| Basic Information | |
|---|---|
| Family ID | F101106 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 102 |
| Average Sequence Length | 37 residues |
| Representative Sequence | VLHWKPRLVAIAAVLALVLVALGGLGIEVDYNLYW |
| Number of Associated Samples | 91 |
| Number of Associated Scaffolds | 102 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 61.76 % |
| % of genes near scaffold ends (potentially truncated) | 21.57 % |
| % of genes from short scaffolds (< 2000 bps) | 83.33 % |
| Associated GOLD sequencing projects | 87 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.48 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (100.000 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil (20.588 % of family members) |
| Environment Ontology (ENVO) | Unclassified (23.529 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (48.039 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 46.03% β-sheet: 0.00% Coil/Unstructured: 53.97% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.48 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 102 Family Scaffolds |
|---|---|---|
| PF00877 | NLPC_P60 | 47.06 |
| PF00990 | GGDEF | 8.82 |
| PF01966 | HD | 4.90 |
| PF02786 | CPSase_L_D2 | 3.92 |
| PF04191 | PEMT | 0.98 |
| PF08442 | ATP-grasp_2 | 0.98 |
| PF10958 | DUF2759 | 0.98 |
| PF01066 | CDP-OH_P_transf | 0.98 |
| PF16655 | PhoD_N | 0.98 |
| PF01039 | Carboxyl_trans | 0.98 |
| COG ID | Name | Functional Category | % Frequency in 102 Family Scaffolds |
|---|---|---|---|
| COG0791 | Cell wall-associated hydrolase, NlpC_P60 family | Cell wall/membrane/envelope biogenesis [M] | 47.06 |
| COG0458 | Carbamoylphosphate synthase large subunit | Amino acid transport and metabolism [E] | 1.96 |
| COG0026 | Phosphoribosylaminoimidazole carboxylase (NCAIR synthetase) | Nucleotide transport and metabolism [F] | 0.98 |
| COG0045 | Succinyl-CoA synthetase, beta subunit | Energy production and conversion [C] | 0.98 |
| COG0151 | Phosphoribosylamine-glycine ligase | Nucleotide transport and metabolism [F] | 0.98 |
| COG0558 | Phosphatidylglycerophosphate synthase | Lipid transport and metabolism [I] | 0.98 |
| COG0777 | Acetyl-CoA carboxylase beta subunit | Lipid transport and metabolism [I] | 0.98 |
| COG0825 | Acetyl-CoA carboxylase alpha subunit | Lipid transport and metabolism [I] | 0.98 |
| COG1042 | Acyl-CoA synthetase (NDP forming) | Energy production and conversion [C] | 0.98 |
| COG1183 | Phosphatidylserine synthase | Lipid transport and metabolism [I] | 0.98 |
| COG4799 | Acetyl-CoA carboxylase, carboxyltransferase component | Lipid transport and metabolism [I] | 0.98 |
| COG5050 | sn-1,2-diacylglycerol ethanolamine- and cholinephosphotranferases | Lipid transport and metabolism [I] | 0.98 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 100.00 % |
| Unclassified | root | N/A | 0.00 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 2035918004|FACENC_F56XM5W01DQSY9 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 509 | Open in IMG/M |
| 2228664021|ICCgaii200_c0914315 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1901 | Open in IMG/M |
| 3300000956|JGI10216J12902_105477019 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1051 | Open in IMG/M |
| 3300001686|C688J18823_10270971 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1122 | Open in IMG/M |
| 3300005441|Ga0070700_100946123 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 705 | Open in IMG/M |
| 3300005526|Ga0073909_10005937 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 3600 | Open in IMG/M |
| 3300005526|Ga0073909_10037938 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1690 | Open in IMG/M |
| 3300005543|Ga0070672_100981562 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 748 | Open in IMG/M |
| 3300005614|Ga0068856_100071387 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 3437 | Open in IMG/M |
| 3300005618|Ga0068864_100207897 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1801 | Open in IMG/M |
| 3300005713|Ga0066905_100790195 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 822 | Open in IMG/M |
| 3300005718|Ga0068866_10546832 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 774 | Open in IMG/M |
| 3300005719|Ga0068861_100291113 | All Organisms → cellular organisms → Bacteria | 1410 | Open in IMG/M |
| 3300005764|Ga0066903_100139293 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 3444 | Open in IMG/M |
| 3300005764|Ga0066903_100629158 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1869 | Open in IMG/M |
| 3300005764|Ga0066903_104330397 | All Organisms → cellular organisms → Bacteria | 759 | Open in IMG/M |
| 3300005841|Ga0068863_100906038 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 882 | Open in IMG/M |
| 3300005937|Ga0081455_10005409 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 14018 | Open in IMG/M |
| 3300005983|Ga0081540_1007772 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia | 7590 | Open in IMG/M |
| 3300005983|Ga0081540_1031831 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2891 | Open in IMG/M |
| 3300006579|Ga0074054_11739229 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 559 | Open in IMG/M |
| 3300006794|Ga0066658_10943759 | All Organisms → cellular organisms → Bacteria | 500 | Open in IMG/M |
| 3300006806|Ga0079220_11704406 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 551 | Open in IMG/M |
| 3300006852|Ga0075433_11088860 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 695 | Open in IMG/M |
| 3300006871|Ga0075434_100410635 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1375 | Open in IMG/M |
| 3300009093|Ga0105240_10697917 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1108 | Open in IMG/M |
| 3300009094|Ga0111539_10194141 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2368 | Open in IMG/M |
| 3300009101|Ga0105247_11218256 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 600 | Open in IMG/M |
| 3300009840|Ga0126313_10012146 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 5492 | Open in IMG/M |
| 3300009840|Ga0126313_10463895 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1011 | Open in IMG/M |
| 3300009840|Ga0126313_11172826 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 632 | Open in IMG/M |
| 3300010036|Ga0126305_10546759 | All Organisms → cellular organisms → Bacteria | 775 | Open in IMG/M |
| 3300010039|Ga0126309_10063008 | All Organisms → cellular organisms → Bacteria | 1812 | Open in IMG/M |
| 3300010041|Ga0126312_10130370 | All Organisms → cellular organisms → Bacteria | 1736 | Open in IMG/M |
| 3300010047|Ga0126382_10347906 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1134 | Open in IMG/M |
| 3300010047|Ga0126382_10965793 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 743 | Open in IMG/M |
| 3300010047|Ga0126382_12187389 | All Organisms → cellular organisms → Bacteria | 532 | Open in IMG/M |
| 3300010359|Ga0126376_10823941 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 909 | Open in IMG/M |
| 3300010360|Ga0126372_10415878 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1233 | Open in IMG/M |
| 3300010371|Ga0134125_11265359 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 805 | Open in IMG/M |
| 3300011000|Ga0138513_100033655 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 752 | Open in IMG/M |
| 3300012208|Ga0137376_10556745 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 993 | Open in IMG/M |
| 3300012487|Ga0157321_1023842 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 580 | Open in IMG/M |
| 3300012505|Ga0157339_1030700 | All Organisms → cellular organisms → Bacteria | 627 | Open in IMG/M |
| 3300012882|Ga0157304_1040449 | All Organisms → cellular organisms → Bacteria | 682 | Open in IMG/M |
| 3300012899|Ga0157299_10009871 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1593 | Open in IMG/M |
| 3300012900|Ga0157292_10411378 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 515 | Open in IMG/M |
| 3300012905|Ga0157296_10008316 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1694 | Open in IMG/M |
| 3300012915|Ga0157302_10378746 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 576 | Open in IMG/M |
| 3300012948|Ga0126375_10135823 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1526 | Open in IMG/M |
| 3300012948|Ga0126375_12112346 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 501 | Open in IMG/M |
| 3300014497|Ga0182008_10580322 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 627 | Open in IMG/M |
| 3300015077|Ga0173483_10479000 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 658 | Open in IMG/M |
| 3300015262|Ga0182007_10128204 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 852 | Open in IMG/M |
| 3300015371|Ga0132258_13622172 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1056 | Open in IMG/M |
| 3300015372|Ga0132256_100425335 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1432 | Open in IMG/M |
| 3300015373|Ga0132257_100030699 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 5812 | Open in IMG/M |
| 3300015373|Ga0132257_100884926 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1118 | Open in IMG/M |
| 3300017792|Ga0163161_11602084 | All Organisms → cellular organisms → Bacteria | 574 | Open in IMG/M |
| 3300018027|Ga0184605_10007614 | All Organisms → cellular organisms → Bacteria | 4026 | Open in IMG/M |
| 3300018028|Ga0184608_10140945 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1034 | Open in IMG/M |
| 3300018072|Ga0184635_10210421 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 774 | Open in IMG/M |
| 3300018073|Ga0184624_10044931 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1767 | Open in IMG/M |
| 3300018433|Ga0066667_11052856 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 703 | Open in IMG/M |
| 3300018465|Ga0190269_11044991 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 623 | Open in IMG/M |
| 3300019279|Ga0184642_1603314 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 730 | Open in IMG/M |
| 3300019356|Ga0173481_10138986 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 988 | Open in IMG/M |
| 3300019868|Ga0193720_1060868 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 522 | Open in IMG/M |
| 3300019875|Ga0193701_1031595 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1086 | Open in IMG/M |
| 3300020004|Ga0193755_1091219 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 970 | Open in IMG/M |
| 3300020059|Ga0193745_1027652 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1244 | Open in IMG/M |
| 3300021445|Ga0182009_10464492 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 663 | Open in IMG/M |
| 3300023071|Ga0247752_1005785 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1642 | Open in IMG/M |
| 3300024055|Ga0247794_10010854 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2108 | Open in IMG/M |
| 3300024310|Ga0247681_1028893 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 816 | Open in IMG/M |
| 3300025552|Ga0210142_1032642 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 992 | Open in IMG/M |
| 3300025899|Ga0207642_10087065 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1533 | Open in IMG/M |
| 3300025901|Ga0207688_10506186 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 757 | Open in IMG/M |
| 3300025919|Ga0207657_10157621 | All Organisms → cellular organisms → Bacteria | 1845 | Open in IMG/M |
| 3300025940|Ga0207691_10426407 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1130 | Open in IMG/M |
| 3300026041|Ga0207639_10059785 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2937 | Open in IMG/M |
| 3300026095|Ga0207676_10141176 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2062 | Open in IMG/M |
| 3300027787|Ga0209074_10476524 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 537 | Open in IMG/M |
| 3300027821|Ga0209811_10087841 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1105 | Open in IMG/M |
| 3300027874|Ga0209465_10623009 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 533 | Open in IMG/M |
| 3300027909|Ga0209382_10212935 | All Organisms → cellular organisms → Bacteria | 2209 | Open in IMG/M |
| 3300028711|Ga0307293_10243554 | All Organisms → cellular organisms → Bacteria | 571 | Open in IMG/M |
| 3300028712|Ga0307285_10023520 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1433 | Open in IMG/M |
| 3300028744|Ga0307318_10022538 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2032 | Open in IMG/M |
| 3300028768|Ga0307280_10373875 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 528 | Open in IMG/M |
| 3300028791|Ga0307290_10031150 | All Organisms → cellular organisms → Bacteria | 1892 | Open in IMG/M |
| 3300028799|Ga0307284_10044975 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1533 | Open in IMG/M |
| 3300028872|Ga0307314_10074223 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 892 | Open in IMG/M |
| 3300028878|Ga0307278_10186055 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 927 | Open in IMG/M |
| 3300030336|Ga0247826_11597244 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 531 | Open in IMG/M |
| 3300030511|Ga0268241_10013630 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1541 | Open in IMG/M |
| 3300031093|Ga0308197_10079004 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 926 | Open in IMG/M |
| 3300031938|Ga0308175_100081656 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2917 | Open in IMG/M |
| 3300031938|Ga0308175_100325362 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1578 | Open in IMG/M |
| 3300031995|Ga0307409_100119554 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2228 | Open in IMG/M |
| 3300031996|Ga0308176_11473168 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 725 | Open in IMG/M |
| 3300034172|Ga0334913_018536 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1570 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 20.59% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 6.86% |
| Serpentine Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Serpentine Soil | 5.88% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 4.90% |
| Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 3.92% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 3.92% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 3.92% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 3.92% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 3.92% |
| Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 2.94% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 2.94% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 2.94% |
| Tabebuia Heterophylla Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Tabebuia Heterophylla Rhizosphere | 2.94% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 1.96% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 1.96% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 1.96% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 1.96% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Rhizosphere | 1.96% |
| Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere | 1.96% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere | 1.96% |
| Groundwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Groundwater Sediment | 0.98% |
| Natural And Restored Wetlands | Environmental → Aquatic → Marine → Wetlands → Unclassified → Natural And Restored Wetlands | 0.98% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 0.98% |
| Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 0.98% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 0.98% |
| Sub-Biocrust Soil | Environmental → Terrestrial → Soil → Unclassified → Desert → Sub-Biocrust Soil | 0.98% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 0.98% |
| Soil | Environmental → Terrestrial → Soil → Loam → Grasslands → Soil | 0.98% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 0.98% |
| Soil | Environmental → Terrestrial → Agricultural Field → Unclassified → Unclassified → Soil | 0.98% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn, Switchgrass And Miscanthus Rhizosphere | 0.98% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 0.98% |
| Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere | 0.98% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.98% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 0.98% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere | 0.98% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Arabidopsis Rhizosphere | 0.98% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 2035918004 | Soil microbial communities from sample at FACE Site 2 North Carolina CO2- | Environmental | Open in IMG/M |
| 2228664021 | Soil microbial communities from Great Prairies - Iowa, Continuous Corn soil | Environmental | Open in IMG/M |
| 3300000956 | Soil microbial communities from Great Prairies - Kansas, Native Prairie soil | Environmental | Open in IMG/M |
| 3300001686 | Grasslands soil microbial communities from Hopland, California, USA | Environmental | Open in IMG/M |
| 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Environmental | Open in IMG/M |
| 3300005526 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire. - Coalmine Soil_Cen17_06102014_R1 | Environmental | Open in IMG/M |
| 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Host-Associated | Open in IMG/M |
| 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Host-Associated | Open in IMG/M |
| 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Host-Associated | Open in IMG/M |
| 3300005713 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 36 (version 2) | Environmental | Open in IMG/M |
| 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Host-Associated | Open in IMG/M |
| 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Host-Associated | Open in IMG/M |
| 3300005764 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2) | Environmental | Open in IMG/M |
| 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Host-Associated | Open in IMG/M |
| 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Host-Associated | Open in IMG/M |
| 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Host-Associated | Open in IMG/M |
| 3300006579 | Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtLAB (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300006794 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_107 | Environmental | Open in IMG/M |
| 3300006806 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS100 | Environmental | Open in IMG/M |
| 3300006852 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Host-Associated | Open in IMG/M |
| 3300006871 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Host-Associated | Open in IMG/M |
| 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Host-Associated | Open in IMG/M |
| 3300009094 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) | Host-Associated | Open in IMG/M |
| 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Host-Associated | Open in IMG/M |
| 3300009840 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot105A | Environmental | Open in IMG/M |
| 3300010036 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot26 | Environmental | Open in IMG/M |
| 3300010039 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot56 | Environmental | Open in IMG/M |
| 3300010041 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot104A | Environmental | Open in IMG/M |
| 3300010047 | Tropical forest soil microbial communities from Panama - MetaG Plot_30 | Environmental | Open in IMG/M |
| 3300010359 | Tropical forest soil microbial communities from Panama - MetaG Plot_15 | Environmental | Open in IMG/M |
| 3300010360 | Tropical forest soil microbial communities from Panama - MetaG Plot_6 | Environmental | Open in IMG/M |
| 3300010371 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-1 | Environmental | Open in IMG/M |
| 3300011000 | Agricultural soil microbial communities from Tamara ranch near Red Deer, Alberta, Canada - d1t6i015 | Environmental | Open in IMG/M |
| 3300012208 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_20_16 metaG | Environmental | Open in IMG/M |
| 3300012487 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.4.old.130510 | Host-Associated | Open in IMG/M |
| 3300012505 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.10.yng.090610 | Host-Associated | Open in IMG/M |
| 3300012882 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S133-311R-2 | Environmental | Open in IMG/M |
| 3300012899 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S058-202B-2 | Environmental | Open in IMG/M |
| 3300012900 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S179-409R-1 | Environmental | Open in IMG/M |
| 3300012905 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S013-104B-2 | Environmental | Open in IMG/M |
| 3300012915 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S103-311B-2 | Environmental | Open in IMG/M |
| 3300012948 | Tropical forest soil microbial communities from Panama - MetaG Plot_14 | Environmental | Open in IMG/M |
| 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Host-Associated | Open in IMG/M |
| 3300015077 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S178-409R-2 (version 2) | Environmental | Open in IMG/M |
| 3300015262 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG | Host-Associated | Open in IMG/M |
| 3300015371 | Combined assembly of cpr5 and col0 rhizosphere and soil | Host-Associated | Open in IMG/M |
| 3300015372 | Soil combined assembly | Host-Associated | Open in IMG/M |
| 3300015373 | Combined assembly of cpr5 rhizosphere | Host-Associated | Open in IMG/M |
| 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Host-Associated | Open in IMG/M |
| 3300018027 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_30_coex | Environmental | Open in IMG/M |
| 3300018028 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_30_coex | Environmental | Open in IMG/M |
| 3300018072 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_30_b2 | Environmental | Open in IMG/M |
| 3300018073 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_5_b1 | Environmental | Open in IMG/M |
| 3300018433 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_116 | Environmental | Open in IMG/M |
| 3300018465 | Populus adjacent soil microbial communities from riparian zone of Blue River, Arizona, USA - 249 IS | Environmental | Open in IMG/M |
| 3300019279 | Metatranscriptome of groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_30 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300019356 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S073-202C-2 (version 2) | Environmental | Open in IMG/M |
| 3300019868 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U2s1 | Environmental | Open in IMG/M |
| 3300019875 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U3s2 | Environmental | Open in IMG/M |
| 3300020004 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? H1a2 | Environmental | Open in IMG/M |
| 3300020059 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L1a2 | Environmental | Open in IMG/M |
| 3300021445 | Bulk soil microbial communities from the field in Mead, Nebraska, USA - 072115-187_1 MetaG | Environmental | Open in IMG/M |
| 3300023071 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-S019-104C-5 | Environmental | Open in IMG/M |
| 3300024055 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-S046-202B-6 | Environmental | Open in IMG/M |
| 3300024310 | Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK22 | Environmental | Open in IMG/M |
| 3300025552 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - Goodyear_PhragC_D2 (SPAdes) | Environmental | Open in IMG/M |
| 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300027787 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Plitter (SPAdes) | Environmental | Open in IMG/M |
| 3300027821 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire. - Coalmine Soil_Cen17_06102014_R1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027874 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 1 MoBio (SPAdes) | Environmental | Open in IMG/M |
| 3300027909 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD5 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300028711 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_150 | Environmental | Open in IMG/M |
| 3300028712 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_139 | Environmental | Open in IMG/M |
| 3300028744 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_367 | Environmental | Open in IMG/M |
| 3300028768 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_119 | Environmental | Open in IMG/M |
| 3300028791 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_144 | Environmental | Open in IMG/M |
| 3300028799 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_123 | Environmental | Open in IMG/M |
| 3300028872 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_204 | Environmental | Open in IMG/M |
| 3300028878 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_117 | Environmental | Open in IMG/M |
| 3300030336 | Soil microbial communities from agricultural site in Penn Yan, New York, United States - 12C_Control_Day1 | Environmental | Open in IMG/M |
| 3300030511 | Bulk soil microbial communities from Mexico - Amatitan (Am) metaG (v2) | Environmental | Open in IMG/M |
| 3300031093 | Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_198 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031938 | Soil microbial communities from UC Gill Tract Community Farm, Albany, California, United States - DLSLS.C.R1 | Environmental | Open in IMG/M |
| 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Host-Associated | Open in IMG/M |
| 3300031996 | Soil microbial communities from UC Gill Tract Community Farm, Albany, California, United States - DLSLS.C.R2 | Environmental | Open in IMG/M |
| 3300034172 | Sub-biocrust soil microbial communities from Mojave Desert, California, United States - 9HMS | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| FACENCA_4714320 | 2035918004 | Soil | GEVDVLHWKPRLVALTALLALVLIALAGLGTEIAYNLYW |
| ICCgaii200_09143153 | 2228664021 | Soil | VLHWKPRLVAIAVVLALVLVALGGLGIEVSENYNLYW |
| JGI10216J12902_1054770191 | 3300000956 | Soil | LHWSPRLVALAAALALVLLVLGGLGFEEPYNLYW* |
| C688J18823_102709712 | 3300001686 | Soil | LTLLHWKPRLVALAAVLALVLVALAGLGIELTYNLYW* |
| Ga0070700_1009461231 | 3300005441 | Corn, Switchgrass And Miscanthus Rhizosphere | QGRLKLLHWSPRLVALVAVLALVLIALGGLAEELTYNLYW* |
| Ga0073909_100059375 | 3300005526 | Surface Soil | VLHWSPRVVALVAVLALVLIALGGLAEELTYNLYW* |
| Ga0073909_100379383 | 3300005526 | Surface Soil | MLHWSPRLVALVAVLALVLIALGGLAEELTYNLYW* |
| Ga0070672_1009815621 | 3300005543 | Miscanthus Rhizosphere | LLHWSPRLVALVAVLALVLIALGGLAEELTYNLYW* |
| Ga0068856_1000713872 | 3300005614 | Corn Rhizosphere | VLHWKPRLVALTAVLALVLIALAGLGTEIAYNLYW* |
| Ga0068864_1002078972 | 3300005618 | Switchgrass Rhizosphere | TLGRLKLLHWSPRLVALAAVLALVLLALGGLGIEAPYNLYW* |
| Ga0066905_1007901952 | 3300005713 | Tropical Forest Soil | LHWKPRLVAIAVILALVLVALGGLGIEVVESYNLYW* |
| Ga0068866_105468322 | 3300005718 | Miscanthus Rhizosphere | LKLLHWSPRLVALVAVLALVLIALGGLAEELTYNLYW* |
| Ga0068861_1002911132 | 3300005719 | Switchgrass Rhizosphere | VLHWKPRLVAIAVVLALVLVALGGLGIEVGENYNLYW* |
| Ga0066903_1001392932 | 3300005764 | Tropical Forest Soil | VLHWKPRLVALTAVLALVLIALAGLGVEFAYNLYW* |
| Ga0066903_1006291582 | 3300005764 | Tropical Forest Soil | VLHWKPRLVAIAVVLALVLVALSGLGIEVVESYNLYW* |
| Ga0066903_1043303971 | 3300005764 | Tropical Forest Soil | SWGRFQVLHWKPRLVAIAVVLALVLVALGGLGIEVGEYYNLYW* |
| Ga0068863_1009060382 | 3300005841 | Switchgrass Rhizosphere | LKLLHWSPRLVALAAVLALVLLALGGLGIEAPYNLYW* |
| Ga0081455_100054096 | 3300005937 | Tabebuia Heterophylla Rhizosphere | VLHWKPRLVAIAVVLALVLVALSGLGTEVVESYNLYW* |
| Ga0081540_10077722 | 3300005983 | Tabebuia Heterophylla Rhizosphere | VLHWKPRLVAIAVVLALVLVAFGGLGIEVGESYNLYW* |
| Ga0081540_10318311 | 3300005983 | Tabebuia Heterophylla Rhizosphere | VLHWKPRLVAIAVVLALVLVALGGLGIEVGEYYNLYW* |
| Ga0074054_117392292 | 3300006579 | Soil | LTLLHWSPRVVALVAVLALVLIALGGLAEELTYNLYW* |
| Ga0066658_109437592 | 3300006794 | Soil | LLHWKPRLVALAAVLALVLVALAGLGIELTYNLYW* |
| Ga0079220_117044062 | 3300006806 | Agricultural Soil | VLHWKPRIVALVAVLALVAIVLAGLGVEISYILYW* |
| Ga0075433_110888602 | 3300006852 | Populus Rhizosphere | RLKLLHWSPRLVALVAVLALVLIALGGLAEELTYNLYW* |
| Ga0075434_1004106353 | 3300006871 | Populus Rhizosphere | VGRFTLLHWKPRLVAIAAVLALMLVALGGLAGELIEYNLYW* |
| Ga0105240_106979172 | 3300009093 | Corn Rhizosphere | LIVLHWSPRVVALVAVLALVLIALGGLAEELTYNLYW* |
| Ga0111539_101941414 | 3300009094 | Populus Rhizosphere | LHWKPRLVAIAVVLALVLVALGGLGIEVGENYNLYW* |
| Ga0105247_112182562 | 3300009101 | Switchgrass Rhizosphere | LHWSPRLVALAAVLALVLLALGGLGIEAPYNLYW* |
| Ga0126313_100121465 | 3300009840 | Serpentine Soil | LLHWKPRLVAIAAVLALVLVALAGLGYELAYNLYW* |
| Ga0126313_104638952 | 3300009840 | Serpentine Soil | VLHWSPRLVALAAALALILIAFGGLGIDEPYNLYW* |
| Ga0126313_111728262 | 3300009840 | Serpentine Soil | VLHWKPRLVVIAAVLALVLVALGGLGIEVDYNLYW* |
| Ga0126305_105467591 | 3300010036 | Serpentine Soil | MLHWKPRLVAIAAVLALVLVALGGLGIEVDYNLYW* |
| Ga0126309_100630082 | 3300010039 | Serpentine Soil | MLHWNPRLVALTAAVVLILVALAGLGIETAYNLYW* |
| Ga0126312_101303702 | 3300010041 | Serpentine Soil | VLHWKPRLVAIAAVLALVLVALGGLGIEVDYNLYW* |
| Ga0126382_103479062 | 3300010047 | Tropical Forest Soil | LHWKPRLVAIAVVLVLVLIALGGLGIEVDYNLYW* |
| Ga0126382_109657932 | 3300010047 | Tropical Forest Soil | CNPSWGRFQVLHWKPRLVAIAIVLALVLVALSGLGIEVVESYNLYW* |
| Ga0126382_121873892 | 3300010047 | Tropical Forest Soil | LHWKPRLVAIAVVLALVLVALSGLGIEVVESYNLYW* |
| Ga0126376_108239411 | 3300010359 | Tropical Forest Soil | VLHWKPRLVALTAVLALVLIALGGLGTEIAYNLYW* |
| Ga0126372_104158782 | 3300010360 | Tropical Forest Soil | VLHWKPRLVALTALLALVLIALAGLGAEIAYNLYW* |
| Ga0134125_112653592 | 3300010371 | Terrestrial Soil | LGRLKLLHWRARLIALAAVLALILVALGGLGIEVPYNLYW* |
| Ga0138513_1000336551 | 3300011000 | Soil | LLHWKPRLVAIAVVLALVLIALGGLGIEVDYNLYW* |
| Ga0137376_105567453 | 3300012208 | Vadose Zone Soil | LKLLHWSPRLVALVAVLALVLIALGGLAEELTYNLY |
| Ga0157321_10238422 | 3300012487 | Arabidopsis Rhizosphere | VGRFTLLHWKPRLVAIAAVLALMLVALGGLAVELIEYNLYW* |
| Ga0157339_10307002 | 3300012505 | Arabidopsis Rhizosphere | LLHWKPRLVAIAAVLALMLVALGGLAVELIEYNLYW* |
| Ga0157304_10404492 | 3300012882 | Soil | LHWKPRLVAIAVVLALVLVALGGLGIEVDYNLYW* |
| Ga0157299_100098712 | 3300012899 | Soil | LHWKPRLVASAVVLALVLVALGGLGIEVGENYNLYW* |
| Ga0157292_104113782 | 3300012900 | Soil | LLHWKPRLVAIAVVLALVLVALGGLGIEVGENYNLYW* |
| Ga0157296_100083162 | 3300012905 | Soil | LHWKPRLVAIAVVQALVLVALGGLGIEVGENYNLYW* |
| Ga0157302_103787462 | 3300012915 | Soil | VLHWKPRLVALTALLALVLIALAGLGTEIAYNLYW* |
| Ga0126375_101358232 | 3300012948 | Tropical Forest Soil | LLHWKPRLVAIAVVLVLVLIALGGLGIEVDYNLYW* |
| Ga0126375_121123461 | 3300012948 | Tropical Forest Soil | LHWKPRLVAIAVVLALVLVALGGLGIEVGEYYNLYW* |
| Ga0182008_105803221 | 3300014497 | Rhizosphere | LLHWKPRLVAIAAVLALVLLALGGLGIEVDYNLYW* |
| Ga0173483_104790002 | 3300015077 | Soil | LLHWKPRLVAIAVVLALVLVALGGLGIEVDYNLYW* |
| Ga0182007_101282041 | 3300015262 | Rhizosphere | KLLHWSPRLVALVAVLALVLIALGGLAEELTYNLYW* |
| Ga0132258_136221722 | 3300015371 | Arabidopsis Rhizosphere | WGRFTLLHWKPRLVAIAVVLVLVLVALGGLGIEVDYNLYW* |
| Ga0132256_1004253351 | 3300015372 | Arabidopsis Rhizosphere | LLHWKPRLVAIAVVLVLVLVALGGLGIEADYNLYW* |
| Ga0132257_1000306996 | 3300015373 | Arabidopsis Rhizosphere | LLHWKPRLVAIAVVLVLVLVALGGLGIEVDYNLYW* |
| Ga0132257_1008849261 | 3300015373 | Arabidopsis Rhizosphere | VGRFTLLHWKPRLVAIAAVLALMLVALGGLAVELVEYNLYW* |
| Ga0163161_116020842 | 3300017792 | Switchgrass Rhizosphere | LHWKPRLVAIAVVLALVLVALGGLGIEVGENYNLYW |
| Ga0184605_100076144 | 3300018027 | Groundwater Sediment | LTLLHWSPRLVALAAALALIVIAFGGLGIDEPYNLYW |
| Ga0184608_101409452 | 3300018028 | Groundwater Sediment | MLHWNPRLVALAAVIALILIALGGLGIETDYNLYW |
| Ga0184635_102104212 | 3300018072 | Groundwater Sediment | MLHWNPRLVALVAVIALILIALGGLGIETDYNLYW |
| Ga0184624_100449312 | 3300018073 | Groundwater Sediment | LLHWKPRLVAIAVVLALVLIALGGLGIGVDYNLYW |
| Ga0066667_110528562 | 3300018433 | Grasslands Soil | LTLLHWKPRLVALAAVLALVLVALGGLGVELPYNLYW |
| Ga0190269_110449911 | 3300018465 | Soil | LTLLHWSPRLVALAAALILIAFGGLGIDEPYNLYW |
| Ga0184642_16033142 | 3300019279 | Groundwater Sediment | LTLLHWSPRLVALAAALALIAIAFGGLGIDEPYNLYW |
| Ga0173481_101389862 | 3300019356 | Soil | VLHWKPRLVAIAVVLALVLVALGGLGIEVGENYNLYW |
| Ga0193720_10608682 | 3300019868 | Soil | MLHWSPRLVALAAALALIVLALGGLGIETFYNLYW |
| Ga0193701_10315952 | 3300019875 | Soil | LKLLHWSPRLVALAAVLVLVLIALGGLGIELTYNLYW |
| Ga0193755_10912191 | 3300020004 | Soil | GRLTLLHWSPRVVALVAVLALVLIALGGLAEELTYNLYW |
| Ga0193745_10276522 | 3300020059 | Soil | MLHWKPRLVVLAAILALVLVALGGLGFEGSLSGYNLYW |
| Ga0182009_104644922 | 3300021445 | Soil | LLHWKPRLVAIAAVLALVLLALGGLGIEVDYNLYW |
| Ga0247752_10057852 | 3300023071 | Soil | ASCNPSWGRFQVLHWKPRLVAIAVVLALVLVALGGLGIEVGENYNLYW |
| Ga0247794_100108542 | 3300024055 | Soil | LLHWKPRLVAIAVVLALVLVALGGLGIEVDYNLYW |
| Ga0247681_10288932 | 3300024310 | Soil | LKLLHWSPRLVALVAVLALVLIALGGLAEELTYNLYW |
| Ga0210142_10326422 | 3300025552 | Natural And Restored Wetlands | LTLLHWSPRLVALVAVLALVLIALGGLAESVTYNLYW |
| Ga0207642_100870652 | 3300025899 | Miscanthus Rhizosphere | LIVLHWSPRVVALVAVLALVLIALGGLAEELTYNLYW |
| Ga0207688_105061862 | 3300025901 | Corn, Switchgrass And Miscanthus Rhizosphere | RSKLLHWSPRLVALVAVLALVLIALGGLAEELTYNLYW |
| Ga0207657_101576212 | 3300025919 | Corn Rhizosphere | VLHWSPRVVALVAVLALVLIALGGLAEELTYNLYW |
| Ga0207691_104264072 | 3300025940 | Miscanthus Rhizosphere | LLHWSPRLVALVAVLALVLIALGGLAEELTYSLYW |
| Ga0207639_100597852 | 3300026041 | Corn Rhizosphere | VLHWRPRVVALVAVLALVLIALGGLAEELTYNLYW |
| Ga0207676_101411762 | 3300026095 | Switchgrass Rhizosphere | LKLLYWSSRLVALAAVLALVLLALGGLGIEAPYNLYW |
| Ga0209074_104765241 | 3300027787 | Agricultural Soil | LLHWKPRLVAIAVVLVLVLVALGGLGIEVDYNLYW |
| Ga0209811_100878412 | 3300027821 | Surface Soil | MLHWSPRLVALVAVLALVLIALGGLAEELTYNLYW |
| Ga0209465_106230092 | 3300027874 | Tropical Forest Soil | VLHWKPRLVAIAIVLALVLVALSGLGIEVVESYNLYW |
| Ga0209382_102129351 | 3300027909 | Populus Rhizosphere | QVLHWKPRLVAIAVVLALVLVALGGLGIEVGENYNLYW |
| Ga0307293_102435541 | 3300028711 | Soil | LTLLHWSPRLVALAAALALIAVVLGGLGIEEPFNLYW |
| Ga0307285_100235201 | 3300028712 | Soil | SAVGRFTMLHWNPRLVALAAVIALILIALCGLGIETDYNLYW |
| Ga0307318_100225382 | 3300028744 | Soil | LTLLHWSPRLVALAAALALILIAFGGLGIDEPYNLYW |
| Ga0307280_103738751 | 3300028768 | Soil | LLHWSPRLVALVAVLALVLIALGGLAEELTYNLYW |
| Ga0307290_100311502 | 3300028791 | Soil | LTLLHWSPRLVALAAVLVLVLIALGGLGIELTYNLYW |
| Ga0307284_100449753 | 3300028799 | Soil | LTLLHWSPRLVALAAALALILIALGGLGIDEPYNLYW |
| Ga0307314_100742232 | 3300028872 | Soil | TMLHWNPRLVALAAVIALILIALGGLGIETDYNLYW |
| Ga0307278_101860551 | 3300028878 | Soil | SLLHWSPRLVALAAALALILIAFGGLGIDEPYNLYW |
| Ga0247826_115972441 | 3300030336 | Soil | LTLLHWSPRVIALVAVLALVLIALGGLAEELTYNLYW |
| Ga0268241_100136302 | 3300030511 | Soil | LLHWRPRLVALAAVIALVLLALGGLGIEVDYNLYW |
| Ga0308197_100790042 | 3300031093 | Soil | VSTDRARLVALAAVIALILIALGGLGIETDYNLYW |
| Ga0308175_1000816562 | 3300031938 | Soil | LKLLHWSPRVVALVAVLALVLIALGGLAEELTYNLYW |
| Ga0308175_1003253622 | 3300031938 | Soil | VGRFTLLHWKPRLVAIAAVLALVLLALGGLGIEVDYNLYW |
| Ga0307409_1001195542 | 3300031995 | Rhizosphere | LLHWKPRLVATTAVLALVLVALGGLGIEVDYNLYW |
| Ga0308176_114731682 | 3300031996 | Soil | SAKAPRWRFHMLHWKPRLVAIAVVLALVLVALGGLGIEVDYNLYW |
| Ga0334913_018536_852_959 | 3300034172 | Sub-Biocrust Soil | MLHWNPRLIALAAAFALVLIALCGLGFEAVYNLYW |
| ⦗Top⦘ |