLGRRHRGVAIEGMAPASVFRIPGHRWVKLKTREGDLRVRALTPTAPLGAFSLPDASSSIRAALTRIAQDEVFDNWLISRENSALQWTTCRRDWLPAVGPLELTSSLPFLALAS
Ga0307278_1007831533300028878SoilVFRIARGPFVTLKTREGTLRVRALSPAAPLGAFSLSAASASIRAALVRNAQDDVFDNWLMRREASALGATTCRRDWLPAVGTLELTSELPFLELAS
Ga0307278_1046653423300028878SoilNLKTREGTLRVRALSPAAPLGAFSLSAASASIRAALVRNAQDDVFDTWLMRRETSALGATTCRRDWLPAVGTLELTSQLPFLDLAS
Ga0307278_1050864923300028878SoilRNGVLRVRALSPTAPLGAFSLSDAWSSIRAALVQHAQDAVFDNWLMRRESAALQWTTCRKDWLPAVGPLELTTELPFLALAS
Ga0307498_1003271613300031170SoilHGWARVKTRDGVIRVRALTPTAPLGAFSLGDAWSSIRAALVQDAQGSVFDNWLMRRESAALQWTTCRKDWLPAVGPLELTTELPFLALAS
Ga0307499_1016768713300031184SoilTRDGVISVRALTPTAPLGAFSLGDAWSSIRAALVQDAQGSVFDNWLMRRESAALQWTTCRKDWLPAVGPLELTTELPFLALAS
Ga0307406_1006604643300031901RhizosphereVLKVRALGPTAPLGAFSIQAATASIRAALVRIAQDGVFDNWIMQRESAALAGTTCRRDWLPERGPMELTSELPFLALAN
Ga0307415_10107070723300032126RhizosphereDGLAPAAVFRLPARKWVTLTPLDGVLKVRALGPTAPLGAFSIQAATASIRAALVRIAQDGVFDNWIMQRESAALAGTTCRRDWLPERGPMELTSELPFLALAN
Ga0307472_10078937423300032205Hardwood Forest SoilYYTLNPNTTLFQTSSGDAIDGLAPAPIFRISGHGWVKVKTRDGVVRVRARTPTAPLGAFSLSDAWSSIRAALVQDAQDAVFDNWLMRRESAALQWTTCRKDWLPAVGPLEITTELPFLALAS


 ⦗Top⦘


© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.