NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F101101

Metagenome / Metatranscriptome Family F101101

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F101101
Family Type Metagenome / Metatranscriptome
Number of Sequences 102
Average Sequence Length 42 residues
Representative Sequence MFERFTDKARTAVILAKAKAAERGDQIRPVYLLHALASGEG
Number of Associated Samples 93
Number of Associated Scaffolds 102

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 100.00 %
% of genes near scaffold ends (potentially truncated) 97.06 %
% of genes from short scaffolds (< 2000 bps) 92.16 %
Associated GOLD sequencing projects 91
AlphaFold2 3D model prediction Yes
3D model pTM-score0.38

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (52.941 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil
(31.372 % of family members)
Environment Ontology (ENVO) Unclassified
(29.412 % of family members)
Earth Microbiome Project Ontology (EMPO) Free-living → Non-saline → Soil (non-saline)
(40.196 % of family members)



 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      


 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 46.38%    β-sheet: 0.00%    Coil/Unstructured: 53.62%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  
pTM-score: 0.38
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.


 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 102 Family Scaffolds
PF08281Sigma70_r4_2 36.27
PF08279HTH_11 26.47
PF13384HTH_23 17.65
PF08022FAD_binding_8 5.88
PF01794Ferric_reduct 2.94
PF02861Clp_N 0.98
PF04205FMN_bind 0.98
PF02424ApbE 0.98

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 102 Family Scaffolds
COG0542ATP-dependent Clp protease, ATP-binding subunit ClpAPosttranslational modification, protein turnover, chaperones [O] 0.98
COG1477FAD:protein FMN transferase ApbEPosttranslational modification, protein turnover, chaperones [O] 0.98


 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms52.94 %
UnclassifiedrootN/A47.06 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
2170459024|GZRSKLJ02JXJDVNot Available503Open in IMG/M
3300001653|JGI20275J16321_100571All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales761Open in IMG/M
3300001686|C688J18823_10549252All Organisms → cellular organisms → Bacteria739Open in IMG/M
3300005436|Ga0070713_100533113All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia1110Open in IMG/M
3300005451|Ga0066681_10181476All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia1252Open in IMG/M
3300005455|Ga0070663_101421566All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia615Open in IMG/M
3300005471|Ga0070698_101979394Not Available536Open in IMG/M
3300005529|Ga0070741_11371237All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia589Open in IMG/M
3300005530|Ga0070679_100878892All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia840Open in IMG/M
3300005618|Ga0068864_101755315All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micromonosporales → Micromonosporaceae626Open in IMG/M
3300005834|Ga0068851_10512541All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales721Open in IMG/M
3300006102|Ga0075015_101040824All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micromonosporales → Micromonosporaceae503Open in IMG/M
3300006581|Ga0074048_13070691All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia545Open in IMG/M
3300006603|Ga0074064_10006380All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales686Open in IMG/M
3300006806|Ga0079220_10417697All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia883Open in IMG/M
3300009101|Ga0105247_11848386All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia504Open in IMG/M
3300009174|Ga0105241_10198721All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1673Open in IMG/M
3300009520|Ga0116214_1282341Not Available634Open in IMG/M
3300009553|Ga0105249_10145571All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia2276Open in IMG/M
3300009700|Ga0116217_10416974Not Available850Open in IMG/M
3300010322|Ga0134084_10385900Not Available543Open in IMG/M
3300010333|Ga0134080_10509709Not Available573Open in IMG/M
3300010371|Ga0134125_10600578All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Propionibacteriales → Nocardioidaceae1216Open in IMG/M
3300010396|Ga0134126_12059570All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia623Open in IMG/M
3300010880|Ga0126350_10163506All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia2376Open in IMG/M
3300011270|Ga0137391_10554408Not Available968Open in IMG/M
3300012210|Ga0137378_10524083All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1093Open in IMG/M
3300012351|Ga0137386_10770192All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia691Open in IMG/M
3300012498|Ga0157345_1039878Not Available561Open in IMG/M
3300012923|Ga0137359_10352488All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1308Open in IMG/M
3300012987|Ga0164307_11861255Not Available510Open in IMG/M
3300013104|Ga0157370_10711606All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria916Open in IMG/M
3300013104|Ga0157370_10784587Not Available867Open in IMG/M
3300014969|Ga0157376_10854476All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria925Open in IMG/M
3300015357|Ga0134072_10362270Not Available560Open in IMG/M
3300016341|Ga0182035_11301537Not Available651Open in IMG/M
3300017926|Ga0187807_1024509All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1862Open in IMG/M
3300017930|Ga0187825_10141546Not Available847Open in IMG/M
3300017961|Ga0187778_11353579Not Available502Open in IMG/M
3300017974|Ga0187777_10334167All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1040Open in IMG/M
3300017974|Ga0187777_11120208Not Available573Open in IMG/M
3300017993|Ga0187823_10344671Not Available529Open in IMG/M
3300018090|Ga0187770_10612251All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria866Open in IMG/M
3300021046|Ga0215015_10876893Not Available619Open in IMG/M
3300021402|Ga0210385_10896706Not Available681Open in IMG/M
3300021405|Ga0210387_11001092Not Available732Open in IMG/M
3300021407|Ga0210383_10863210Not Available772Open in IMG/M
3300021474|Ga0210390_10063278All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria3051Open in IMG/M
3300021478|Ga0210402_10771129All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales → Nocardiaceae → Rhodococcus → unclassified Rhodococcus → Rhodococcus sp. P27886Open in IMG/M
3300021559|Ga0210409_10749500Not Available848Open in IMG/M
3300021559|Ga0210409_11181698Not Available640Open in IMG/M
3300022873|Ga0224550_1057104Not Available560Open in IMG/M
3300025412|Ga0208194_1055885All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia606Open in IMG/M
3300025911|Ga0207654_11238801All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia544Open in IMG/M
3300025929|Ga0207664_10930160Not Available780Open in IMG/M
3300026088|Ga0207641_11475608Not Available681Open in IMG/M
3300026318|Ga0209471_1087710All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1364Open in IMG/M
3300026523|Ga0209808_1264559Not Available549Open in IMG/M
3300027297|Ga0208241_1057000All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → Pseudonocardiaceae → Saccharothrix → Saccharothrix espanaensis → Saccharothrix espanaensis DSM 44229622Open in IMG/M
3300027684|Ga0209626_1108061Not Available723Open in IMG/M
3300027889|Ga0209380_10516530Not Available696Open in IMG/M
3300030007|Ga0311338_10468513All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1330Open in IMG/M
3300030739|Ga0302311_10240000All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1348Open in IMG/M
3300030880|Ga0265776_110106All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia556Open in IMG/M
3300030940|Ga0265740_1042875Not Available538Open in IMG/M
3300031446|Ga0170820_10575365All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia503Open in IMG/M
3300031543|Ga0318516_10661220Not Available594Open in IMG/M
3300031544|Ga0318534_10388382Not Available802Open in IMG/M
3300031546|Ga0318538_10244108All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria964Open in IMG/M
3300031573|Ga0310915_10215526All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1345Open in IMG/M
3300031679|Ga0318561_10420329Not Available735Open in IMG/M
3300031708|Ga0310686_106655887Not Available922Open in IMG/M
3300031719|Ga0306917_10086662All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia2214Open in IMG/M
3300031765|Ga0318554_10321293Not Available880Open in IMG/M
3300031765|Ga0318554_10510673Not Available680Open in IMG/M
3300031768|Ga0318509_10075174All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1780Open in IMG/M
3300031769|Ga0318526_10276583Not Available687Open in IMG/M
3300031781|Ga0318547_10065318All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria2001Open in IMG/M
3300031793|Ga0318548_10250691All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria870Open in IMG/M
3300031794|Ga0318503_10144107Not Available767Open in IMG/M
3300031795|Ga0318557_10211717Not Available885Open in IMG/M
3300031831|Ga0318564_10016114All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria3048Open in IMG/M
3300031835|Ga0318517_10313643Not Available709Open in IMG/M
3300031845|Ga0318511_10241087All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales → Nocardiaceae → Rhodococcus → unclassified Rhodococcus → Rhodococcus sp. P27810Open in IMG/M
3300031845|Ga0318511_10309746Not Available715Open in IMG/M
3300031879|Ga0306919_10981638Not Available646Open in IMG/M
3300031896|Ga0318551_10776566Not Available556Open in IMG/M
3300032008|Ga0318562_10166245All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1273Open in IMG/M
3300032008|Ga0318562_10670204Not Available597Open in IMG/M
3300032041|Ga0318549_10040526All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1885Open in IMG/M
3300032041|Ga0318549_10529412Not Available529Open in IMG/M
3300032065|Ga0318513_10554527Not Available562Open in IMG/M
3300032174|Ga0307470_10821879Not Available722Open in IMG/M
3300032180|Ga0307471_102304019Not Available679Open in IMG/M
3300032261|Ga0306920_101931351All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales → Nocardiaceae → Rhodococcus → unclassified Rhodococcus → Rhodococcus sp. P27829Open in IMG/M
3300032261|Ga0306920_101959151All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia822Open in IMG/M
3300032770|Ga0335085_11342868Not Available752Open in IMG/M
3300032783|Ga0335079_10147746All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia2639Open in IMG/M
3300032895|Ga0335074_10697121All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria980Open in IMG/M
3300033289|Ga0310914_10399504All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1244Open in IMG/M
3300033289|Ga0310914_11424835All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales → Nocardiaceae → Rhodococcus → unclassified Rhodococcus → Rhodococcus sp. P27596Open in IMG/M
3300033412|Ga0310810_10166297All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia2542Open in IMG/M



 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil31.37%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil5.88%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil4.90%
Vadose Zone SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil3.92%
Tropical PeatlandEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland3.92%
Freshwater SedimentEnvironmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment2.94%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil2.94%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Soil2.94%
SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Soil2.94%
Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil2.94%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil1.96%
Terrestrial SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil1.96%
Peatlands SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil1.96%
Hardwood Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil1.96%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere1.96%
PalsaEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa1.96%
Switchgrass RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere1.96%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere1.96%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere1.96%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere1.96%
PeatlandEnvironmental → Aquatic → Freshwater → Wetlands → Unclassified → Peatland0.98%
WatershedsEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds0.98%
Grass SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Grass Soil0.98%
Surface SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil0.98%
Agricultural SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil0.98%
Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil0.98%
SoilEnvironmental → Terrestrial → Soil → Loam → Grasslands → Soil0.98%
SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Soil0.98%
Corn RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere0.98%
Agricultural SoilEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Agricultural Soil0.98%
SoilEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Soil0.98%
Corn RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere0.98%
Arabidopsis RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Rhizosphere0.98%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere0.98%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere0.98%
Boreal Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Boreal Forest Soil0.98%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
2170459024Grass soil microbial communities from Rothamsted Park, UK - FD1 (NaCl 300g/L 5ml)EnvironmentalOpen in IMG/M
3300001653Forest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaG HF041EnvironmentalOpen in IMG/M
3300001686Grasslands soil microbial communities from Hopland, California, USAEnvironmentalOpen in IMG/M
3300005436Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaGEnvironmentalOpen in IMG/M
3300005451Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_130EnvironmentalOpen in IMG/M
3300005455Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaGHost-AssociatedOpen in IMG/M
3300005471Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaGEnvironmentalOpen in IMG/M
3300005529Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen16_06102014_R1EnvironmentalOpen in IMG/M
3300005530Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaGEnvironmentalOpen in IMG/M
3300005618Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2Host-AssociatedOpen in IMG/M
3300005834Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2Host-AssociatedOpen in IMG/M
3300006102Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Alex Branch Run_MetaG_ABR_2013EnvironmentalOpen in IMG/M
3300006581Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtLPB (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300006603Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtHMC (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300006806Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS100EnvironmentalOpen in IMG/M
3300009101Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaGHost-AssociatedOpen in IMG/M
3300009174Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaGHost-AssociatedOpen in IMG/M
3300009520Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_1_NS metaGEnvironmentalOpen in IMG/M
3300009553Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaGHost-AssociatedOpen in IMG/M
3300009700Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_4_PS metaGEnvironmentalOpen in IMG/M
3300010322Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Glu_20cm_2_24_1 metaGEnvironmentalOpen in IMG/M
3300010333Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Met_40cm_2_24_1 metaGEnvironmentalOpen in IMG/M
3300010371Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-1EnvironmentalOpen in IMG/M
3300010396Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-2EnvironmentalOpen in IMG/M
3300010880Boreal forest soil eukaryotic communities from Alaska, USA - C5-1 Metatranscriptome (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300011270Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4B metaGEnvironmentalOpen in IMG/M
3300012210Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_60_16 metaGEnvironmentalOpen in IMG/M
3300012351Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_100_16 metaGEnvironmentalOpen in IMG/M
3300012498Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.3.yng.090410Host-AssociatedOpen in IMG/M
3300012923Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_40_16 metaGEnvironmentalOpen in IMG/M
3300012987Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_243_MGEnvironmentalOpen in IMG/M
3300013104Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaGHost-AssociatedOpen in IMG/M
3300014969Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaGHost-AssociatedOpen in IMG/M
3300015357Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_20cm_5_0_1 metaGEnvironmentalOpen in IMG/M
3300016341Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170EnvironmentalOpen in IMG/M
3300017926Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW_2EnvironmentalOpen in IMG/M
3300017930Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SourceSoil_5EnvironmentalOpen in IMG/M
3300017961Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP5_20_MGEnvironmentalOpen in IMG/M
3300017974Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP5_10_MGEnvironmentalOpen in IMG/M
3300017993Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SourceSoil_3EnvironmentalOpen in IMG/M
3300018090Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP02_20_MGEnvironmentalOpen in IMG/M
3300021046Soil microbial communities from Shale Hills CZO, Pennsylvania, United States - 90cm depthEnvironmentalOpen in IMG/M
3300021402Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-26-OEnvironmentalOpen in IMG/M
3300021405Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-OEnvironmentalOpen in IMG/M
3300021407Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-OEnvironmentalOpen in IMG/M
3300021474Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-11-OEnvironmentalOpen in IMG/M
3300021478Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-MEnvironmentalOpen in IMG/M
3300021559Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-MEnvironmentalOpen in IMG/M
3300022873Peat soil microbial communities from Stordalen Mire, Sweden - 717 P3 10-14EnvironmentalOpen in IMG/M
3300025412Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_19_10 (SPAdes)EnvironmentalOpen in IMG/M
3300025911Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025929Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300026088Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026318Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_128 (SPAdes)EnvironmentalOpen in IMG/M
3300026523Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_157 (SPAdes)EnvironmentalOpen in IMG/M
3300027297Forest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaG HF047 (SPAdes)EnvironmentalOpen in IMG/M
3300027684Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM1H0_M2 (SPAdes)EnvironmentalOpen in IMG/M
3300027889Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 6 (SPAdes)EnvironmentalOpen in IMG/M
3300030007I_Palsa_E1 coassemblyEnvironmentalOpen in IMG/M
3300030739Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Palsa_N1_3EnvironmentalOpen in IMG/M
3300030880Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZA2 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300030940Metatranscriptome of soil microbial communities from Maridalen valley, Oslo, Norway - NSI1 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300031446Fir Summer Coassembly Site 11 - Champenoux / Amance forestEnvironmentalOpen in IMG/M
3300031543Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f20EnvironmentalOpen in IMG/M
3300031544Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.117b4f26EnvironmentalOpen in IMG/M
3300031546Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.166b4f23EnvironmentalOpen in IMG/M
3300031573Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.AN111EnvironmentalOpen in IMG/M
3300031679Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f23EnvironmentalOpen in IMG/M
3300031708FICUS49499 Metagenome Czech Republic combined assemblyEnvironmentalOpen in IMG/M
3300031719Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.000 (v2)EnvironmentalOpen in IMG/M
3300031765Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f22EnvironmentalOpen in IMG/M
3300031768Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f22EnvironmentalOpen in IMG/M
3300031769Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f24EnvironmentalOpen in IMG/M
3300031781Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f20EnvironmentalOpen in IMG/M
3300031793Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f21EnvironmentalOpen in IMG/M
3300031794Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.174b1f23EnvironmentalOpen in IMG/M
3300031795Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f19EnvironmentalOpen in IMG/M
3300031831Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.066b5f20EnvironmentalOpen in IMG/M
3300031835Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f21EnvironmentalOpen in IMG/M
3300031845Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.171b2f18EnvironmentalOpen in IMG/M
3300031879Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.172 (v2)EnvironmentalOpen in IMG/M
3300031896Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f19EnvironmentalOpen in IMG/M
3300032008Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.066b5f18EnvironmentalOpen in IMG/M
3300032041Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f22EnvironmentalOpen in IMG/M
3300032065Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.171b2f20EnvironmentalOpen in IMG/M
3300032174Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_05EnvironmentalOpen in IMG/M
3300032180Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515EnvironmentalOpen in IMG/M
3300032261Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 (v2)EnvironmentalOpen in IMG/M
3300032770Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.5EnvironmentalOpen in IMG/M
3300032783Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.3EnvironmentalOpen in IMG/M
3300032895Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.3EnvironmentalOpen in IMG/M
3300033289Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.AN108EnvironmentalOpen in IMG/M
3300033412Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - NCEnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap



 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
FD1_087033202170459024Grass SoilMFERFTDKARTAVIAARAEAAERGDQIRPVYLLHALASGDGVAARALAG
JGI20275J16321_10057133300001653Forest SoilMFERFTDKARKVVILAKGKATERGDDQIRPVHMLYGLAAADGVAAR
C688J18823_1054925233300001686SoilMFERFTDKARAAVIQARATAAGRGDRMIRPAYLLYAL
Ga0070713_10053311313300005436Corn, Switchgrass And Miscanthus RhizosphereMFERFTDKARTAVIVARAEASERGDQIRPVYLLHALAAGEGVAARALAG
Ga0066681_1018147633300005451SoilMFERFTDKARTAVIAARAEASERGDQIRPEYLLHALAAGEGVAA
Ga0070663_10142156613300005455Corn RhizosphereMFERLTDRARAAVIQARATAAERGDQIRPVYLLHAVALGEGTAARALAGLGID
Ga0070698_10197939423300005471Corn, Switchgrass And Miscanthus RhizosphereMFERFTDKARKVVVVVVVLAKGKATERGDDQIRPVHMLYGLAA
Ga0070741_1137123713300005529Surface SoilMFERFTDRARAAVIRARATAAERGDQIRPVYLLHAVALGEGTAARALAGLGIDAG
Ga0070679_10087889233300005530Corn RhizosphereMFERFTDRARAAVIRARATAAERGDQIRPVYLLHAVALGE
Ga0068864_10175531533300005618Switchgrass RhizosphereMFERLTDRARAAVIQARATAAERGDQIRPVYLLHAVALGEGTA
Ga0068851_1051254133300005834Corn RhizosphereMFERFTDKAKTAVIAARAEAAERGDQIRPVYLLHALAS
Ga0075015_10104082413300006102WatershedsMFERFTDKARTVVILAKAKATERGDQIRPVYMLYALASAEGVAA
Ga0074048_1307069123300006581SoilMFERFTDRARTAVILARTEASERGDQIRPVYMLHAL
Ga0074064_1000638013300006603SoilMFERFTDKARTAVIAARAEAAERGDQIRPVYLLHALA
Ga0079220_1041769733300006806Agricultural SoilMFERFTDKARAAVIVARAEASERGDQIRPVYLLHALAAGEGVA
Ga0105247_1184838613300009101Switchgrass RhizosphereMFERFTDRARAAVIRARATAAERGDQIRPVYLLHAVALGEGTAARALAGLGID
Ga0105241_1019872113300009174Corn RhizosphereMFERFTDKARTAVIAARAEAAERGDQIRPVYLLHALASGDGV
Ga0116214_128234113300009520Peatlands SoilMFERFTDKARKVVILAKHKATEQGDAEIRPVHMLY
Ga0105249_1014557113300009553Switchgrass RhizosphereMFERFTDKARTAVIAARAEAAERGDQIRPVYLLHALAAGDGVAARA
Ga0116217_1041697413300009700Peatlands SoilMFERFTDKARTVVILAKAKATERGDQIRPVYMLYA
Ga0134084_1038590013300010322Grasslands SoilMFERFTDKARTAVIAARAEAAERGDQIRPVYLLHALAA
Ga0134080_1050970923300010333Grasslands SoilMFERFTDKAKTAVILAKADASERGDQIRPVYLLHALAAG
Ga0134125_1060057833300010371Terrestrial SoilMFERFTDKARTAVIVARAEASERSDQIRPVYLLHALAA
Ga0134126_1205957023300010396Terrestrial SoilMFERLTDRARAAVIRARATAAERGDQIRPVYLLHAVA
Ga0126350_1016350613300010880Boreal Forest SoilMFERFTDKARKVVLLAKGKATERGDDQIRPVHLLYGLAAADG
Ga0137391_1055440823300011270Vadose Zone SoilMFERFTDKARTAVILAKAKAAERGDQIRPVYLLHALASGEG*
Ga0137378_1052408313300012210Vadose Zone SoilMFERFTDKARTVVILAKAKATERGDQIRPVYMLHA
Ga0137386_1077019223300012351Vadose Zone SoilMFERFTDKARKVVILAKAKATERGDQIRPVYMLHALASGEGVAARVLA
Ga0157345_103987823300012498Arabidopsis RhizosphereMFERFTDRARTAVILARTEASERGDQIRPVYMLHALA
Ga0137359_1035248833300012923Vadose Zone SoilMFERFTDKARTVVILAKARAAERGDQIRPVYMLHALAAGDGVAARALAGPQ
Ga0164307_1186125523300012987SoilMFERFTDRARTVMILARTTAAARGDQIRPVYLLHALT
Ga0157370_1071160633300013104Corn RhizosphereMFERFTDKAKTAVIAARAEAAERGDQIRPVYLLHALASGDGVAARALAGL
Ga0157370_1078458733300013104Corn RhizosphereMFERFTDKARTAVIAARAEAAERGDQIRPVYLLHALASGDGVAARALAGL
Ga0157376_1085447633300014969Miscanthus RhizosphereMFERFTDKARTAVIAARAEAAERGDQIRPVYLLHALACGDGVAARA
Ga0134072_1036227023300015357Grasslands SoilMFERFTDKARTAVIAARAEAAERGDQIRPVYLLHALASGDGVAAR
Ga0182035_1130153713300016341SoilMFERFTDQARSAVSLARAKAAERGDQIRPVYMLYALTCGDGVAARALAGL
Ga0187807_102450923300017926Freshwater SedimentMFERFTDKARKIVILAKAKATERGDDQIRPVHMLYGWPPPTAWPPGR
Ga0187825_1014154623300017930Freshwater SedimentMFERFTDKARKVVSLALAKAKEQGDDQVRPVHMLYGVTAADGVAARAL
Ga0187778_1135357923300017961Tropical PeatlandMFERFTDKARKVVVVAKTAATERGEDQVRPLHMLYGLAATDGVAA
Ga0187777_1033416733300017974Tropical PeatlandMFERFTDKARSAVILAKTKATERGDDQIRPLHMLYGLVA
Ga0187777_1112020823300017974Tropical PeatlandMFERFTDKARTVVILAKTKATERGDDQIRPEHMLY
Ga0187823_1034467123300017993Freshwater SedimentMFERFTDRARTAVILARTEASERGDQIRPEYMLHALAADEGVA
Ga0187770_1061225113300018090Tropical PeatlandMFERFTDKARKVVILAKTKATERGDDQIRPVHMLYGLVSTDGMA
Ga0215015_1087689313300021046SoilMFERFSDQARTVVILAKAKATERGDQIRPVYGLDTGNGQWR
Ga0210385_1089670613300021402SoilMFERFTDKARKVVILAKTKATDRGDDQIGPVHMLYGL
Ga0210387_1100109213300021405SoilMFERFTDRARTAVILARTEASERGDQIRPEYMLHA
Ga0210383_1086321023300021407SoilMFERFTDKARKVVFLAKGKATERGDDQIRPVHMLYGLAA
Ga0210390_1006327813300021474SoilMFERFTDKARKVVILAKGKATERGDDQIRPVHMLYGLAAADGVA
Ga0210402_1077112913300021478SoilMFERFTGNARTVVILAKAKATERGDQIRPVYMLYALASAEGVAARALA
Ga0210409_1074950013300021559SoilMFERFTDKARKVVFLAKGKATERGDDQIRPVHMLY
Ga0210409_1118169823300021559SoilMFERFTDKARTAVIAARAEASERGDQIRPVYLLHALAAGQG
Ga0224550_105710413300022873SoilMFERFTDKARQVVFLAKGKATERDDDQIRPVHMLYGLAAADGVAARVLT
Ga0208194_105588513300025412PeatlandMFERFTDNARAAVFTARAKAAERGDQIRPLYLLYALAAGEGVAARTLAGLAVDAA
Ga0207654_1123880113300025911Corn RhizosphereMFERFTDRARAAVIRARATAAERGDQIRPVYLLHAVALGEGTAAR
Ga0207664_1093016013300025929Agricultural SoilMFERFTDKARTAVIAARAEAAERGDQIRPVYLLHAL
Ga0207641_1147560813300026088Switchgrass RhizosphereMFERFTDKAKTAVIAARAEAAERGDQIRPVYLLHALASGDGVAARALAG
Ga0209471_108771043300026318SoilMFERFTDKARTAVIVARADASERGDQIRPVYLLHAL
Ga0209808_126455923300026523SoilMFERFTDKARTAVIVAKAEASERGDQIRPVYLLHAL
Ga0208241_105700013300027297Forest SoilMFERFTDRARKVVSLALNKAKERGDDQIRPVHMLYGV
Ga0209626_110806133300027684Forest SoilMFERFTDKARTVVILARAKATERGDQIRPVYMLYALASAEG
Ga0209380_1051653013300027889SoilMFERFTDKARKVVVLAKNKATERGDDQIRPVHMLYGLV
Ga0311338_1046851333300030007PalsaMFERFTDKARGTVFAARAKAAERGDGQIRPVYMLHGLITMDGVAARALAGL
Ga0302311_1024000033300030739PalsaMFERFTDKARQVVFLAKGKATERGDDQIRPVHMLYGLAAADGVAARV
Ga0265776_11010613300030880SoilMFERFTDKARTVVILARAKATERGDQIRPVYMLYALASAEGVAARVLAS
Ga0265740_104287513300030940SoilMFERFTDKARKVVLLAKGKATERGDDQIRPVHLLYGLAA
Ga0170820_1057536513300031446Forest SoilMFERFTDKARTAVIVARAEASERGDQIRPVYLLHALAAGQGVAAR
Ga0318516_1066122013300031543SoilMFERFTDRARTAVILARTEASERGDQIRPVYMLHALAS
Ga0318534_1038838213300031544SoilMFERFTDRARKVVILAKTKATERGDDQIRPVHMLYGLVGTDGV
Ga0318538_1024410833300031546SoilMFERFTDRARTAVILARTEASERGDQIRPVYMLHALASVRA
Ga0310915_1021552633300031573SoilMFERFTDRARTAVILARTEASERGDQIRPVYMLHALASGEGVAAQVLAG
Ga0318561_1042032913300031679SoilMFERFTDRARKVVILAKTKATERGDDQIRPVHMLYGLVGTD
Ga0310686_10665588733300031708SoilMFERFTDKARTVVIAAKTKAQERGDDQIRPAHMLYG
Ga0306917_1008666213300031719SoilMFERFTDKARKVVILATAKATERGEGEIRPVHMLYGVA
Ga0318554_1032129313300031765SoilMFERFTDKARKVVILAKNKATERGDDQIRPVHMLYGLAGTDGVAA
Ga0318554_1051067313300031765SoilMFERFTDQARQVVILAKGQATERGDDQIRPVHMLYGLAAAD
Ga0318509_1007517433300031768SoilMFERFTDRARTAVIAARAEATARGDQIRPVYMLHALASGEG
Ga0318526_1027658323300031769SoilMFERFTDRARTAVILARTEASERGDQIRPVYMLHALASGE
Ga0318547_1006531813300031781SoilMFERFTDRARTAVIMARTEASERGDQIRPVYMLHALASGEGVA
Ga0318548_1025069113300031793SoilMFERFTDRARTAVIMARTEASERGDQIRPVYMLHALASG
Ga0318503_1014410723300031794SoilMFERFTDKARAVVILAKAKATERGDQIRPVYMLHALASAEG
Ga0318557_1021171713300031795SoilMFERFTDKARKVVILAKNKATERGDDQIRPVHILY
Ga0318564_1001611453300031831SoilMFERFTDKARKVVILAKNKATERGDDQIRPVHMLYGLAGTDGVA
Ga0318517_1031364313300031835SoilMFERFTDKARTTVILAKAKATERGDQIRPVYMLHALAAGEGVTARV
Ga0318511_1024108713300031845SoilMFERFTDKARAAVILARTEASERGDQIRPVYLLHARACGEGV
Ga0318511_1030974613300031845SoilMFERFTDKARKVVILAKNKATERGDDQIRPVHILYG
Ga0306919_1098163833300031879SoilMFERFTDKARKVVILAKNKAAERGDDQIRPVHMLY
Ga0318551_1077656623300031896SoilMFERFTDRARTAVILARTEASERGDQIRPVYMLHALASSEGVQHVH
Ga0318562_1016624513300032008SoilMFERFTDKARKVVHLATAKATERGEDEIRPVHMLYGLAA
Ga0318562_1067020413300032008SoilMFERFTDRARTAVILARTEASERGDQIRPVYMLHALASG
Ga0318549_1004052613300032041SoilMFERFTDRARTAVIAARAEATARGDQIRPVYMLHAL
Ga0318549_1052941213300032041SoilMFERFTDKARKVVILAKNKAAERGDDQIRPVHMLYG
Ga0318513_1055452713300032065SoilMFERFTDRARTAVILARTEASERGDQIRPVYMLHALASGEGVAAQVLA
Ga0307470_1082187923300032174Hardwood Forest SoilMFERFTDKAKTAVIVAKADASERGDQIRPVYLLHALAAGEGIASRAL
Ga0307471_10230401913300032180Hardwood Forest SoilMFERFTDRARTVMILARTTAAARGDQIRPVYLLHALTSAD
Ga0306920_10193135123300032261SoilMFERFTDKARAVVILAKAKATERGDQIRPVYMLHAL
Ga0306920_10195915113300032261SoilMFERFTDKARKVVSVAAARAKEQGDDQIRPVHMLYALTATDGV
Ga0335085_1134286823300032770SoilMFERFTGKARTVVILAKAKAAERGDQIRPVYMLHALASAQGVAAR
Ga0335079_1014774643300032783SoilMFERFTDKARTVVILAKAKAAERDDQIRPVYMLYALASGDGVAARVL
Ga0335074_1069712133300032895SoilMFERFTDKARKVVVAARDQAIEQGDDQIRPVHMLYGLAATDGVAGRV
Ga0310914_1039950413300033289SoilMFERFTGRARTVVILAKAEAAERGDQIRPVYLLYALASG
Ga0310914_1142483513300033289SoilMFERFTDKARAVVILAKAKATERGDQIRPVYMLHALASAEGVAARALAGLGVD
Ga0310810_1016629713300033412SoilMFERFTDKARTAVIAARTEAAERGDQIRPVYMLHALAAG


 ⦗Top⦘


© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.