| Basic Information | |
|---|---|
| Family ID | F101063 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 102 |
| Average Sequence Length | 42 residues |
| Representative Sequence | FAKDYARNADDINRLLYVGVTRTRQTLHIVLPKNEQKGFRF |
| Number of Associated Samples | 86 |
| Number of Associated Scaffolds | 102 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Unclassified |
| % of genes with valid RBS motifs | 0.00 % |
| % of genes near scaffold ends (potentially truncated) | 99.02 % |
| % of genes from short scaffolds (< 2000 bps) | 92.16 % |
| Associated GOLD sequencing projects | 82 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.38 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Unclassified (78.431 % of family members) |
| NCBI Taxonomy ID | N/A |
| Taxonomy | N/A |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Aquatic → Marine → Coastal → Unclassified → Aqueous (32.353 % of family members) |
| Environment Ontology (ENVO) | Unclassified (48.039 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Saline → Water (saline) (49.020 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 42.03% β-sheet: 0.00% Coil/Unstructured: 57.97% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.38 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 102 Family Scaffolds |
|---|---|---|
| PF01612 | DNA_pol_A_exo1 | 79.41 |
| PF01555 | N6_N4_Mtase | 6.86 |
| PF00145 | DNA_methylase | 0.98 |
| PF13245 | AAA_19 | 0.98 |
| PF00476 | DNA_pol_A | 0.98 |
| COG ID | Name | Functional Category | % Frequency in 102 Family Scaffolds |
|---|---|---|---|
| COG0863 | DNA modification methylase | Replication, recombination and repair [L] | 6.86 |
| COG1041 | tRNA G10 N-methylase Trm11 | Translation, ribosomal structure and biogenesis [J] | 6.86 |
| COG2189 | Adenine specific DNA methylase Mod | Replication, recombination and repair [L] | 6.86 |
| COG0270 | DNA-cytosine methylase | Replication, recombination and repair [L] | 0.98 |
| COG0749 | DNA polymerase I, 3'-5' exonuclease and polymerase domains | Replication, recombination and repair [L] | 0.98 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| Unclassified | root | N/A | 78.43 % |
| All Organisms | root | All Organisms | 21.57 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300000101|DelMOSum2010_c10229713 | Not Available | 599 | Open in IMG/M |
| 3300001460|JGI24003J15210_10040986 | Not Available | 1607 | Open in IMG/M |
| 3300003277|JGI25908J49247_10125365 | All Organisms → cellular organisms → Bacteria | 607 | Open in IMG/M |
| 3300003388|JGI25910J50241_10052374 | All Organisms → cellular organisms → Bacteria | 1261 | Open in IMG/M |
| 3300003411|JGI25911J50253_10128872 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 743 | Open in IMG/M |
| 3300003493|JGI25923J51411_1001625 | All Organisms → cellular organisms → Bacteria | 4709 | Open in IMG/M |
| 3300005584|Ga0049082_10147307 | Not Available | 817 | Open in IMG/M |
| 3300005662|Ga0078894_10044811 | All Organisms → cellular organisms → Bacteria | 3722 | Open in IMG/M |
| 3300006026|Ga0075478_10051564 | Not Available | 1348 | Open in IMG/M |
| 3300006027|Ga0075462_10093942 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → Maribacter → unclassified Maribacter → Maribacter sp. | 934 | Open in IMG/M |
| 3300006637|Ga0075461_10095453 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → Maribacter → unclassified Maribacter → Maribacter sp. | 937 | Open in IMG/M |
| 3300006637|Ga0075461_10144008 | Not Available | 732 | Open in IMG/M |
| 3300006637|Ga0075461_10151166 | Not Available | 711 | Open in IMG/M |
| 3300006641|Ga0075471_10139834 | Not Available | 1285 | Open in IMG/M |
| 3300006802|Ga0070749_10377142 | Not Available | 785 | Open in IMG/M |
| 3300006802|Ga0070749_10467918 | Not Available | 689 | Open in IMG/M |
| 3300006802|Ga0070749_10606277 | Not Available | 590 | Open in IMG/M |
| 3300006802|Ga0070749_10639203 | Not Available | 572 | Open in IMG/M |
| 3300006810|Ga0070754_10249160 | Not Available | 811 | Open in IMG/M |
| 3300006810|Ga0070754_10424585 | Not Available | 579 | Open in IMG/M |
| 3300006874|Ga0075475_10040836 | Not Available | 2213 | Open in IMG/M |
| 3300006875|Ga0075473_10087058 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1232 | Open in IMG/M |
| 3300006916|Ga0070750_10199469 | Not Available | 887 | Open in IMG/M |
| 3300006919|Ga0070746_10484493 | Not Available | 545 | Open in IMG/M |
| 3300006919|Ga0070746_10488842 | Not Available | 542 | Open in IMG/M |
| 3300007234|Ga0075460_10048568 | Not Available | 1599 | Open in IMG/M |
| 3300007276|Ga0070747_1030338 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales | 2149 | Open in IMG/M |
| 3300007344|Ga0070745_1011582 | Not Available | 4170 | Open in IMG/M |
| 3300007344|Ga0070745_1078781 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 1312 | Open in IMG/M |
| 3300007346|Ga0070753_1083340 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 1265 | Open in IMG/M |
| 3300007346|Ga0070753_1326798 | Not Available | 544 | Open in IMG/M |
| 3300007540|Ga0099847_1121081 | Not Available | 788 | Open in IMG/M |
| 3300007640|Ga0070751_1077041 | Not Available | 1406 | Open in IMG/M |
| 3300007640|Ga0070751_1198564 | Not Available | 781 | Open in IMG/M |
| 3300008055|Ga0108970_11460979 | Not Available | 611 | Open in IMG/M |
| 3300008116|Ga0114350_1033411 | Not Available | 2013 | Open in IMG/M |
| 3300008259|Ga0114841_1139383 | Not Available | 981 | Open in IMG/M |
| 3300008470|Ga0115371_11015884 | Not Available | 598 | Open in IMG/M |
| 3300009149|Ga0114918_10435714 | Not Available | 709 | Open in IMG/M |
| 3300009152|Ga0114980_10234000 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → Maribacter → unclassified Maribacter → Maribacter sp. | 1075 | Open in IMG/M |
| 3300009432|Ga0115005_11266205 | Not Available | 601 | Open in IMG/M |
| 3300009601|Ga0114914_1045133 | Not Available | 722 | Open in IMG/M |
| 3300010354|Ga0129333_11121436 | Not Available | 656 | Open in IMG/M |
| 3300010354|Ga0129333_11442611 | Not Available | 565 | Open in IMG/M |
| 3300010388|Ga0136551_1098181 | Not Available | 510 | Open in IMG/M |
| 3300010883|Ga0133547_11686844 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → Maribacter → unclassified Maribacter → Maribacter sp. | 1178 | Open in IMG/M |
| 3300012012|Ga0153799_1038245 | Not Available | 904 | Open in IMG/M |
| 3300012013|Ga0153805_1047427 | Not Available | 729 | Open in IMG/M |
| 3300013010|Ga0129327_10151659 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → Maribacter → unclassified Maribacter → Maribacter sp. | 1155 | Open in IMG/M |
| (restricted) 3300013131|Ga0172373_10321908 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → Maribacter → unclassified Maribacter → Maribacter sp. | 988 | Open in IMG/M |
| 3300013372|Ga0177922_10256135 | Not Available | 513 | Open in IMG/M |
| 3300013372|Ga0177922_11051340 | Not Available | 1113 | Open in IMG/M |
| 3300017709|Ga0181387_1126512 | Not Available | 526 | Open in IMG/M |
| 3300017722|Ga0181347_1149679 | Not Available | 638 | Open in IMG/M |
| 3300017723|Ga0181362_1061862 | Not Available | 767 | Open in IMG/M |
| 3300017736|Ga0181365_1083682 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Dehalococcoidia → unclassified Dehalococcoidia → Dehalococcoidia bacterium | 780 | Open in IMG/M |
| 3300017736|Ga0181365_1144409 | Not Available | 565 | Open in IMG/M |
| 3300017755|Ga0181411_1064299 | Not Available | 1116 | Open in IMG/M |
| 3300017758|Ga0181409_1124234 | Not Available | 761 | Open in IMG/M |
| 3300017761|Ga0181356_1193840 | Not Available | 605 | Open in IMG/M |
| 3300017774|Ga0181358_1265229 | Not Available | 535 | Open in IMG/M |
| 3300017964|Ga0181589_10445032 | Not Available | 846 | Open in IMG/M |
| 3300019783|Ga0181361_117130 | Not Available | 573 | Open in IMG/M |
| 3300020179|Ga0194134_10027329 | Not Available | 3565 | Open in IMG/M |
| 3300020205|Ga0211731_10756065 | Not Available | 753 | Open in IMG/M |
| 3300020578|Ga0194129_10311818 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → Maribacter → unclassified Maribacter → Maribacter sp. | 875 | Open in IMG/M |
| 3300021169|Ga0206687_1688359 | Not Available | 874 | Open in IMG/M |
| 3300021424|Ga0194117_10391282 | Not Available | 639 | Open in IMG/M |
| 3300021957|Ga0222717_10609419 | Not Available | 571 | Open in IMG/M |
| 3300021961|Ga0222714_10493192 | Not Available | 630 | Open in IMG/M |
| 3300021963|Ga0222712_10316099 | Not Available | 974 | Open in IMG/M |
| 3300022167|Ga0212020_1014579 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → Maribacter → unclassified Maribacter → Maribacter sp. | 1217 | Open in IMG/M |
| 3300022190|Ga0181354_1143869 | Not Available | 751 | Open in IMG/M |
| 3300022198|Ga0196905_1098776 | All Organisms → cellular organisms → Bacteria | 781 | Open in IMG/M |
| 3300022407|Ga0181351_1172512 | Not Available | 754 | Open in IMG/M |
| 3300022407|Ga0181351_1234027 | Not Available | 585 | Open in IMG/M |
| 3300022934|Ga0255781_10102667 | Not Available | 1558 | Open in IMG/M |
| 3300025647|Ga0208160_1157433 | Not Available | 544 | Open in IMG/M |
| 3300025751|Ga0208150_1076358 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → Maribacter → unclassified Maribacter → Maribacter sp. | 1114 | Open in IMG/M |
| 3300025759|Ga0208899_1200778 | Not Available | 634 | Open in IMG/M |
| 3300025769|Ga0208767_1129409 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → Maribacter → unclassified Maribacter → Maribacter sp. | 954 | Open in IMG/M |
| 3300025818|Ga0208542_1132014 | Not Available | 692 | Open in IMG/M |
| 3300027917|Ga0209536_101811811 | Not Available | 736 | Open in IMG/M |
| 3300027972|Ga0209079_10183207 | Not Available | 716 | Open in IMG/M |
| (restricted) 3300028114|Ga0247835_1105325 | Not Available | 1090 | Open in IMG/M |
| (restricted) 3300028557|Ga0247832_1169948 | Not Available | 813 | Open in IMG/M |
| 3300031612|Ga0308009_10123256 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → Maribacter → unclassified Maribacter → Maribacter sp. | 984 | Open in IMG/M |
| 3300031621|Ga0302114_10359998 | Not Available | 554 | Open in IMG/M |
| 3300031626|Ga0302121_10039636 | Not Available | 1500 | Open in IMG/M |
| 3300031628|Ga0308014_1046631 | Not Available | 1075 | Open in IMG/M |
| 3300031660|Ga0307994_1149198 | Not Available | 782 | Open in IMG/M |
| 3300031669|Ga0307375_10244233 | Not Available | 1179 | Open in IMG/M |
| 3300031673|Ga0307377_10495078 | Not Available | 891 | Open in IMG/M |
| 3300031758|Ga0315907_10298721 | Not Available | 1323 | Open in IMG/M |
| 3300031857|Ga0315909_10380490 | Not Available | 1019 | Open in IMG/M |
| 3300031951|Ga0315904_10127465 | Not Available | 2621 | Open in IMG/M |
| 3300031951|Ga0315904_10878535 | Not Available | 727 | Open in IMG/M |
| 3300032050|Ga0315906_10689433 | Not Available | 822 | Open in IMG/M |
| 3300032073|Ga0315315_10805682 | Not Available | 855 | Open in IMG/M |
| 3300032116|Ga0315903_10840872 | Not Available | 664 | Open in IMG/M |
| 3300032116|Ga0315903_11080907 | Not Available | 553 | Open in IMG/M |
| 3300034101|Ga0335027_0477185 | Not Available | 788 | Open in IMG/M |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Aqueous | Environmental → Aquatic → Marine → Coastal → Unclassified → Aqueous | 32.35% |
| Freshwater Lake | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lake | 14.71% |
| Freshwater | Environmental → Aquatic → Freshwater → Unclassified → Unclassified → Freshwater | 6.86% |
| Marine | Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine | 4.90% |
| Freshwater | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater | 3.92% |
| Freshwater | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater | 3.92% |
| Freshwater Lake | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake | 2.94% |
| Freshwater To Marine Saline Gradient | Environmental → Aquatic → Marine → Coastal → Unclassified → Freshwater To Marine Saline Gradient | 2.94% |
| Marine | Environmental → Aquatic → Marine → Unclassified → Unclassified → Marine | 2.94% |
| Estuarine Water | Environmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine Water | 2.94% |
| Seawater | Environmental → Aquatic → Marine → Strait → Unclassified → Seawater | 2.94% |
| Freshwater, Plankton | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater, Plankton | 1.96% |
| Salt Marsh | Environmental → Aquatic → Marine → Intertidal Zone → Salt Marsh → Salt Marsh | 1.96% |
| Soil | Environmental → Terrestrial → Soil → Clay → Unclassified → Soil | 1.96% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Freshwater Sediment | 0.98% |
| Freshwater Lentic | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lentic | 0.98% |
| Freshwater Lake | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake | 0.98% |
| Surface Ice | Environmental → Aquatic → Freshwater → Ice → Unclassified → Surface Ice | 0.98% |
| Pond Fresh Water | Environmental → Aquatic → Freshwater → Pond → Unclassified → Pond Fresh Water | 0.98% |
| Deep Ocean | Environmental → Aquatic → Marine → Oceanic → Unclassified → Deep Ocean | 0.98% |
| Seawater | Environmental → Aquatic → Marine → Oceanic → Unclassified → Seawater | 0.98% |
| Marine Sediment | Environmental → Aquatic → Marine → Oceanic → Sediment → Marine Sediment | 0.98% |
| Deep Subsurface | Environmental → Aquatic → Marine → Oceanic → Sediment → Deep Subsurface | 0.98% |
| Seawater | Environmental → Aquatic → Marine → Intertidal Zone → Unclassified → Seawater | 0.98% |
| Marine | Environmental → Aquatic → Marine → Neritic Zone → Unclassified → Marine | 0.98% |
| Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Sediment | 0.98% |
| Estuary | Host-Associated → Plants → Leaf → Unclassified → Unclassified → Estuary | 0.98% |
| Visualization |
|---|
| Powered by ApexCharts |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300000101 | Marine microbial communities from Delaware Coast, sample from Delaware MO Early Summer May 2010 | Environmental | Open in IMG/M |
| 3300001460 | Marine viral communities from the Pacific Ocean - LP-28 | Environmental | Open in IMG/M |
| 3300003277 | Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM15.SD | Environmental | Open in IMG/M |
| 3300003388 | Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM110.SN | Environmental | Open in IMG/M |
| 3300003411 | Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM110.SD | Environmental | Open in IMG/M |
| 3300003493 | Freshwater lake microbial communities from Lake Michigan, USA - Fa13.BD.MM15.SN | Environmental | Open in IMG/M |
| 3300005584 | Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG HU45MSRF | Environmental | Open in IMG/M |
| 3300005662 | Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MLB.SD (version 4) | Environmental | Open in IMG/M |
| 3300006026 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_29_D_<0.8_DNA | Environmental | Open in IMG/M |
| 3300006027 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Fall_30_<0.8_DNA | Environmental | Open in IMG/M |
| 3300006637 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Fall_15_>0.8_DNA | Environmental | Open in IMG/M |
| 3300006641 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_0.19_D_>0.8_DNA | Environmental | Open in IMG/M |
| 3300006802 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_18 | Environmental | Open in IMG/M |
| 3300006810 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Sep_01 | Environmental | Open in IMG/M |
| 3300006874 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_22_D_>0.8_DNA | Environmental | Open in IMG/M |
| 3300006875 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_0.19_N_>0.8_DNA | Environmental | Open in IMG/M |
| 3300006916 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_24 | Environmental | Open in IMG/M |
| 3300006919 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Mar_21 | Environmental | Open in IMG/M |
| 3300007234 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Fall_15_<0.8_DNA | Environmental | Open in IMG/M |
| 3300007276 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Mar_31 | Environmental | Open in IMG/M |
| 3300007344 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Mar_4 | Environmental | Open in IMG/M |
| 3300007346 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Aug_31 | Environmental | Open in IMG/M |
| 3300007540 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1504_2 Viral MetaG | Environmental | Open in IMG/M |
| 3300007640 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Aug_28 | Environmental | Open in IMG/M |
| 3300008055 | Metatranscriptomes of the Eelgrass leaves and roots. Combined Assembly of Gp0128390, Gp0128391, Gp0128392, and Gp0128393 | Host-Associated | Open in IMG/M |
| 3300008116 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE2, Sample E2014-0106-3-NA | Environmental | Open in IMG/M |
| 3300008259 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, sample HABS-E2014-0132-C-NA | Environmental | Open in IMG/M |
| 3300008470 | Sediment core microbial communities from Adelie Basin, Antarctica. Combined Assembly of Gp0136540, Gp0136562, Gp0136563 | Environmental | Open in IMG/M |
| 3300009149 | Deep subsurface microbial communities from Baltic Sea to uncover new lineages of life (NeLLi) - Landsort_02402 metaG | Environmental | Open in IMG/M |
| 3300009152 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140806_EF_MetaG | Environmental | Open in IMG/M |
| 3300009432 | Marine eukaryotic phytoplankton communities from Arctic Ocean - Arctic Ocean - Greenland ARC118M Metagenome | Environmental | Open in IMG/M |
| 3300009601 | Marine viral communities from the Global Malaspina Expedition - Malaspina viral metaG Antarct_38 | Environmental | Open in IMG/M |
| 3300010354 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_0.6_0.8_DNA | Environmental | Open in IMG/M |
| 3300010388 | Freshwater microbial communities from the surface of the forest pond in Jussy, Geneva, Switzerland - JEBV, may 2015 | Environmental | Open in IMG/M |
| 3300010883 | western Arctic Ocean co-assembly | Environmental | Open in IMG/M |
| 3300012012 | Freshwater microbial communities from Eastern Basin Lake Erie, Ontario, Canada - Station 879 - Top - Depth 1m | Environmental | Open in IMG/M |
| 3300012013 | Freshwater microbial communities from Eastern Basin Lake Erie, Ontario, Canada - Station 67 - Surface Ice | Environmental | Open in IMG/M |
| 3300013010 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Spr_31_0.8_DNA | Environmental | Open in IMG/M |
| 3300013131 (restricted) | Freshwater microbial communities from Kabuno Bay, South-Kivu, Congo ? kab_092012_10m | Environmental | Open in IMG/M |
| 3300013372 | Freshwater microbial communities from Lake Erie, Ontario, Canada. Combined Assembly of 10 SPs | Environmental | Open in IMG/M |
| 3300017709 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 10 SPOT_SRF_2010-04-27 | Environmental | Open in IMG/M |
| 3300017722 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM110.S.N | Environmental | Open in IMG/M |
| 3300017723 | Freshwater viral communities from Lake Michigan, USA - Su13.ND.MM110.S.N | Environmental | Open in IMG/M |
| 3300017736 | Freshwater viral communities from Lake Michigan, USA - Fa13.ND.MM110.D.N | Environmental | Open in IMG/M |
| 3300017755 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 34 SPOT_SRF_2012-07-09 | Environmental | Open in IMG/M |
| 3300017758 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 32 SPOT_SRF_2012-05-30 | Environmental | Open in IMG/M |
| 3300017761 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM110.S.N | Environmental | Open in IMG/M |
| 3300017774 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM110.S.D | Environmental | Open in IMG/M |
| 3300017964 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 071410BT metaG (megahit assembly) | Environmental | Open in IMG/M |
| 3300019783 | Freshwater viral communities from Lake Michigan, USA - Sp13.ND.MM110.S.N | Environmental | Open in IMG/M |
| 3300020179 | Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015056 Kigoma Offshore 0m | Environmental | Open in IMG/M |
| 3300020205 | Freshwater lake microbial communities from Lake Erken, Sweden - P4710_103 megahit1 | Environmental | Open in IMG/M |
| 3300020578 | Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015038 Kigoma Deep Cast 35m | Environmental | Open in IMG/M |
| 3300021169 | Metatranscriptome of ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M1 30m 12015 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300021424 | Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015009 Mahale N1 surface | Environmental | Open in IMG/M |
| 3300021957 | Estuarine water microbial communities from San Francisco Bay, California, United States - C33_18D | Environmental | Open in IMG/M |
| 3300021961 | Estuarine water microbial communities from San Francisco Bay, California, United States - C33_3D | Environmental | Open in IMG/M |
| 3300021963 | Estuarine water microbial communities from San Francisco Bay, California, United States - C33_657D | Environmental | Open in IMG/M |
| 3300022167 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Mar_4 (v2) | Environmental | Open in IMG/M |
| 3300022190 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM15.S.N | Environmental | Open in IMG/M |
| 3300022198 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_1S Viral MetaG (v3) | Environmental | Open in IMG/M |
| 3300022407 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM15.S.D | Environmental | Open in IMG/M |
| 3300022934 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 101413BT metaG | Environmental | Open in IMG/M |
| 3300025647 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1504_1 Viral MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025751 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_29_D_>0.8_DNA (SPAdes) | Environmental | Open in IMG/M |
| 3300025759 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_24 (SPAdes) | Environmental | Open in IMG/M |
| 3300025769 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Mar_21 (SPAdes) | Environmental | Open in IMG/M |
| 3300025818 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Fall_15_<0.8_DNA (SPAdes) | Environmental | Open in IMG/M |
| 3300027917 | Marine sediment microbial communities from White Oak River estuary, North Carolina - WOR-2-8_12 (SPAdes) | Environmental | Open in IMG/M |
| 3300027972 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (6) Depth 10-12cm September2015 (SPAdes) | Environmental | Open in IMG/M |
| 3300028114 (restricted) | Freshwater microbial communities from meromictic Lake La Cruz, Castile-La Mancha, Spain - LaCruzMarch2015_13.5m | Environmental | Open in IMG/M |
| 3300028557 (restricted) | Freshwater microbial communities from meromictic Lake La Cruz, Castile-La Mancha, Spain - LaCruzMarch2015_4m | Environmental | Open in IMG/M |
| 3300031612 | Marine microbial communities from water near the shore, Antarctic Ocean - #127 | Environmental | Open in IMG/M |
| 3300031621 | Marine microbial communities from Western Arctic Ocean, Canada - AG5_Surface | Environmental | Open in IMG/M |
| 3300031626 | Marine microbial communities from Western Arctic Ocean, Canada - CB21_surface | Environmental | Open in IMG/M |
| 3300031628 | Marine microbial communities from water near the shore, Antarctic Ocean - #229 | Environmental | Open in IMG/M |
| 3300031660 | Marine microbial communities from Ellis Fjord, Antarctic Ocean - #261 | Environmental | Open in IMG/M |
| 3300031669 | Soil microbial communities from Risofladan, Vaasa, Finland - TR-1 | Environmental | Open in IMG/M |
| 3300031673 | Soil microbial communities from Risofladan, Vaasa, Finland - TR-3 | Environmental | Open in IMG/M |
| 3300031758 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 12 MA123 | Environmental | Open in IMG/M |
| 3300031857 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 2 MA125 | Environmental | Open in IMG/M |
| 3300031951 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 12 MA120 | Environmental | Open in IMG/M |
| 3300032050 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 2 MA122 | Environmental | Open in IMG/M |
| 3300032073 | Ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M1 40m 3416 | Environmental | Open in IMG/M |
| 3300032116 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 2 MA119 | Environmental | Open in IMG/M |
| 3300034101 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME19Sep2005-rr0107 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
Note: Some of these sequences are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| DelMOSum2010_102297131 | 3300000101 | Marine | YARDADDINRLLYVGVTRTRQSLHIVLPKNEQKGF* |
| JGI24003J15210_100409861 | 3300001460 | Marine | LLITDLSPKFAQDYARDADDINRLLYVGVTRTRQSLHIVLPKNEQKGFRF* |
| JGI25908J49247_101253652 | 3300003277 | Freshwater Lake | TRFAKDYEKNSDDINRLLYVGITRAKQTLHIVLPKNEQKGFRL* |
| JGI25910J50241_100523743 | 3300003388 | Freshwater Lake | KFANEYAKNSDDINRLLYVGITRARQSLHIILPKNEQKGFRF* |
| JGI25911J50253_101288722 | 3300003411 | Freshwater Lake | PKFANEYAKNSDDINRLLYVGITRARQSLHIILPKNEQKGFRF* |
| JGI25923J51411_10016252 | 3300003493 | Freshwater Lake | MSDLSTRFAKDYDKNSDDINRLLYVGITRAKQTLHIVLPKNELKGFRL* |
| Ga0049082_101473071 | 3300005584 | Freshwater Lentic | AKEYERNSDDVNRLLYVGITRAKQALHYVLPKNELKGFRL* |
| Ga0078894_100448119 | 3300005662 | Freshwater Lake | AVNSDSIHRMFYVGVTRAKKSLHIILPKNTNRGFQL* |
| Ga0075478_100515641 | 3300006026 | Aqueous | SPKFAKDYARNADDINRLLYVGVTRTRQSLHIVLPKNEERGFRF* |
| Ga0075462_100939422 | 3300006027 | Aqueous | LSPRFAKEYEYNADSIHRLLYVGVTRTRQALHIVLPKNGERGFRF* |
| Ga0075461_100954531 | 3300006637 | Aqueous | DLSPRFAKEYEYNADSIHRLLYVGVTRTRQALHIVLPKNGERGFRF* |
| Ga0075461_101440082 | 3300006637 | Aqueous | KEYEYNADSIHRLLYVGVTRTRQALHIVLPKNGERGFRF* |
| Ga0075461_101511662 | 3300006637 | Aqueous | LMTDLSPRFAKDYARNADDINRLLYVGVTRTREALHIVLPKNEQRGFRF* |
| Ga0075471_101398342 | 3300006641 | Aqueous | ADYAVNGDDINRLLYVGITRTRQTLHIIRPKRDDRGFRL* |
| Ga0070749_103771421 | 3300006802 | Aqueous | AKNADDINRLLYVGVTRTKHALHIVLPKNEEKGFRF* |
| Ga0070749_104679182 | 3300006802 | Aqueous | FAKDYARNADDINRLLYVGVTRTREALHIVLPKNEQRGFRF* |
| Ga0070749_106062771 | 3300006802 | Aqueous | NADDINRLLYVGVTRTKHALHIVLPKNEEKGFRF* |
| Ga0070749_106392031 | 3300006802 | Aqueous | DLSTKFAKDYDKNSDDINRLLYVGITRAKQTLHVVLPKNEQKGFRL* |
| Ga0070754_102491601 | 3300006810 | Aqueous | DYAKNADDINRLLYVGVTRTKHALHIVLPKNEEKGFRF* |
| Ga0070754_104245851 | 3300006810 | Aqueous | LTDLSPKFAKDYARNADDINRLLYVGVTRTRQSLHIVLPKNEERGFRF* |
| Ga0075475_100408363 | 3300006874 | Aqueous | SPKFAKDYAKNADDINRLLYVGVTRTKHALHIVLPKNEEKGFRF* |
| Ga0075473_100870582 | 3300006875 | Aqueous | ISDLSTKFAQEYERNSDDINRLLYVGITRAKQALHIVLPKNTQKGFRL* |
| Ga0070750_101994692 | 3300006916 | Aqueous | YAKNADDINRLLYVGVTRTKHALHIVLPKNEEKGFRF* |
| Ga0070746_104844931 | 3300006919 | Aqueous | LLLTDLSPKFAKDYAKNADDINRLLYVGVTRTKHALHIVLPKNEEKGFRF* |
| Ga0070746_104888421 | 3300006919 | Aqueous | NADDINRLLYVGVTRTRQSLHIVLPKNEERGFRF* |
| Ga0075460_100485682 | 3300007234 | Aqueous | YAKNADDINRLLYVGVTRTKQALHIVLPKNEEKGFRF* |
| Ga0070747_10303381 | 3300007276 | Aqueous | QDYARDADDINRLLYVGVTRTRQSLHIVLPKNEQKGFRF* |
| Ga0070745_10115821 | 3300007344 | Aqueous | RFAKDYARNADDINRLLYVGVTRTRKTLHIVLPKNEQKGFRF* |
| Ga0070745_10787812 | 3300007344 | Aqueous | VLLLTDLSPKFAKDYAKNADDINRLLYVGVTRTKHALHIVLPKNEEKGFRF* |
| Ga0070753_10833401 | 3300007346 | Aqueous | KNADDINRLLYVGVTRTKHALHIVLPKNEEKGFRF* |
| Ga0070753_13267981 | 3300007346 | Aqueous | SYDTNPDDINRLLYVGITRTRNVLHLVLPQYNQKGFRL* |
| Ga0099847_11210811 | 3300007540 | Aqueous | KDYAKNADDINRLLYVGVTRTRQSLHIVLPKNEERGFRF* |
| Ga0070751_10770411 | 3300007640 | Aqueous | DLSPKFAKDYAKNADDINRLLYVGVTRTKHALHIVLPKNEEKGFRF* |
| Ga0070751_11985642 | 3300007640 | Aqueous | RFAKEYEYNADSIHRLLYVGVTRTRQALHIVLPKNGERGFRF* |
| Ga0108970_114609792 | 3300008055 | Estuary | DNVLLIGDLSTKFAQEYDKNSDDINRLLYVGITRAKQSLHFVLPKNSYKGFRL* |
| Ga0114350_10334111 | 3300008116 | Freshwater, Plankton | DLSTRFAKDYEKNSDDINRLLYVGITRAKQTLHIVLPKNEQKGFRL* |
| Ga0114841_11393832 | 3300008259 | Freshwater, Plankton | STRFAKDYEKNSDDINRLLYVGITRAKQTLHIVLPKNEQKGFRL* |
| Ga0115371_110158841 | 3300008470 | Sediment | NADDINRLLYVGVTRTRQSLHIVLPKNNQKGFRF* |
| Ga0114918_104357142 | 3300009149 | Deep Subsurface | MTDLSPRFAKDYARNADDINRLLYVGVTRTRKTLHIVLPKNEQKGFRF* |
| Ga0114980_102340002 | 3300009152 | Freshwater Lake | DLSTKFAKEYDHNADDINRLLYVAVTRTREVLHIVQPKNTLKAFRF* |
| Ga0115005_112662051 | 3300009432 | Marine | TDLSPKFAKDYAKNADDINRLLYVGVTRARQSLHIVLPKNNQKGFRF* |
| Ga0114914_10451331 | 3300009601 | Deep Ocean | LMTDLSPKFAKDYARNADDINRLLYVGVTRTRQTLHIVLPKNEQKGFRF* |
| Ga0129333_111214361 | 3300010354 | Freshwater To Marine Saline Gradient | FANEYENNPDDINRLLYVGITRAKQALHIVLPKNTQKGFRL* |
| Ga0129333_114426111 | 3300010354 | Freshwater To Marine Saline Gradient | LIGDLSTKFAQEYDKNSDDINRLLYVGITRAKQSLHFVLPKNSYKGFRL* |
| Ga0136551_10981811 | 3300010388 | Pond Fresh Water | KNSDDINRLLYVGITRAKQTLHIVLPKNEQKGFRL* |
| Ga0133547_116868441 | 3300010883 | Marine | LMTDLSPKFAKDYAKNADDINRLLYVGVTRTRQTLHIVLPKNEQKGFRF* |
| Ga0153799_10382451 | 3300012012 | Freshwater | STRFAKDYDKNSDDINRLLYVGITRAKQTLHIVLPKNELKGFRL* |
| Ga0153805_10474272 | 3300012013 | Surface Ice | RFAKDYDKNSDDINRLMYVGITRAKQTLHIVLPKNEQKGFRL* |
| Ga0129327_101516591 | 3300013010 | Freshwater To Marine Saline Gradient | KFAKDYAKNADDINRLLYVGVTRTRQSLHIVLPKNEERGFRF* |
| (restricted) Ga0172373_103219081 | 3300013131 | Freshwater | YDTNPDDINRLLYVGITRTRNVLHLVLPQYNQKGFRL* |
| Ga0177922_102561351 | 3300013372 | Freshwater | DKNSDDINRLLYVGITRAKQSLHFVLPKNSYKGFRL* |
| Ga0177922_110513402 | 3300013372 | Freshwater | LMSDLSTRFAKDYDKNSDDINRLLYVGITRAKQSLHIVLPKNEQKGFRL* |
| Ga0181387_11265121 | 3300017709 | Seawater | PKFAKDYARDADDINRLLYVGVTRTRQSLHIVLPKNEQKGFRF |
| Ga0181347_11496792 | 3300017722 | Freshwater Lake | YDKNSDDINRLLYVGITRAKQTLHIVLPKNEQKGFRL |
| Ga0181362_10618622 | 3300017723 | Freshwater Lake | ITDLSPKFATAYAKDADNINRLLYVGITRAKKTLHIVLPKDYTKAFRL |
| Ga0181365_10836821 | 3300017736 | Freshwater Lake | LSPRFAAEYAKDADNINRLLYVGITRAKKSLHIVLPKDYTKAFRL |
| Ga0181365_11444091 | 3300017736 | Freshwater Lake | LSDLSTRSAREYDRNSDDINRLLYVGITRAKQTLHVVLPKNEQKGFRL |
| Ga0181411_10642991 | 3300017755 | Seawater | SPKFAKDYARDADDINRLLYVGVTRTRQSLHIVLPKNEQKGFRF |
| Ga0181409_11242341 | 3300017758 | Seawater | PKFAKDYAKNADDINRLLYVGVTRTRQSLHIVLPKNEQKGFRF |
| Ga0181356_11938402 | 3300017761 | Freshwater Lake | AAEYAKDADNINRLLYVGITRAKKSLHIVLPKDYTKAFRL |
| Ga0181358_12652292 | 3300017774 | Freshwater Lake | SDLSTRSAREYDRNSDDINRLLYVGITRAKQTLHIVLPKNEQKGFRL |
| Ga0181589_104450321 | 3300017964 | Salt Marsh | KNADDINRLLYVGVTRTREALHIVLPKNEQRGFRF |
| Ga0181361_1171301 | 3300019783 | Freshwater Lake | DLSPKFANEYAKNSDDINRLLYVGITRARQSLHIILPKNEQKGFRF |
| Ga0194134_100273291 | 3300020179 | Freshwater Lake | RSSDDLNRLLYVGITRARKTLHLVLPKDEQKGFRL |
| Ga0211731_107560651 | 3300020205 | Freshwater | DKNSDDINRLLYVGITRAKQTLHIVLPKNEQKGFRL |
| Ga0194129_103118182 | 3300020578 | Freshwater Lake | DLSTKFVNESTRSSDDLNRLLYVGITRARKTLHLVLPKDEQKGFRL |
| Ga0206687_16883591 | 3300021169 | Seawater | DYAKNADDINRLLYVGVTRTRQSLHIVLPKNEERGFRF |
| Ga0194117_103912822 | 3300021424 | Freshwater Lake | KEYYRNADDIHRLLYVGVTRARQSLHIVLPKNEQKGFRV |
| Ga0222717_106094192 | 3300021957 | Estuarine Water | KFAKDYAKNADDINRLLYVGVTRTRQSLHIVLPKNEERGFRF |
| Ga0222714_104931921 | 3300021961 | Estuarine Water | TKFAKDYERNSDDINRLLYVGITRAKQSLHIVLPKNEQKGFRL |
| Ga0222712_103160992 | 3300021963 | Estuarine Water | LITDLSPKFANEYAKNSDDINRLLYVGITRARQSLHIILPKNEQKGFRF |
| Ga0212020_10145792 | 3300022167 | Aqueous | LLLTDLSPKFAKDYAKNADDINRLLYVGVTRTKHALHIVLPKNEEKGFRF |
| Ga0181354_11438691 | 3300022190 | Freshwater Lake | RNPDDINRLLYVAITRAKKSLHIVRCADQYKGFRI |
| Ga0196905_10987761 | 3300022198 | Aqueous | VLLLTDLSPKFAKDYAKNADDINRLLYVGVTRTKHALHIVLPKNEEKGFRF |
| Ga0181351_11725122 | 3300022407 | Freshwater Lake | RVLSDLSTRFAKEYERNSDDINRLLYVGITRAKQELHIVLPKNQQKGFHL |
| Ga0181351_12340272 | 3300022407 | Freshwater Lake | FVKDYDKNSDDINRLLYVGITRAKQTLHIVLPKNEQKGFRL |
| Ga0255781_101026671 | 3300022934 | Salt Marsh | YNADSIHRLLYVGVTRTRQALHIVLPKNGERGFRF |
| Ga0208160_11574332 | 3300025647 | Aqueous | KNPDDIHRLLYVGITRAKQSLHVVLPKDMRKGFML |
| Ga0208150_10763581 | 3300025751 | Aqueous | AKDYARNADDINRLLYVGVTRTRQSLHIVLPKNEERGFRF |
| Ga0208899_12007782 | 3300025759 | Aqueous | FAKEYEYNADSIHRLLYVGVTRTRQALHIVLPKNGERGFRF |
| Ga0208767_11294091 | 3300025769 | Aqueous | KEYEYNADSIHRLLYVGVTRTRQALHIVLPKNGERGFRF |
| Ga0208542_11320141 | 3300025818 | Aqueous | AKEYAKNADDINRLLYVGVTRTKQALHIVLPKNEEKGFRF |
| Ga0209536_1018118111 | 3300027917 | Marine Sediment | EYDRNADDIHRLLYVGITRARQSLHVVLPKNEYKGFRL |
| Ga0209079_101832072 | 3300027972 | Freshwater Sediment | LIGDLSTKFAQEYDKNSDDINRLLYVGITRAKQSLHFVLPKNSYKGFRL |
| (restricted) Ga0247835_11053251 | 3300028114 | Freshwater | AKDYEKNSDDINRLLYVGITRAKQTLHIVLPKNEQKGFRL |
| (restricted) Ga0247832_11699482 | 3300028557 | Freshwater | STRFAKDYEKNSDDINRLLYVGITRAKQTLHIVLPKNEQKGFRL |
| Ga0308009_101232561 | 3300031612 | Marine | FAKDYAKNADDINRLLYVGVTRTRQSLHIVLPKNNQKGFRF |
| Ga0302114_103599981 | 3300031621 | Marine | KDYAKNADDINRLLYVGVTRTRQSLHIVLPKNNQKGFRF |
| Ga0302121_100396362 | 3300031626 | Marine | LSPKFAKDYAKNADDINRLLYVGVTRTRQTLHIVLPKNEQKGFRF |
| Ga0308014_10466311 | 3300031628 | Marine | ARNADDINRLLYVGVTRTRQSLHIVLPKNNQKGFRF |
| Ga0307994_11491981 | 3300031660 | Marine | FAKDYARNADDINRLLYVGVTRTRQTLHIVLPKNEQKGFRF |
| Ga0307375_102442331 | 3300031669 | Soil | LLMTDFSPRFAKDYARNADDINRLLYVGVTRTRKTLHIVLPKNEQKGFRF |
| Ga0307377_104950781 | 3300031673 | Soil | KFAKEYAKNADDINRLLYVGVTRTKQALHIVLPKNEEKGFRF |
| Ga0315907_102987212 | 3300031758 | Freshwater | YERNADDINRLLYVGVTRAKQSLHIVLPKNTQKGFRL |
| Ga0315909_103804902 | 3300031857 | Freshwater | KDYDKNSDDINRLLYVGITRAKQTLHIVLPKNEQKGFRL |
| Ga0315904_101274651 | 3300031951 | Freshwater | DLTTKFAKDYERNSDDINRLLYVGITRAKQSLHIVLPKFEQKGFRL |
| Ga0315904_108785352 | 3300031951 | Freshwater | TRFAKEYDKNSDDINRLLYVGITRAKQTLHIVRPKNEQKGFRL |
| Ga0315906_106894333 | 3300032050 | Freshwater | AENSDSIHRMFYVGVTRAKKSLHIILPKNTNRGFQL |
| Ga0315315_108056822 | 3300032073 | Seawater | LSPKFAKDYARDADDINRLLYVGVTRTRQSLHIVLPKNEQKGFRF |
| Ga0315903_108408721 | 3300032116 | Freshwater | EYAENSDSIHRMFYVGVTRAKKSLHIILPKNTNRGFQL |
| Ga0315903_110809071 | 3300032116 | Freshwater | LLLDLSTRFAKDYDKNSDDINRLLYVGITRAKQTLHIVLPKNEQKGFRL |
| Ga0335027_0477185_678_788 | 3300034101 | Freshwater | ERNSDDINRLLYVGITRAKQSLHIVLPKNEQKGFRL |
| ⦗Top⦘ |