| Basic Information | |
|---|---|
| Family ID | F101050 |
| Family Type | Metagenome |
| Number of Sequences | 102 |
| Average Sequence Length | 43 residues |
| Representative Sequence | MSKGNREKKKPKADKSKLKPAAAATPFGAASNAGKAAGKRK |
| Number of Associated Samples | 86 |
| Number of Associated Scaffolds | 102 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | No |
| Most common taxonomic group | Unclassified |
| % of genes with valid RBS motifs | 76.47 % |
| % of genes near scaffold ends (potentially truncated) | 18.63 % |
| % of genes from short scaffolds (< 2000 bps) | 75.49 % |
| Associated GOLD sequencing projects | 76 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.16 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Unclassified (50.000 % of family members) |
| NCBI Taxonomy ID | N/A |
| Taxonomy | N/A |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere (10.784 % of family members) |
| Environment Ontology (ENVO) | Unclassified (53.922 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Host-associated → Plant → Plant rhizosphere (48.039 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 0.00% β-sheet: 0.00% Coil/Unstructured: 100.00% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.16 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 102 Family Scaffolds |
|---|---|---|
| PF02485 | Branch | 6.86 |
| PF00313 | CSD | 5.88 |
| PF00072 | Response_reg | 1.96 |
| PF11752 | DUF3309 | 1.96 |
| PF01145 | Band_7 | 1.96 |
| PF01451 | LMWPc | 1.96 |
| PF13419 | HAD_2 | 0.98 |
| PF01464 | SLT | 0.98 |
| PF13193 | AMP-binding_C | 0.98 |
| PF03413 | PepSY | 0.98 |
| PF07690 | MFS_1 | 0.98 |
| PF04116 | FA_hydroxylase | 0.98 |
| PF02353 | CMAS | 0.98 |
| PF02518 | HATPase_c | 0.98 |
| PF12840 | HTH_20 | 0.98 |
| PF16859 | TetR_C_11 | 0.98 |
| PF01547 | SBP_bac_1 | 0.98 |
| PF02600 | DsbB | 0.98 |
| PF08085 | Entericidin | 0.98 |
| PF13581 | HATPase_c_2 | 0.98 |
| PF01936 | NYN | 0.98 |
| PF08327 | AHSA1 | 0.98 |
| PF01339 | CheB_methylest | 0.98 |
| PF13439 | Glyco_transf_4 | 0.98 |
| PF08281 | Sigma70_r4_2 | 0.98 |
| PF00196 | GerE | 0.98 |
| PF07568 | HisKA_2 | 0.98 |
| COG ID | Name | Functional Category | % Frequency in 102 Family Scaffolds |
|---|---|---|---|
| COG2201 | Chemotaxis response regulator CheB, contains REC and protein-glutamate methylesterase domains | Signal transduction mechanisms [T] | 1.96 |
| COG1432 | NYN domain, predicted PIN-related RNAse, tRNA/rRNA maturation | General function prediction only [R] | 0.98 |
| COG1495 | Disulfide bond formation protein DsbB | Posttranslational modification, protein turnover, chaperones [O] | 0.98 |
| COG2226 | Ubiquinone/menaquinone biosynthesis C-methylase UbiE/MenG | Coenzyme transport and metabolism [H] | 0.98 |
| COG2227 | 2-polyprenyl-3-methyl-5-hydroxy-6-metoxy-1,4-benzoquinol methylase | Coenzyme transport and metabolism [H] | 0.98 |
| COG2230 | Cyclopropane fatty-acyl-phospholipid synthase and related methyltransferases | Lipid transport and metabolism [I] | 0.98 |
| COG3000 | Sterol desaturase/sphingolipid hydroxylase, fatty acid hydroxylase superfamily | Lipid transport and metabolism [I] | 0.98 |
| COG3920 | Two-component sensor histidine kinase, HisKA and HATPase domains | Signal transduction mechanisms [T] | 0.98 |
| COG5510 | Predicted small secreted protein | Function unknown [S] | 0.98 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 50.00 % |
| Unclassified | root | N/A | 50.00 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 2228664021|ICCgaii200_c0484135 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 886 | Open in IMG/M |
| 3300000033|ICChiseqgaiiDRAFT_c2424078 | All Organisms → cellular organisms → Bacteria | 1618 | Open in IMG/M |
| 3300004114|Ga0062593_102108043 | Not Available | 629 | Open in IMG/M |
| 3300004157|Ga0062590_102732735 | Not Available | 526 | Open in IMG/M |
| 3300005327|Ga0070658_10133652 | All Organisms → cellular organisms → Bacteria | 2069 | Open in IMG/M |
| 3300005331|Ga0070670_101185205 | Not Available | 698 | Open in IMG/M |
| 3300005331|Ga0070670_102213373 | Not Available | 506 | Open in IMG/M |
| 3300005334|Ga0068869_100060316 | All Organisms → cellular organisms → Bacteria | 2780 | Open in IMG/M |
| 3300005335|Ga0070666_10085546 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 2160 | Open in IMG/M |
| 3300005338|Ga0068868_101557181 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 620 | Open in IMG/M |
| 3300005339|Ga0070660_101301654 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 617 | Open in IMG/M |
| 3300005339|Ga0070660_101502280 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 573 | Open in IMG/M |
| 3300005339|Ga0070660_101691475 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 539 | Open in IMG/M |
| 3300005344|Ga0070661_100714820 | All Organisms → cellular organisms → Bacteria | 817 | Open in IMG/M |
| 3300005347|Ga0070668_100881815 | Not Available | 799 | Open in IMG/M |
| 3300005367|Ga0070667_100505608 | Not Available | 1108 | Open in IMG/M |
| 3300005459|Ga0068867_100184096 | Not Available | 1662 | Open in IMG/M |
| 3300005534|Ga0070735_10392482 | Not Available | 831 | Open in IMG/M |
| 3300005541|Ga0070733_10476304 | Not Available | 834 | Open in IMG/M |
| 3300005548|Ga0070665_100756484 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Acidimicrobiia → Acidimicrobiales → environmental samples → uncultured Acidimicrobiales bacterium | 985 | Open in IMG/M |
| 3300005563|Ga0068855_100058216 | All Organisms → cellular organisms → Bacteria | 4526 | Open in IMG/M |
| 3300005578|Ga0068854_100656269 | Not Available | 901 | Open in IMG/M |
| 3300005616|Ga0068852_101112648 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 810 | Open in IMG/M |
| 3300005841|Ga0068863_102715660 | Not Available | 504 | Open in IMG/M |
| 3300005842|Ga0068858_100024127 | All Organisms → cellular organisms → Bacteria | 5667 | Open in IMG/M |
| 3300005843|Ga0068860_100253337 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1715 | Open in IMG/M |
| 3300005844|Ga0068862_102028161 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 586 | Open in IMG/M |
| 3300006059|Ga0075017_100670524 | Not Available | 796 | Open in IMG/M |
| 3300006638|Ga0075522_10115609 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1433 | Open in IMG/M |
| 3300006642|Ga0075521_10053389 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1770 | Open in IMG/M |
| 3300009551|Ga0105238_12652895 | Not Available | 537 | Open in IMG/M |
| 3300009551|Ga0105238_12675129 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 535 | Open in IMG/M |
| 3300009553|Ga0105249_12273963 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 615 | Open in IMG/M |
| 3300010371|Ga0134125_10503201 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1342 | Open in IMG/M |
| 3300010379|Ga0136449_100981260 | Not Available | 1363 | Open in IMG/M |
| 3300010396|Ga0134126_10005746 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 15516 | Open in IMG/M |
| 3300011120|Ga0150983_11205599 | Not Available | 541 | Open in IMG/M |
| 3300012929|Ga0137404_11417720 | Not Available | 642 | Open in IMG/M |
| 3300013296|Ga0157374_11656065 | Not Available | 664 | Open in IMG/M |
| 3300013296|Ga0157374_12121150 | Not Available | 589 | Open in IMG/M |
| 3300013306|Ga0163162_10035766 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 4948 | Open in IMG/M |
| 3300013306|Ga0163162_10606337 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Caulobacterales → Caulobacteraceae → Brevundimonas → Brevundimonas intermedia | 1221 | Open in IMG/M |
| 3300013308|Ga0157375_13203903 | Not Available | 546 | Open in IMG/M |
| 3300014489|Ga0182018_10134626 | Not Available | 1421 | Open in IMG/M |
| 3300014499|Ga0182012_10446374 | Not Available | 847 | Open in IMG/M |
| 3300014501|Ga0182024_10005409 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 28662 | Open in IMG/M |
| 3300014501|Ga0182024_10018105 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 13151 | Open in IMG/M |
| 3300014501|Ga0182024_11529514 | All Organisms → cellular organisms → Bacteria | 760 | Open in IMG/M |
| 3300014501|Ga0182024_12325042 | Not Available | 583 | Open in IMG/M |
| 3300014838|Ga0182030_10334636 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 1634 | Open in IMG/M |
| 3300014968|Ga0157379_10001600 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 18672 | Open in IMG/M |
| 3300014969|Ga0157376_11251877 | Not Available | 771 | Open in IMG/M |
| 3300015264|Ga0137403_10457046 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1152 | Open in IMG/M |
| 3300015371|Ga0132258_10974744 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 2142 | Open in IMG/M |
| 3300019874|Ga0193744_1054707 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 765 | Open in IMG/M |
| 3300020027|Ga0193752_1028343 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 2586 | Open in IMG/M |
| 3300020579|Ga0210407_10699892 | Not Available | 786 | Open in IMG/M |
| 3300021178|Ga0210408_10902226 | Not Available | 688 | Open in IMG/M |
| 3300021404|Ga0210389_10161515 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1740 | Open in IMG/M |
| 3300021478|Ga0210402_11215142 | Not Available | 681 | Open in IMG/M |
| 3300022908|Ga0247779_1107799 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 728 | Open in IMG/M |
| 3300025321|Ga0207656_10130017 | Not Available | 1179 | Open in IMG/M |
| 3300025711|Ga0207696_1140007 | All Organisms → cellular organisms → Bacteria | 648 | Open in IMG/M |
| 3300025862|Ga0209483_1018821 | Not Available | 3596 | Open in IMG/M |
| 3300025903|Ga0207680_10042082 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 2670 | Open in IMG/M |
| 3300025909|Ga0207705_10131792 | All Organisms → cellular organisms → Bacteria | 1861 | Open in IMG/M |
| 3300025909|Ga0207705_10459552 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Caulobacterales → Caulobacteraceae → Brevundimonas → Brevundimonas intermedia | 987 | Open in IMG/M |
| 3300025913|Ga0207695_10178367 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2046 | Open in IMG/M |
| 3300025924|Ga0207694_10691475 | Not Available | 860 | Open in IMG/M |
| 3300025924|Ga0207694_11633971 | Not Available | 543 | Open in IMG/M |
| 3300025925|Ga0207650_10985227 | Not Available | 717 | Open in IMG/M |
| 3300025930|Ga0207701_10695534 | Not Available | 861 | Open in IMG/M |
| 3300025960|Ga0207651_10827404 | Not Available | 822 | Open in IMG/M |
| 3300026088|Ga0207641_11775087 | Not Available | 619 | Open in IMG/M |
| 3300027903|Ga0209488_10106146 | All Organisms → cellular organisms → Bacteria | 2108 | Open in IMG/M |
| 3300027911|Ga0209698_11174168 | Not Available | 566 | Open in IMG/M |
| 3300028379|Ga0268266_10004094 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 14080 | Open in IMG/M |
| 3300028379|Ga0268266_10013994 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 6906 | Open in IMG/M |
| 3300029882|Ga0311368_10076748 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2930 | Open in IMG/M |
| 3300029882|Ga0311368_10707453 | Not Available | 696 | Open in IMG/M |
| 3300029910|Ga0311369_10123575 | Not Available | 2552 | Open in IMG/M |
| 3300029911|Ga0311361_10130786 | Not Available | 3390 | Open in IMG/M |
| 3300029911|Ga0311361_10163184 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 2872 | Open in IMG/M |
| 3300031057|Ga0170834_109518948 | Not Available | 728 | Open in IMG/M |
| 3300031238|Ga0265332_10478920 | Not Available | 515 | Open in IMG/M |
| 3300031366|Ga0307506_10274873 | Not Available | 650 | Open in IMG/M |
| 3300031474|Ga0170818_106072535 | Not Available | 798 | Open in IMG/M |
| 3300031672|Ga0307373_10376223 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 842 | Open in IMG/M |
| 3300031708|Ga0310686_112652026 | Not Available | 1125 | Open in IMG/M |
| 3300031715|Ga0307476_10092364 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 2127 | Open in IMG/M |
| 3300031716|Ga0310813_10145154 | Not Available | 1903 | Open in IMG/M |
| 3300031718|Ga0307474_10101920 | Not Available | 2146 | Open in IMG/M |
| 3300031718|Ga0307474_11558301 | Not Available | 519 | Open in IMG/M |
| 3300031754|Ga0307475_10119465 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2074 | Open in IMG/M |
| 3300031962|Ga0307479_10893417 | Not Available | 861 | Open in IMG/M |
| 3300032160|Ga0311301_11833967 | Not Available | 720 | Open in IMG/M |
| 3300032174|Ga0307470_10060524 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1992 | Open in IMG/M |
| 3300032515|Ga0348332_11519847 | Not Available | 563 | Open in IMG/M |
| 3300032515|Ga0348332_13018141 | Not Available | 547 | Open in IMG/M |
| 3300033412|Ga0310810_11087408 | Not Available | 668 | Open in IMG/M |
| 3300033475|Ga0310811_10483742 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1306 | Open in IMG/M |
| 3300033887|Ga0334790_236800 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 510 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 10.78% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 6.86% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere | 6.86% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 5.88% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 4.90% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 4.90% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 3.92% |
| Permafrost | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Permafrost | 3.92% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 3.92% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 3.92% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 2.94% |
| Arctic Peat Soil | Environmental → Terrestrial → Soil → Unclassified → Permafrost → Arctic Peat Soil | 2.94% |
| Palsa | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa | 2.94% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 2.94% |
| Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 1.96% |
| Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 1.96% |
| Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 1.96% |
| Peatlands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil | 1.96% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 1.96% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 1.96% |
| Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil | 1.96% |
| Bog | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Bog | 1.96% |
| Bog | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Bog | 1.96% |
| Plant Litter | Environmental → Terrestrial → Plant Litter → Unclassified → Unclassified → Plant Litter | 1.96% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 1.96% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 1.96% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Corn, Switchgrass And Miscanthus Rhizosphere | 0.98% |
| Palsa | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Palsa | 0.98% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 0.98% |
| Soil | Environmental → Terrestrial → Soil → Clay → Unclassified → Soil | 0.98% |
| Soil | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Soil | 0.98% |
| Plant Litter | Environmental → Terrestrial → Plant Litter → Unclassified → Unclassified → Plant Litter | 0.98% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 0.98% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.98% |
| Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Rhizosphere | 0.98% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 2228664021 | Soil microbial communities from Great Prairies - Iowa, Continuous Corn soil | Environmental | Open in IMG/M |
| 3300000033 | Soil microbial communities from Great Prairies - Iowa, Continuous Corn soil | Environmental | Open in IMG/M |
| 3300004114 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of AARS Block 5 | Environmental | Open in IMG/M |
| 3300004157 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - - Combined assembly of AARS Block 2 | Environmental | Open in IMG/M |
| 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Host-Associated | Open in IMG/M |
| 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Host-Associated | Open in IMG/M |
| 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Host-Associated | Open in IMG/M |
| 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Host-Associated | Open in IMG/M |
| 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Host-Associated | Open in IMG/M |
| 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Host-Associated | Open in IMG/M |
| 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Host-Associated | Open in IMG/M |
| 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Host-Associated | Open in IMG/M |
| 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Host-Associated | Open in IMG/M |
| 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Host-Associated | Open in IMG/M |
| 3300005534 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen07_05102014_R1 | Environmental | Open in IMG/M |
| 3300005541 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen05_05102014_R1 | Environmental | Open in IMG/M |
| 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Host-Associated | Open in IMG/M |
| 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Host-Associated | Open in IMG/M |
| 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Host-Associated | Open in IMG/M |
| 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Host-Associated | Open in IMG/M |
| 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Host-Associated | Open in IMG/M |
| 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Host-Associated | Open in IMG/M |
| 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Host-Associated | Open in IMG/M |
| 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Host-Associated | Open in IMG/M |
| 3300006059 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Alex Branch Run_MetaG_ABR_2012 | Environmental | Open in IMG/M |
| 3300006638 | Arctic peat soil microbial communities from the Barrow Environmental Observatory site, Barrow, Alaska, USA - NGEE PermafrostL2-A | Environmental | Open in IMG/M |
| 3300006642 | Arctic peat soil microbial communities from the Barrow Environmental Observatory site, Barrow, Alaska, USA - NGEE PermafrostAB12-D | Environmental | Open in IMG/M |
| 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Host-Associated | Open in IMG/M |
| 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Host-Associated | Open in IMG/M |
| 3300010371 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-1 | Environmental | Open in IMG/M |
| 3300010379 | Sb_50d combined assembly | Environmental | Open in IMG/M |
| 3300010396 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-2 | Environmental | Open in IMG/M |
| 3300011120 | Combined assembly of Microbial Forest Soil metaT | Environmental | Open in IMG/M |
| 3300012929 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Host-Associated | Open in IMG/M |
| 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Host-Associated | Open in IMG/M |
| 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Host-Associated | Open in IMG/M |
| 3300014489 | Permafrost microbial communities from Stordalen Mire, Sweden - 812P2M metaG | Environmental | Open in IMG/M |
| 3300014499 | Permafrost microbial communities from Stordalen Mire, Sweden - 612S2S metaG | Environmental | Open in IMG/M |
| 3300014501 | Permafrost microbial communities from Stordalen Mire, Sweden - P3-2 metaG (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300014838 | Permafrost microbial communities from Stordalen Mire, Sweden - 812S3M metaG (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Host-Associated | Open in IMG/M |
| 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Host-Associated | Open in IMG/M |
| 3300015264 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300015371 | Combined assembly of cpr5 and col0 rhizosphere and soil | Host-Associated | Open in IMG/M |
| 3300019874 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L1a1 | Environmental | Open in IMG/M |
| 3300020027 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? H1c1 | Environmental | Open in IMG/M |
| 3300020579 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-M | Environmental | Open in IMG/M |
| 3300021178 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-4-M | Environmental | Open in IMG/M |
| 3300021404 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-28-O | Environmental | Open in IMG/M |
| 3300021478 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-M | Environmental | Open in IMG/M |
| 3300022908 | Plant litter microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-L221-509R-5 | Environmental | Open in IMG/M |
| 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025711 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025862 | Arctic peat soil microbial communities from the Barrow Environmental Observatory site, Barrow, Alaska, USA - NGEE PermafrostL2-A (SPAdes) | Environmental | Open in IMG/M |
| 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025930 | Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) | Environmental | Open in IMG/M |
| 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300027903 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027911 | Freshwater sediment microbial communities from Pennsylvania, USA - Little Laurel Run_MetaG_LLR_2012 (SPAdes) | Environmental | Open in IMG/M |
| 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300029882 | III_Palsa_E1 coassembly | Environmental | Open in IMG/M |
| 3300029910 | III_Palsa_E2 coassembly | Environmental | Open in IMG/M |
| 3300029911 | III_Bog_N2 coassembly | Environmental | Open in IMG/M |
| 3300031057 | Oak Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031238 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG | Host-Associated | Open in IMG/M |
| 3300031366 | Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 25_S | Environmental | Open in IMG/M |
| 3300031474 | Fir Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031672 | Soil microbial communities from Risofladan, Vaasa, Finland - OX-2 | Environmental | Open in IMG/M |
| 3300031708 | FICUS49499 Metagenome Czech Republic combined assembly | Environmental | Open in IMG/M |
| 3300031715 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM2C_05 | Environmental | Open in IMG/M |
| 3300031716 | Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - YN3 | Environmental | Open in IMG/M |
| 3300031718 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_05 | Environmental | Open in IMG/M |
| 3300031754 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_515 | Environmental | Open in IMG/M |
| 3300031962 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_515 | Environmental | Open in IMG/M |
| 3300032160 | Sb_50d combined assembly (MetaSPAdes) | Environmental | Open in IMG/M |
| 3300032174 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_05 | Environmental | Open in IMG/M |
| 3300032515 | FICUS49499 Metatranscriptome Czech Republic combined assembly (additional data) | Environmental | Open in IMG/M |
| 3300033412 | Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - NC | Environmental | Open in IMG/M |
| 3300033475 | Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - YC | Environmental | Open in IMG/M |
| 3300033887 | Peat soil microbial communities from Stordalen Mire, Sweden - 713 P-1-X1 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| ICCgaii200_04841352 | 2228664021 | Soil | MGKGNREKKKPKQNKVKAKDIVPATPFGANSNAGKAAGKRK |
| ICChiseqgaiiDRAFT_24240783 | 3300000033 | Soil | MGKGNREKKKPKQNKVKAKDIVPATPFGANSNAGKAAGKRK* |
| Ga0062593_1021080433 | 3300004114 | Soil | MKGVWSDAGREPAQQERPMSRGNREKKKPKADKNKAKPVAAVTPFGAASNAGKAPGKPK* |
| Ga0062590_1027327351 | 3300004157 | Soil | MSKGNREKKKPKADKSKLKPAAAATPFGAASNAGKAAGKRK* |
| Ga0070658_101336522 | 3300005327 | Corn Rhizosphere | MGKGNREKKKPKQDKIKAKDIVPASPFGANSNAGKAAGKSK* |
| Ga0070670_1011852053 | 3300005331 | Switchgrass Rhizosphere | REPAQQERPMSRGNREKKKPKADKNKAKPVAAVTPFGAASNAGKAPGKPK* |
| Ga0070670_1022133732 | 3300005331 | Switchgrass Rhizosphere | ESAQQERQMSRGNREKKKPKADKNKAKPVAAVTPFGTASNAGKASGKSK* |
| Ga0068869_1000603163 | 3300005334 | Miscanthus Rhizosphere | MSRGNREKKKPKADKSKVKPAAIASPFGAASNAGKAAGKHK* |
| Ga0070666_100855462 | 3300005335 | Switchgrass Rhizosphere | MSRGNREKKKPKADKSKVKPVAVASPFGAASNAGKAAGKRK* |
| Ga0068868_1015571812 | 3300005338 | Miscanthus Rhizosphere | MGKGNREKKKPKQDKIKTKDVVPASPFGANSNAGKAAGKRK* |
| Ga0070660_1013016543 | 3300005339 | Corn Rhizosphere | AGQPGVSEMGKGNREKKKPKQDKIKAKDIVPASPFGGNAGKAAGKRK* |
| Ga0070660_1015022801 | 3300005339 | Corn Rhizosphere | MGKGNREKKKPKQDKIKAKDIVPASPFGGNSNAGKAAGKRK* |
| Ga0070660_1016914751 | 3300005339 | Corn Rhizosphere | MGKGNREKKKPKQDKIKAKDVVPASPFGANSNAGKAAGKRK* |
| Ga0070661_1007148201 | 3300005344 | Corn Rhizosphere | MSRGNREKKKPKADKSKLKPVMATTPFGAASNAGKAAGKRK* |
| Ga0070668_1008818152 | 3300005347 | Switchgrass Rhizosphere | MSRGNREKKKPKADKNKAKPAAAITPFGAASNAGKAVGKSK* |
| Ga0070667_1005056085 | 3300005367 | Switchgrass Rhizosphere | SRGNREKKKPKADKSKVKPVAVASPFGAASNAGKAAGKHK* |
| Ga0068867_1001840963 | 3300005459 | Miscanthus Rhizosphere | MSRGNREKKKPKADKNKAKPVAAVTPFGAASNAGKAPGKPK* |
| Ga0070735_103924822 | 3300005534 | Surface Soil | MSKGNREKKKPKADKSKLKPVASASPFGAASNAGKPAGKRK* |
| Ga0070733_104763044 | 3300005541 | Surface Soil | MSRGNREKKKPKADKSKIKPAAADTPFGAASNAGKPAGRRK* |
| Ga0070665_1007564841 | 3300005548 | Switchgrass Rhizosphere | GNREKKKPKADKSKLKPVMATTPFGAASNAGKAAGKRK* |
| Ga0068855_1000582168 | 3300005563 | Corn Rhizosphere | MGKGNREKKKPKQDKIKAKDIVPASPFGANSNAGKAAGKRK* |
| Ga0068854_1006562694 | 3300005578 | Corn Rhizosphere | QQERQMSRGNREKKKPKADKNKAKPVAAVTPFGTASNAGKASGKSK* |
| Ga0068852_1011126483 | 3300005616 | Corn Rhizosphere | MGKGNREKKKPKQDKIKAKDAVPASPFGANSNAGKAAGKRK* |
| Ga0068863_1027156601 | 3300005841 | Switchgrass Rhizosphere | ERQMSRGNREKKKPKADKSKAIAAAAATPFGAASNAGKAAGKRK* |
| Ga0068858_1000241278 | 3300005842 | Switchgrass Rhizosphere | MSRGNREKKKPKADKNKAKPVAAVTPFGTASNAGKASGKSK* |
| Ga0068860_1002533371 | 3300005843 | Switchgrass Rhizosphere | MSRGNREKKKPKADKNKAKPAAAVTPFGAASNAGKAAGKSK* |
| Ga0068862_1020281611 | 3300005844 | Switchgrass Rhizosphere | EKKKPKQDKIKAKDVVPASPFGANSNAGKAAGKRK* |
| Ga0075017_1006705243 | 3300006059 | Watersheds | MSKGNREKKKPKADKSKTKLAAPSSPFGSQSNAGKPSGKRK* |
| Ga0075522_101156091 | 3300006638 | Arctic Peat Soil | SKGNREKKKPKADKNKAKIVAATTPFGAASNAGKAAGKRK* |
| Ga0075521_100533895 | 3300006642 | Arctic Peat Soil | MSKGNREKKKPKADKSKMKPAASASPFGAASNAGKPAGKRK* |
| Ga0105238_126528953 | 3300009551 | Corn Rhizosphere | ESAQQERPMSRGNREKKKPKADKSKIKLVEAVTPFGAASNAGKAAGKRK* |
| Ga0105238_126751292 | 3300009551 | Corn Rhizosphere | MGKGNREKKKPKQDKIKAKDIVPASPFGGNAGKAAGKRK* |
| Ga0105249_122739631 | 3300009553 | Switchgrass Rhizosphere | MPKGNREKKKPKADKSKVPPIPAAAPFGTASNAGKPKRK* |
| Ga0134125_105032012 | 3300010371 | Terrestrial Soil | MGKGNREKKKPKQNKVKAKDIAPVSPFGANSNAGKAAGKRK* |
| Ga0136449_1009812602 | 3300010379 | Peatlands Soil | MPKGNREKKKPKADKSKAMPMPATTPFGSASNAGKPKRK* |
| Ga0134126_100057467 | 3300010396 | Terrestrial Soil | MPKGNREKKKPKADKSKVMPMPAATPFGSASNAGKPKRK* |
| Ga0150983_112055992 | 3300011120 | Forest Soil | RQEGDTMSKGNREKKKPKADKNKAKIQPATTPFGAASNAGKPANRRK* |
| Ga0137404_114177203 | 3300012929 | Vadose Zone Soil | MKGVWSGAGRESAQQERQMSRGNREKKKPKADKSKIKLVEAVTPFGAASNAGKAAGKRK* |
| Ga0157374_116560651 | 3300013296 | Miscanthus Rhizosphere | MSRGNREKKKPKADKSKAIAAAAATPFGAASNAGKAAGKRK* |
| Ga0157374_121211501 | 3300013296 | Miscanthus Rhizosphere | NRHTAGQPGVSEMGKGNREKKKPKQDKIKTKDVVPASPFGANSNAGKAAGKRK* |
| Ga0163162_100357667 | 3300013306 | Switchgrass Rhizosphere | MKGVWSGAGHESAQQERQMSRGNREKKKPKADKSKVKPVEAATPFGAASNAGKAAGKRK* |
| Ga0163162_106063373 | 3300013306 | Switchgrass Rhizosphere | MGKGNREKKKPKQDKIKTKDAVPASPFGANSNAGKAAGKRK* |
| Ga0157375_132039033 | 3300013308 | Miscanthus Rhizosphere | GPLAGCESVQKERQMSRGNREKKKPKADKSKAIPAAAATPFGAASNAGKAAGKRK* |
| Ga0182018_101346262 | 3300014489 | Palsa | MSKGNREKKKPKADKAKLKIVPNSSPFGAASNAGKAAGKRK* |
| Ga0182012_104463743 | 3300014499 | Bog | MSKGNREKKKPKADKGKLKIAPPSSPFGSASNAGKAAGKRK* |
| Ga0182024_100054099 | 3300014501 | Permafrost | MRSNREKKKPKADKNAKKNAAAPPSVAALRIAGKAAGRKPFS* |
| Ga0182024_1001810513 | 3300014501 | Permafrost | MPKGNREKKKPKADKSKAMPMPAATPFGSASNAGKPKRK* |
| Ga0182024_115295141 | 3300014501 | Permafrost | MPKGNREKKKPKADKTKEKVIAPVSPFGSASNAGKPTGKRK* |
| Ga0182024_123250422 | 3300014501 | Permafrost | MPKGNREKKKPKTDKSKAKVIAPVSPFGSASNAGKPTVKRK* |
| Ga0182030_103346363 | 3300014838 | Bog | MSKGNREKKKPKSDKAKLKIVPSSSPFGAASNAGKAAGKRK* |
| Ga0157379_1000160021 | 3300014968 | Switchgrass Rhizosphere | MKGVRSGADAESAQQERQMSRGNREKKKPKADKSKLKPIEAATPFGAASNAGKAAGKRK* |
| Ga0157376_112518774 | 3300014969 | Miscanthus Rhizosphere | MSRGNREKKKPKADKSKAKPVVTVSPFGAASNAGKPAGKRK* |
| Ga0137403_104570463 | 3300015264 | Vadose Zone Soil | MSRGNREKKKPKADKSKIKLVEAVTPFGAASNAGKAAGKRK* |
| Ga0132258_109747441 | 3300015371 | Arabidopsis Rhizosphere | MKGVWSDAGRESAQQERPMSRGNREKKKPKADKNKAKPVAAVTPFGAASNAGKAPGKPK* |
| Ga0193744_10547072 | 3300019874 | Soil | MSKGNREKKKPKQDKSKAKDVASATPFGAASNAGKAAGKRK |
| Ga0193752_10283432 | 3300020027 | Soil | MSKGNREKKKPKQDKSKAKDVASATPFGAASNAGKPAGKRK |
| Ga0210407_106998921 | 3300020579 | Soil | GNREKKKPKADKNKAKPAVAVTPFGAASNIGKGVGKHK |
| Ga0210408_109022262 | 3300021178 | Soil | MSRGNREKKKPKADKNKAKPAVAVTPFGAASNIGKGVGKHK |
| Ga0210389_101615151 | 3300021404 | Soil | MKGILSGAERESAQRENQMSRGNREKKKPKADKSKIKPAVADTPFGAASNAGKPAGKRK |
| Ga0210402_112151422 | 3300021478 | Soil | MPKGNREKKKPKSDKSKVLPIPTASPFGKSSNAGKPKHK |
| Ga0247779_11077992 | 3300022908 | Plant Litter | VFEMGKGNREKKKPKQDKIKAKDVVPVSPFGGNSNAGKAAGKRK |
| Ga0207656_101300172 | 3300025321 | Corn Rhizosphere | MSRGNREKKKPKADKNKAKPVAAVTPFGTASNAGKASGKSK |
| Ga0207696_11400071 | 3300025711 | Switchgrass Rhizosphere | MSRGNREKKKPKADKNKAKPAAAITPFGAASNAGKAVGKSK |
| Ga0209483_10188214 | 3300025862 | Arctic Peat Soil | MSKGNREKKKPKADKNKAKIVAATTPFGAASNAGKAAGKRK |
| Ga0207680_100420824 | 3300025903 | Switchgrass Rhizosphere | MSRGNREKKKPKADKSKVKPVAVASPFGAASNAGKAAGKRK |
| Ga0207705_101317922 | 3300025909 | Corn Rhizosphere | MGKGNREKKKPKQDKIKAKDIVPASPFGANSNAGKAAGKSK |
| Ga0207705_104595522 | 3300025909 | Corn Rhizosphere | MGKGNREKKKPKQDKIKAKDVVPASPFGANSNAGKAAGKRK |
| Ga0207695_101783672 | 3300025913 | Corn Rhizosphere | MGKGNREKKKPKQDKIKAKDIVPASPFGANSNAGKAAGKRK |
| Ga0207694_106914753 | 3300025924 | Corn Rhizosphere | MSRGNREKKKPKADKNKAKPAAAVTPFGAASNAGKAAGKSK |
| Ga0207694_116339711 | 3300025924 | Corn Rhizosphere | MKGVGSGADVESAQQERPMSRGNREKKKPKADKSKIKLVEAVTPFGAASNAGKAAGKRK |
| Ga0207650_109852274 | 3300025925 | Switchgrass Rhizosphere | REPAQQERPMSRGNREKKKPKADKNKAKPVAAVTPFGAASNAGKAPGKPK |
| Ga0207701_106955341 | 3300025930 | Corn, Switchgrass And Miscanthus Rhizosphere | AGRESAQQERPMSRGNREKKKPKADKNKAKPVAAVTPFGAASNAGKAPGKPK |
| Ga0207651_108274044 | 3300025960 | Switchgrass Rhizosphere | MFPEEEFEKKKPKADKNKAKPVAAVTPFGTASNAGKASGKSK |
| Ga0207641_117750872 | 3300026088 | Switchgrass Rhizosphere | MSRGNREKKKPKADKNKAKPAAAVTPFGAASNAEKAAGKSK |
| Ga0209488_101061463 | 3300027903 | Vadose Zone Soil | MSRGNREKKKPKADKSKAKPVAAITPFGAVFNAGKVPGKSK |
| Ga0209698_111741681 | 3300027911 | Watersheds | MSKGNREKKKPKADKSKTKLAAPSSPFGSQSNAGKPSGKRK |
| Ga0268266_1000409414 | 3300028379 | Switchgrass Rhizosphere | MSRGNREKKKPKADKSKVKPAAIASPFGAASNAGKAAGKHK |
| Ga0268266_100139948 | 3300028379 | Switchgrass Rhizosphere | MGKGNREKKKPKQDKIKTKDVVPASPFGANSNAGKAAGKRK |
| Ga0311368_100767481 | 3300029882 | Palsa | MPKGNREKKKPKADKSKVMPTPVATPFGSASNAGKPKRK |
| Ga0311368_107074531 | 3300029882 | Palsa | MSKGNREKKKPKADKSKAKIEPAASPFGAASNAGKPANRRK |
| Ga0311369_101235751 | 3300029910 | Palsa | MSKGNREKKKPKADKSKAKVDVATTSFGAASNAGKPANKRK |
| Ga0311361_101307866 | 3300029911 | Bog | MSRGNREKKKPKADKNKAKVDVATTPFGAASNAGKPAHKRE |
| Ga0311361_101631842 | 3300029911 | Bog | MSKGNREKKKPKSDKAKLKIVPSSSPFGAASNAGKAAGKRK |
| Ga0170834_1095189483 | 3300031057 | Forest Soil | SKGNREKKKPKADKSKIKPAAPASPFGAASNAGKAAGKRK |
| Ga0265332_104789202 | 3300031238 | Rhizosphere | MSKGNREKKKPKADKSKMKPAASASPFGAASNAGKPAGKRK |
| Ga0307506_102748731 | 3300031366 | Soil | MSRGNREKKKPKADKSKAIAAAAATPFGAASNAGKAAGKRK |
| Ga0170818_1060725351 | 3300031474 | Forest Soil | MSKGNREKKKPKADKSKIKPAAPASPFGAASNAGKAAGKRK |
| Ga0307373_103762232 | 3300031672 | Soil | MPKGNREKKKPKADKSKVLPMPAATPFGSASNAGKPKRK |
| Ga0310686_1126520263 | 3300031708 | Soil | MSRVNREKKKPKADKNKAKPVVAAAPFGVTHNTGNDAGKRK |
| Ga0307476_100923641 | 3300031715 | Hardwood Forest Soil | SAQQESQMSRGNREKKKPKADKSKIKPAVADTPFGAASNAGKPAGRRK |
| Ga0310813_101451543 | 3300031716 | Soil | MSRGNREKKKPKADKNKAKPVAAVTPFGAASNAGKAPGKPK |
| Ga0307474_101019202 | 3300031718 | Hardwood Forest Soil | MSRGNRERKKPKADKSKAKVHVAITPFGAASNTGKPAGKRN |
| Ga0307474_115583012 | 3300031718 | Hardwood Forest Soil | MSRGNREKKKPKADKSKAKVDVAIAPFGAASNAGKPAGKRKG |
| Ga0307475_101194653 | 3300031754 | Hardwood Forest Soil | MSRGNRERKKPKADKSKAKVHVAITPFGAASNAGKPAGKRN |
| Ga0307479_108934173 | 3300031962 | Hardwood Forest Soil | MSRGNREKKKPKADKNKAKPAIGVTPFGAASNIGKGVGKHK |
| Ga0311301_118339672 | 3300032160 | Peatlands Soil | MPKGNREKKKPKADKSKAMPMPATTPFGSASNAGKPKRK |
| Ga0307470_100605244 | 3300032174 | Hardwood Forest Soil | MSKGNREKKKPKADKSKMKAAASASPFGAASNAGKPAGKRK |
| Ga0348332_115198471 | 3300032515 | Plant Litter | MSKGNREKKKPKADKSKAKVESAATPFGAASNAGKPANRRK |
| Ga0348332_130181411 | 3300032515 | Plant Litter | MSKGNREKKKPKADKNKAKVQPATTPFGAASNAGKPANRRK |
| Ga0310810_110874083 | 3300033412 | Soil | GREPAQQERPMSRGNREKKKPKADKNKAKPVAAVTPFGAASNAGKAPGKPK |
| Ga0310811_104837422 | 3300033475 | Soil | MSRGNREKKKPKADKNKAKPAAAVTPFGAASNAGKAAEKSK |
| Ga0334790_236800_260_385 | 3300033887 | Soil | MSKGNREKKKPKADKNKAKIVAPATPFGAASNAGKAAGKRK |
| ⦗Top⦘ |