| Basic Information | |
|---|---|
| Family ID | F101087 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 102 |
| Average Sequence Length | 40 residues |
| Representative Sequence | MIDNKEKHYLKACKSDFKCGNYFYGPKYQYCEQCRAKDMC |
| Number of Associated Samples | 81 |
| Number of Associated Scaffolds | 102 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Unclassified |
| % of genes with valid RBS motifs | 44.12 % |
| % of genes near scaffold ends (potentially truncated) | 34.31 % |
| % of genes from short scaffolds (< 2000 bps) | 44.12 % |
| Associated GOLD sequencing projects | 73 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.19 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Unclassified (56.863 % of family members) |
| NCBI Taxonomy ID | N/A |
| Taxonomy | N/A |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Aquatic → Marine → Strait → Unclassified → Seawater (13.725 % of family members) |
| Environment Ontology (ENVO) | Unclassified (66.667 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Saline → Water (saline) (92.157 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 7.35% β-sheet: 2.94% Coil/Unstructured: 89.71% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.19 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 102 Family Scaffolds |
|---|---|---|
| PF13385 | Laminin_G_3 | 11.76 |
| PF13884 | Peptidase_S74 | 8.82 |
| PF10145 | PhageMin_Tail | 2.94 |
| PF04883 | HK97-gp10_like | 0.98 |
| PF00145 | DNA_methylase | 0.98 |
| PF05063 | MT-A70 | 0.98 |
| PF05065 | Phage_capsid | 0.98 |
| PF11367 | DUF3168 | 0.98 |
| COG ID | Name | Functional Category | % Frequency in 102 Family Scaffolds |
|---|---|---|---|
| COG4725 | N6-adenosine-specific RNA methylase IME4 | Translation, ribosomal structure and biogenesis [J] | 1.96 |
| COG0270 | DNA-cytosine methylase | Replication, recombination and repair [L] | 0.98 |
| COG4653 | Predicted phage phi-C31 gp36 major capsid-like protein | Mobilome: prophages, transposons [X] | 0.98 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| Unclassified | root | N/A | 56.86 % |
| All Organisms | root | All Organisms | 43.14 % |
| Visualization |
|---|
| Powered by ApexCharts |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Marine | Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine | 13.73% |
| Seawater | Environmental → Aquatic → Marine → Strait → Unclassified → Seawater | 13.73% |
| Marine | Environmental → Aquatic → Marine → Unclassified → Unclassified → Marine | 12.75% |
| Aqueous | Environmental → Aquatic → Marine → Coastal → Unclassified → Aqueous | 9.80% |
| Marine | Environmental → Aquatic → Marine → Neritic Zone → Unclassified → Marine | 7.84% |
| Salt Marsh | Environmental → Aquatic → Marine → Intertidal Zone → Salt Marsh → Salt Marsh | 5.88% |
| Estuarine Water | Environmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine Water | 4.90% |
| Pond Water | Environmental → Aquatic → Non-Marine Saline And Alkaline → Saline → Unclassified → Pond Water | 4.90% |
| Pelagic Marine | Environmental → Aquatic → Marine → Pelagic → Unclassified → Pelagic Marine | 3.92% |
| Pelagic Marine | Environmental → Aquatic → Marine → Neritic Zone → Unclassified → Pelagic Marine | 3.92% |
| Surface Seawater | Environmental → Aquatic → Marine → Oceanic → Photic Zone → Surface Seawater | 1.96% |
| Seawater | Environmental → Aquatic → Marine → Coastal → Unclassified → Seawater | 1.96% |
| Estuary Water | Environmental → Aquatic → Marine → Coastal → Unclassified → Estuary Water | 1.96% |
| Marine | Environmental → Aquatic → Marine → Intertidal Zone → Unclassified → Marine | 1.96% |
| Estuarine | Environmental → Aquatic → Marine → Intertidal Zone → Estuary → Estuarine | 1.96% |
| Seawater | Environmental → Aquatic → Marine → Oceanic → Unclassified → Seawater | 0.98% |
| Marine | Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine | 0.98% |
| Marine | Environmental → Aquatic → Marine → Inlet → Unclassified → Marine | 0.98% |
| Microbial Mat | Environmental → Aquatic → Marine → Coastal → Sediment → Microbial Mat | 0.98% |
| Marine Surface Water | Environmental → Aquatic → Marine → Coastal → Unclassified → Marine Surface Water | 0.98% |
| Seawater | Environmental → Aquatic → Marine → Intertidal Zone → Unclassified → Seawater | 0.98% |
| Estuarine | Environmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine | 0.98% |
| Seawater | Environmental → Aquatic → Marine → Pelagic → Unclassified → Seawater | 0.98% |
| Water | Environmental → Aquatic → Non-Marine Saline And Alkaline → Saline → Unclassified → Water | 0.98% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300000115 | Marine microbial communities from Delaware Coast, sample from Delaware MO Summer July 2011 | Environmental | Open in IMG/M |
| 3300000116 | Marine microbial communities from Delaware Coast, sample from Delaware MO Spring March 2010 | Environmental | Open in IMG/M |
| 3300000117 | Marine microbial communities from Delaware Coast, sample from Delaware MO Winter December 2010 | Environmental | Open in IMG/M |
| 3300001346 | Pelagic Microbial community sample from North Sea - COGITO 998_met_01 | Environmental | Open in IMG/M |
| 3300001355 | Pelagic Microbial community sample from North Sea - COGITO 998_met_08 | Environmental | Open in IMG/M |
| 3300001957 | Marine microbial communities from Wolf Island, Equador - GS035 | Environmental | Open in IMG/M |
| 3300001965 | Marine microbial communities from Coastal Floreana, Equador - GS028 | Environmental | Open in IMG/M |
| 3300005239 | Environmental Genome Shotgun Sequencing: Ocean Microbial Populations from the Gulf of Maine | Environmental | Open in IMG/M |
| 3300006620 | Marine coastal surface water microbial communities in Port Hacking, Sydney, Australia ? TJ10 time point | Environmental | Open in IMG/M |
| 3300006752 | Marine viral communities from the Subarctic Pacific Ocean - 13_ETSP_OMZ_AT15268 metaG | Environmental | Open in IMG/M |
| 3300006793 | Marine viral communities from the Subarctic Pacific Ocean - 17_ETSP_OMZ_AT15314 metaG | Environmental | Open in IMG/M |
| 3300006867 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_22_N_<0.8_DNA | Environmental | Open in IMG/M |
| 3300006922 | Marine viral communities from the Subarctic Pacific Ocean - 11_ETSP_OMZ_AT15265 metaG | Environmental | Open in IMG/M |
| 3300006925 | Marine viral communities from the Subarctic Pacific Ocean - 14_ETSP_OMZ_AT15311 metaG | Environmental | Open in IMG/M |
| 3300007234 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Fall_15_<0.8_DNA | Environmental | Open in IMG/M |
| 3300007539 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_1M Viral MetaG | Environmental | Open in IMG/M |
| 3300007623 | Water microbial communities from South San Francisco under conditions of wetland restoration - Salt Pond MetaG R2A_A_H2O_MG | Environmental | Open in IMG/M |
| 3300007640 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Aug_28 | Environmental | Open in IMG/M |
| 3300007973 | Coastal water column microbial communities from Columbia River Estuary, Oregon, USA - CMOP_DNA_1460A_0.2um | Environmental | Open in IMG/M |
| 3300007992 | Coastal water column microbial communities from Columbia River Estuary, Oregon, USA - CMOP_DNA_1461AB_0.2um | Environmental | Open in IMG/M |
| 3300009000 | Salt pond water microbial communities from South San Francisco under conditions of wetland restoration - Salt Pond MetaG SF2_B_H2O_MG | Environmental | Open in IMG/M |
| 3300009001 | Salt pond water microbial communities from South San Francisco under conditions of wetland restoration - Salt Pond MetaG SF2_C_H2O_MG | Environmental | Open in IMG/M |
| 3300009027 | Salt pond water microbial communities from South San Francisco under conditions of wetland restoration - Salt Pond MetaG SF2_A_H2O_MG | Environmental | Open in IMG/M |
| 3300009058 | Estuarine microbial communities from the Columbia River estuary - metaG 1370A-02 | Environmental | Open in IMG/M |
| 3300009077 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_110328 | Environmental | Open in IMG/M |
| 3300009472 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_110404 | Environmental | Open in IMG/M |
| 3300009498 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_120426 | Environmental | Open in IMG/M |
| 3300009593 | Marine eukaryotic phytoplankton communities from Atlantic Ocean - Tropical Atlantic ANT8 Metagenome | Environmental | Open in IMG/M |
| 3300012928 | Marine microbial communities from the Costa Rica Dome - CRUD Field 142mm St17 metaG | Environmental | Open in IMG/M |
| 3300012953 | Marine eukaryotic phytoplankton communities from the Atlantic Ocean - Atlantic ANT 2 Metagenome | Environmental | Open in IMG/M |
| 3300012954 | Marine microbial communities from the Costa Rica Dome - CRUD Field 142mm St18 metaG | Environmental | Open in IMG/M |
| 3300017713 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 14 SPOT_SRF_2010-08-11 | Environmental | Open in IMG/M |
| 3300017714 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 35 SPOT_SRF_2012-08-15 | Environmental | Open in IMG/M |
| 3300017742 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 22 SPOT_SRF_2011-05-21 | Environmental | Open in IMG/M |
| 3300017746 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 12 SPOT_SRF_2010-06-29 | Environmental | Open in IMG/M |
| 3300017752 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 23 SPOT_SRF_2011-06-22 | Environmental | Open in IMG/M |
| 3300017753 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 30 SPOT_SRF_2012-01-26 | Environmental | Open in IMG/M |
| 3300017755 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 34 SPOT_SRF_2012-07-09 | Environmental | Open in IMG/M |
| 3300017757 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 43 SPOT_SRF_2013-05-22 | Environmental | Open in IMG/M |
| 3300017762 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 45 SPOT_SRF_2013-07-18 | Environmental | Open in IMG/M |
| 3300017770 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 15 SPOT_SRF_2010-09-15 (version 2) | Environmental | Open in IMG/M |
| 3300017771 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 48 SPOT_SRF_2013-11-13 | Environmental | Open in IMG/M |
| 3300017776 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 17 SPOT_SRF_2010-11-23 | Environmental | Open in IMG/M |
| 3300017956 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 071403BT metaG (megahit assembly) | Environmental | Open in IMG/M |
| 3300017962 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 071404AT metaG (megahit assembly) | Environmental | Open in IMG/M |
| 3300017967 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 071411BT metaG (megahit assembly) | Environmental | Open in IMG/M |
| 3300018876 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 011513CT metaG (megahit assembly) | Environmental | Open in IMG/M |
| 3300020175 | Pelagic subsurface seawater microbial communities from Kabeltonne, Helgoland, North Sea - Helgoland_Spring_Bloom_20160321_2 | Environmental | Open in IMG/M |
| 3300020247 | Marine microbial communities from Tara Oceans - TARA_B100000902 (ERX556048-ERR598962) | Environmental | Open in IMG/M |
| 3300020339 | Marine microbial communities from Tara Oceans - TARA_B100000674 (ERX555929-ERR599080) | Environmental | Open in IMG/M |
| 3300020340 | Marine microbial communities from Tara Oceans - TARA_B100001121 (ERX555960-ERR599119) | Environmental | Open in IMG/M |
| 3300020379 | Marine microbial communities from Tara Oceans - TARA_B100000902 (ERX556001-ERR599168) | Environmental | Open in IMG/M |
| 3300020395 | Marine microbial communities from Tara Oceans - TARA_B100000427 (ERX555987-ERR599133) | Environmental | Open in IMG/M |
| 3300020416 | Marine microbial communities from Tara Oceans - TARA_B100001109 (ERX556137-ERR599039) | Environmental | Open in IMG/M |
| 3300020429 | Marine microbial communities from Tara Oceans - TARA_B100000614 (ERX556134-ERR599032) | Environmental | Open in IMG/M |
| 3300020436 | Marine microbial communities from Tara Oceans - TARA_B100000424 (ERX556009-ERR598984) | Environmental | Open in IMG/M |
| 3300020438 | Marine microbial communities from Tara Oceans - TARA_B100001094 (ERX555907-ERR598942) | Environmental | Open in IMG/M |
| 3300020439 | Marine microbial communities from Tara Oceans - TARA_B100001939 (ERX556062-ERR599029) | Environmental | Open in IMG/M |
| 3300020457 | Marine microbial communities from Tara Oceans - TARA_B100001113 (ERX555941-ERR599014) | Environmental | Open in IMG/M |
| 3300021356 | Coastal seawater microbial communities near Pivers Island, North Carolina, United States - PICO245 | Environmental | Open in IMG/M |
| 3300021958 | Estuarine water microbial communities from San Francisco Bay, California, United States - C33_27D | Environmental | Open in IMG/M |
| 3300021959 | Estuarine water microbial communities from San Francisco Bay, California, United States - C33_13D | Environmental | Open in IMG/M |
| 3300021964 | Estuarine water microbial communities from San Francisco Bay, California, United States - C33_34D | Environmental | Open in IMG/M |
| 3300022187 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Sep_01 (v3) | Environmental | Open in IMG/M |
| 3300024346 | Whole water sample coassembly | Environmental | Open in IMG/M |
| 3300025083 | Marine viral communities from the Subarctic Pacific Ocean - 11_ETSP_OMZ_AT15265 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025084 | Marine viral communities from the Subarctic Pacific Ocean - 14B_ETSP_OMZ_AT15311_CsCl metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025108 | Marine viral communities from the Subarctic Pacific Ocean - 17_ETSP_OMZ_AT15314 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025674 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_1M Viral MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025712 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_110321 (SPAdes) | Environmental | Open in IMG/M |
| 3300025828 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_22_N_<0.8_DNA (SPAdes) | Environmental | Open in IMG/M |
| 3300025889 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_18 (SPAdes) | Environmental | Open in IMG/M |
| 3300025890 | Pelagic Microbial community sample from North Sea - COGITO 998_met_08 (SPAdes) | Environmental | Open in IMG/M |
| 3300026187 | Salt pond water microbial communities from South San Francisco under conditions of wetland restoration - Salt Pond MetaG SF2_C_H2O_MG (SPAdes) | Environmental | Open in IMG/M |
| 3300026465 | Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - 48R (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300027757 | Estuarine microbial communities from the Columbia River estuary - Ebb tide ETM metaG S.759 (SPAdes) | Environmental | Open in IMG/M |
| 3300027906 | Marine eukaryotic phytoplankton communities from Atlantic Ocean - Tropical Atlantic ANT8 Metagenome (SPAdes) | Environmental | Open in IMG/M |
| 3300028115 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 011501CT (spades assembly) | Environmental | Open in IMG/M |
| 3300028196 | Marine microbial communities from Saanich Inlet, British Columbia, Canada - SI112_10m | Environmental | Open in IMG/M |
| 3300032047 | Ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M1 40m 34915 | Environmental | Open in IMG/M |
| 3300032277 | Microbial mat bacterial communities from mineral coupon in-situ incubated in ocean water Damariscotta River, Maine, United States - 3-month pyrrhotite | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| DelMOSum2011_100182493 | 3300000115 | Marine | NKEKHYLKACKSDWNCGEYFYGPKYSMCKQCRDKEMC* |
| DelMOSum2011_101118062 | 3300000115 | Marine | MIDNKEKHYLKACQSDMKCGNYFYHTKYRYCEQCRAKDYC* |
| DelMOSpr2010_100040041 | 3300000116 | Marine | DNKEKHYLKACKSDWNCGEYFYGPKYSMCKQCRDKEMC* |
| DelMOSpr2010_100073745 | 3300000116 | Marine | MIDNKEKHYLKACKSDWNCGEYFYGPKYSMCKQCRDKEMC* |
| DelMOSpr2010_100114514 | 3300000116 | Marine | MIDNKDTAILKPCESDSKCGNYFYHTKYRYCEQCRAKDMC* |
| DelMOSpr2010_100898182 | 3300000116 | Marine | MMDNKDTDILKPCESDFKCGNYFYHTKYRYCEQCRAKDVC* |
| DelMOWin2010_101323091 | 3300000117 | Marine | KDTDILKPCESDFKCGNYFYHTKYRYCEQCRAKDVC* |
| DelMOWin2010_102149762 | 3300000117 | Marine | MINTLSNKQDDILKACQSDFKCGNYFYHTKYRYCEQCRAKDYC* |
| JGI20151J14362_100237262 | 3300001346 | Pelagic Marine | MIDNKEKHYLKACKSDWNCGEYFYGPKYSMCKQCRNKEMC* |
| JGI20158J14315_100118253 | 3300001355 | Pelagic Marine | MIDNKEKHYLKSCKSDWNCGEYFYGPKYRYCKQCRDKEMC* |
| GOS2250_10291403 | 3300001957 | Marine | MIDNKDKDILKPCESDFKCGNYFYHTKYRYCEQCRVKDMC* |
| GOS2243_10719094 | 3300001965 | Marine | MIDNKEKNVLKACQSDFNCGNYFYHTKYRYCEICRAKDMC* |
| Ga0073579_11743024 | 3300005239 | Marine | MIDNKQKDILQACQSDMKCGNYFYHTKYRYCEQCRAKDYC* |
| Ga0101444_1178914 | 3300006620 | Marine Surface Water | RIVAMIDNKQKDILKACKSEIKCGNYFYSTEYRYCEQCRSREMC* |
| Ga0098048_100107115 | 3300006752 | Marine | MIDNKDREVLKPCKSDFKCGNYFYGPKYQYCEICRAKDMC* |
| Ga0098048_10095293 | 3300006752 | Marine | MIDNKEKQYLKACKSDFKCGNYFYGPKYQYCEICRAKDMC* |
| Ga0098048_10103932 | 3300006752 | Marine | MIDNKEKHYLKACKSDFKCGNYFYGPKYQYCEQCRAKDMC* |
| Ga0098055_100035931 | 3300006793 | Marine | MGRGRMIDNKDREVLKPCKSDFKCGNYFYGPKYQYCEICRAKDMC* |
| Ga0098055_10325872 | 3300006793 | Marine | MIDNKEKQYLKACKSDFKCGNYFYGPKYQYCEQCRAKDMC* |
| Ga0075476_102656071 | 3300006867 | Aqueous | RTVVEMIDNKHSDILKPCESDLKCGNYFYHTKYRYCEQCRAKDYC* |
| Ga0098045_10528703 | 3300006922 | Marine | VNNIDNKEKNYLKSCKSDFKCGNYFYHSTFRYCEQCRAKDMC* |
| Ga0098050_11387841 | 3300006925 | Marine | RMIDNKDREVLKPCKSDFKCGNYFYGPKYQYCEICRAKDMC* |
| Ga0075460_100111453 | 3300007234 | Aqueous | MIDNKDTDILKPCESDFKCGNYFYHTKYRYCEQCRTKDYC* |
| Ga0099849_10124422 | 3300007539 | Aqueous | MIDNKDTDILKPCESDFKCGNYFYHTKYKYCEQCRAKDMC* |
| Ga0102948_10345332 | 3300007623 | Water | MIDNKEKHYLKACKSDFKCGNYFYGPKYQFCEKCRAKEMC* |
| Ga0070751_10093603 | 3300007640 | Aqueous | MTDNKDTDILKPCESDFKCGNYFYHTKYRYCEQCRAKDVC* |
| Ga0105746_13131742 | 3300007973 | Estuary Water | MGRGIMIDNKEKHYLKACKSDFKCGNYFYGPKYQYCEQCRAKDMC* |
| Ga0105748_101290981 | 3300007992 | Estuary Water | MIDNKEKHYLKACKSDFKCGNYFYGPKYQYCEICRAK |
| Ga0102960_10395891 | 3300009000 | Pond Water | MVDNKQKDYLKACKSDFKCGNYFYGPDYRYCEQCRTKDMC* |
| Ga0102963_10218151 | 3300009001 | Pond Water | NKQKDYLKACKSDFKCGNYFYGPDYRYCEQCRTKDMC* |
| Ga0102957_10455912 | 3300009027 | Pond Water | MVDNKEKHYLKACKSDWNCGEYFYGPQYNMCKQCRTKEMC* |
| Ga0102854_10154752 | 3300009058 | Estuarine | MIDNKEKHYLKACKSDWNCGEYFYGPQYKYCKKCRAKEMC* |
| Ga0115552_14178642 | 3300009077 | Pelagic Marine | AMVDNKEKHYLKACKSDWNCGEYFYGPQYSMCKQCRDKEMC* |
| Ga0115554_12545181 | 3300009472 | Pelagic Marine | IMIDNKEKHYLKACKSDWNCGEYFYGPKYSMCKQCRDKEMC* |
| Ga0115568_101164411 | 3300009498 | Pelagic Marine | IVAMVDNKEKHYLKACKSDWNCGEYFYGPQYSMCKQCRDKEMC* |
| Ga0115011_100060203 | 3300009593 | Marine | MIDNKDTDILKPCESEIKCGNYFYSPIYRYCEQCRVKDMC* |
| Ga0163110_107989192 | 3300012928 | Surface Seawater | MGRRRMIDNKEKKFLKACQSDFACGNYFYHTKYRYCEICRTKDWC* |
| Ga0163179_100400573 | 3300012953 | Seawater | MISTLSNKQDDILKSCESEFKCGNYFYHPKYRYCELCRAKDWC* |
| Ga0163111_100553812 | 3300012954 | Surface Seawater | MIDNKDKDILKPCESDFKCGNYFYHSKYRYCEQCRAKDMC* |
| Ga0181391_10003393 | 3300017713 | Seawater | MEEAVVLDNKEKHYLKACKSDWDCGEYFYGPKYQYCRKCRDKDMC |
| Ga0181391_10084703 | 3300017713 | Seawater | MIDNKEKHYLKACKSDFKCGNYFYGPKYQYCEKCRAKDMC |
| Ga0181412_10016532 | 3300017714 | Seawater | MIDNKEKHYLKACKSDWNCGEYFYGPQYSMCKQCRDKEMC |
| Ga0181399_11462251 | 3300017742 | Seawater | XMGRRVMIDNKDKEVLKPCKSDFKCGNYFYGPKYQYCEKCRAKDMC |
| Ga0181389_10016982 | 3300017746 | Seawater | MGRGRMIDNKEKHYLKSCKSDWNCGEYFYGPQYSMCKKCRDKEMC |
| Ga0181400_10545011 | 3300017752 | Seawater | KEKHYLKACKSDFKCGNYFYGPEYRYCKQCRAKDMC |
| Ga0181407_11438492 | 3300017753 | Seawater | MIDNKEKSYLKSCESDWDCGNYFYGPKYKYCEQCRAKDMC |
| Ga0181411_10020051 | 3300017755 | Seawater | IDNKEKHYLKACKSDWNCGEYFYGPQYSMCKQCRDKEMC |
| Ga0181420_10055302 | 3300017757 | Seawater | MLDNKEKHYLKACKSDWNCGEYFYGPQYSMCKQCRDKEMC |
| Ga0181422_12016091 | 3300017762 | Seawater | DNKEKHYLKACKSDWDCGEYFYGPKYQYCRKCRDKDMC |
| Ga0187217_10045641 | 3300017770 | Seawater | MDIKMIDNKEKHYLKACKSDFKCGNYFYGPKYQYCEKCRAKDMC |
| Ga0181425_12737541 | 3300017771 | Seawater | DKEVLKPCKSDFKCGNYFYGPKYKYCEQCRAKDMC |
| Ga0181394_10343083 | 3300017776 | Seawater | DNKEKHYLKACKSDWNCGEYFYGPQYSMCKQCRDKEMC |
| Ga0181394_10949861 | 3300017776 | Seawater | DKEVLKPCKSDFKCGNYFYGPEYRYCKQCRAKDMC |
| Ga0181580_100072457 | 3300017956 | Salt Marsh | MIDNKYTDILKPCESDFKCGNYFYHTKYRYCEQCRAKDVC |
| Ga0181581_100027645 | 3300017962 | Salt Marsh | MIDNKYTDILKPCESDFKCGNYFYHTKYRYCEQCRAKDIC |
| Ga0181590_100661172 | 3300017967 | Salt Marsh | MMSNKDTDILKPCESDFKCGNYFYHTKYRYCEQCRTKDYC |
| Ga0181590_109876192 | 3300017967 | Salt Marsh | MIDNKDTDILKPCESDFKCGNYFYHTKYRYCEQCRAKDMC |
| Ga0181564_105642952 | 3300018876 | Salt Marsh | MIDNKDTDILKPCESDFKCGNYFYHTKYRYCEQCRTKDYC |
| Ga0206124_100755701 | 3300020175 | Seawater | MVDNKEKHYLKACKSDWNCGEYFYGPKYRYCKQCRDKEMC |
| Ga0211654_10613912 | 3300020247 | Marine | MIDNKEKTYLKSCKSDWDCGNYFYGPKYRYCKQCREKDMC |
| Ga0211605_10397841 | 3300020339 | Marine | MIATNKNTDILKKCESDFNCGNYFYHTKYRYCEQC |
| Ga0211594_10697762 | 3300020340 | Marine | MIATNKNTDILKKCESDFNCGNYFYHTKYRYCEQCRAKDWC |
| Ga0211652_101226702 | 3300020379 | Marine | IMIDNKEKHYLKACKSDFKCGNYFYGPKYQYCEQCRAKDMC |
| Ga0211705_100288603 | 3300020395 | Marine | MLNSTLSNKQDDILKPCESEFKCGNYFYHSKYRYCEQCRAKDWC |
| Ga0211644_100317391 | 3300020416 | Marine | MIDNKDSDILKACESDFKCGNYFYHSKYRYCEQCRAK |
| Ga0211581_103424912 | 3300020429 | Marine | MGRRMIDNKDSDILKACESDFKCGNYFYHSKYRYCEQC |
| Ga0211708_100124912 | 3300020436 | Marine | MITTNKSTDILKKCESDFNCGNYFYHTKYRYCEQCRAKDWC |
| Ga0211576_100006263 | 3300020438 | Marine | MIDNKDKEVLKPCKSDFKCGNYFYGPKYKYCEQCRAKDMC |
| Ga0211576_100064144 | 3300020438 | Marine | MIDNKEKHYLKACKSDWNCGEYFYGPQYKYCKKCRAKEMC |
| Ga0211576_100179553 | 3300020438 | Marine | MIDNKDKEVLKPCKSDFKCGNYFYGPEYRYCKQCRAKDMC |
| Ga0211558_104027582 | 3300020439 | Marine | MGRRRMIDNKEKKFLKACQSDLACGNYFYHTKYRYCEVCRTKDWC |
| Ga0211643_100153153 | 3300020457 | Marine | MIDNKDSDILKACESDFKCGNYFYHSKYRYCEQCRAKDMC |
| Ga0213858_100390002 | 3300021356 | Seawater | MIDNKDSDILKACESDFACGNYFYHTKYRYCEQCRVKDMC |
| Ga0222718_100006795 | 3300021958 | Estuarine Water | MIDNKQKDILQACQSDMKCGNYFYHTKYRYCEQCRAKDYC |
| Ga0222718_100024182 | 3300021958 | Estuarine Water | MVDNKEKHYLKACKSDWNCGEYFYGPQYNMCKQCRTKEMC |
| Ga0222718_100222113 | 3300021958 | Estuarine Water | MIDNKEKHYLKACKSDFKCGNYFYGPKYQFCEKCRAKEMC |
| Ga0222716_106268723 | 3300021959 | Estuarine Water | MVDNKQKDYLKACKSDFKCGNYFYGPDYRYCEQCRAKD |
| Ga0222719_100123573 | 3300021964 | Estuarine Water | MIDNKEKHYLKACKSDWNCGEYFYGPKYSMCKQCRAKDMC |
| Ga0196899_10038382 | 3300022187 | Aqueous | MMDNKDTDILKPCESDFKCGNYFYHTKYRYCEQCRAKDVC |
| Ga0196899_10241692 | 3300022187 | Aqueous | MIDNKDTAILKPCESDSKCGNYFYHTKYRYCEQCRAKDMC |
| Ga0244775_106158601 | 3300024346 | Estuarine | GRGIMIDNKEKHYLKSCKSDWNCGEYFYGPQYSMCKKCRAKEMC |
| Ga0208791_10524371 | 3300025083 | Marine | IDNKDREVLKPCKSDFKCGNYFYGPKYQYCEICRAKDMC |
| Ga0208298_10002741 | 3300025084 | Marine | MIDNKEKQYLKACKSDFKCGNYFYGPKYQYCEICRAKDMC |
| Ga0208298_10035473 | 3300025084 | Marine | MGRGRMIDNKDREVLKPCKSDFKCGNYFYGPKYQYCEICRAKDMC |
| Ga0208298_10694732 | 3300025084 | Marine | MIDNKEKHYLKACKSDFKCGNYFYGPKYQYCEQCRAKDMC |
| Ga0208793_10245093 | 3300025108 | Marine | MIDNKEKQYLKACKSDFKCGNYFYGPKYQYCEQCRAKDMC |
| Ga0208162_10462722 | 3300025674 | Aqueous | MIDNKDTDILKPCESDFKCGNYFYHTKYKYCEQCRAKDMC |
| Ga0209305_10005448 | 3300025712 | Pelagic Marine | MIDNKEKHYLKACKSDWNCGEYFYGPKYSMCKQCRDKEMC |
| Ga0208547_10017433 | 3300025828 | Aqueous | MTDNKDTDILKPCESDFKCGNYFYHTKYRYCEQCRAKDVC |
| Ga0208547_11502191 | 3300025828 | Aqueous | RTVVEMIDNKHSDILKPCESDLKCGNYFYHTKYRYCEQCRAKDYC |
| Ga0208644_10515823 | 3300025889 | Aqueous | IDNKDTDILKPCESDFKCGNYFYHTKYRYCEQCRTKDYC |
| Ga0209631_100213861 | 3300025890 | Pelagic Marine | DNKEKHYLKACKSDWNCGEYFYGPKYSMCKQCRNKEMC |
| Ga0209631_100744303 | 3300025890 | Pelagic Marine | DNKEKHYLKACKSDWNCGEYFYGPKYSMCKQCRDKEMC |
| Ga0209929_10088243 | 3300026187 | Pond Water | MVDNKQKDYLKACKSDFKCGNYFYGPDYRYCEQCRAKDMC |
| Ga0209929_10251313 | 3300026187 | Pond Water | NKQKDYLKACKSDFKCGNYFYGPDYRYCEQCRTKDMC |
| Ga0247588_11300531 | 3300026465 | Seawater | KEKHYLKACKSDWNCGEYFYGPQYSMCKQCRDKEMC |
| Ga0208671_100825792 | 3300027757 | Estuarine | IVAMVDNKEKHYLKACKSDFKCGNYFYGPKYQYCEQCRAKDMC |
| Ga0209404_100046123 | 3300027906 | Marine | MIDNKDTDILKPCESEIKCGNYFYSPIYRYCEQCRVKDMC |
| Ga0233450_101233741 | 3300028115 | Salt Marsh | MIDNKDSNILKACQSDFSCGNYFYHTKYRYCEQCRAKDY |
| Ga0257114_11530552 | 3300028196 | Marine | MVDNKEKHYLKACKSDWNCGEYFYGPQYSMCKKCRDKEMC |
| Ga0315330_100241132 | 3300032047 | Seawater | MIATNESTDILKKCESDFACGNYFYHTKYRYCEQCRSKDWC |
| Ga0316202_100367473 | 3300032277 | Microbial Mat | IMIDNKEKHYLKACKSDWNCGEYFYGPKYSMCKQCRDKEMC |
| ⦗Top⦘ |