NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F101023

Metagenome / Metatranscriptome Family F101023

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F101023
Family Type Metagenome / Metatranscriptome
Number of Sequences 102
Average Sequence Length 61 residues
Representative Sequence MSTFKHLDGMVALLSEVYEINERIMTGDICSAKTAIASTRMKKLLHHYHEALHEDGAVKVSLQ
Number of Associated Samples 87
Number of Associated Scaffolds 102

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 45.10 %
% of genes near scaffold ends (potentially truncated) 100.00 %
% of genes from short scaffolds (< 2000 bps) 91.18 %
Associated GOLD sequencing projects 84
AlphaFold2 3D model prediction Yes
3D model pTM-score0.65

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (47.059 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater
(15.686 % of family members)
Environment Ontology (ENVO) Unclassified
(55.882 % of family members)
Earth Microbiome Project Ontology (EMPO) Free-living → Non-saline → Water (non-saline)
(51.961 % of family members)



 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      


 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 45.05%    β-sheet: 0.00%    Coil/Unstructured: 54.95%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  
pTM-score: 0.65
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.


 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 102 Family Scaffolds
PF00145DNA_methylase 3.92
PF14743DNA_ligase_OB_2 1.96
PF13508Acetyltransf_7 1.96
PF10269Tmemb_185A 0.98

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 102 Family Scaffolds
COG0270DNA-cytosine methylaseReplication, recombination and repair [L] 3.92


 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms94.12 %
UnclassifiedrootN/A5.88 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
3300003860|Ga0031658_1054404All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage694Open in IMG/M
3300004481|Ga0069718_15901007All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Nostocales → Aphanizomenonaceae → Aphanizomenon → Aphanizomenon flos-aquae → Aphanizomenon flos-aquae WA102531Open in IMG/M
3300006641|Ga0075471_10184678All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Nostocales → Aphanizomenonaceae → Aphanizomenon → Aphanizomenon flos-aquae → Aphanizomenon flos-aquae WA1021091Open in IMG/M
3300006803|Ga0075467_10534130All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Nostocales → Aphanizomenonaceae → Aphanizomenon → Aphanizomenon flos-aquae → Aphanizomenon flos-aquae WA102602Open in IMG/M
3300006805|Ga0075464_10065676Not Available2034Open in IMG/M
3300006805|Ga0075464_10882482All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage558Open in IMG/M
3300006875|Ga0075473_10289470All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage663Open in IMG/M
3300006920|Ga0070748_1343341All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage527Open in IMG/M
3300007234|Ga0075460_10152868All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage804Open in IMG/M
3300007540|Ga0099847_1206150All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage572Open in IMG/M
3300007555|Ga0102817_1028247All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Nostocales → Aphanizomenonaceae → Aphanizomenon → Aphanizomenon flos-aquae → Aphanizomenon flos-aquae WA1021238Open in IMG/M
3300007636|Ga0102856_1035988All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage761Open in IMG/M
3300008259|Ga0114841_1265474All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Nostocales → Aphanizomenonaceae → Aphanizomenon → Aphanizomenon flos-aquae → Aphanizomenon flos-aquae WA102545Open in IMG/M
3300008263|Ga0114349_1012081All Organisms → Viruses → Predicted Viral4345Open in IMG/M
3300008266|Ga0114363_1123105All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Nostocales → Aphanizomenonaceae → Aphanizomenon → Aphanizomenon flos-aquae → Aphanizomenon flos-aquae WA102898Open in IMG/M
3300008450|Ga0114880_1061569All Organisms → cellular organisms → Bacteria1549Open in IMG/M
3300008450|Ga0114880_1130203All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Nostocales → Aphanizomenonaceae → Aphanizomenon → Aphanizomenon flos-aquae → Aphanizomenon flos-aquae WA102933Open in IMG/M
3300009068|Ga0114973_10357601All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Nostocales → Aphanizomenonaceae → Aphanizomenon → Aphanizomenon flos-aquae → Aphanizomenon flos-aquae WA102770Open in IMG/M
3300009081|Ga0105098_10290050All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage783Open in IMG/M
3300009151|Ga0114962_10347161All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage815Open in IMG/M
3300009151|Ga0114962_10380798All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Nostocales → Aphanizomenonaceae → Aphanizomenon → Aphanizomenon flos-aquae → Aphanizomenon flos-aquae WA102768Open in IMG/M
3300009151|Ga0114962_10403824All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage739Open in IMG/M
3300009152|Ga0114980_10481791All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage707Open in IMG/M
3300009158|Ga0114977_10497443All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage668Open in IMG/M
3300009160|Ga0114981_10381449All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Nostocales → Aphanizomenonaceae → Aphanizomenon → Aphanizomenon flos-aquae → Aphanizomenon flos-aquae WA102760Open in IMG/M
3300009164|Ga0114975_10719701All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage526Open in IMG/M
3300009170|Ga0105096_10225997Not Available949Open in IMG/M
3300009181|Ga0114969_10628255All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage586Open in IMG/M
3300009182|Ga0114959_10003386All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage12527Open in IMG/M
3300009184|Ga0114976_10539019All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Nostocales → Aphanizomenonaceae → Aphanizomenon → Aphanizomenon flos-aquae → Aphanizomenon flos-aquae WA102598Open in IMG/M
3300010157|Ga0114964_10466001All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage595Open in IMG/M
3300010158|Ga0114960_10531646All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage562Open in IMG/M
3300017716|Ga0181350_1143725All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage560Open in IMG/M
3300017723|Ga0181362_1099958All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage577Open in IMG/M
3300017754|Ga0181344_1015054All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Nostocales → Aphanizomenonaceae → Aphanizomenon → Aphanizomenon flos-aquae → Aphanizomenon flos-aquae WA1022440Open in IMG/M
3300017761|Ga0181356_1240387All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage519Open in IMG/M
3300017766|Ga0181343_1010080Not Available3061Open in IMG/M
3300017766|Ga0181343_1048183All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Nostocales → Aphanizomenonaceae → Aphanizomenon → Aphanizomenon flos-aquae → Aphanizomenon flos-aquae WA1021258Open in IMG/M
3300017766|Ga0181343_1190453All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Nostocales → Aphanizomenonaceae → Aphanizomenon → Aphanizomenon flos-aquae → Aphanizomenon flos-aquae WA102564Open in IMG/M
3300017785|Ga0181355_1094219All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1243Open in IMG/M
3300019784|Ga0181359_1261647All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Nostocales → Aphanizomenonaceae → Aphanizomenon → Aphanizomenon flos-aquae → Aphanizomenon flos-aquae WA102518Open in IMG/M
3300020141|Ga0211732_1515230All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage601Open in IMG/M
3300020151|Ga0211736_10405833All Organisms → cellular organisms → Bacteria2076Open in IMG/M
3300020159|Ga0211734_10730744All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Nostocales → Aphanizomenonaceae → Aphanizomenon → Aphanizomenon flos-aquae → Aphanizomenon flos-aquae WA102500Open in IMG/M
3300020160|Ga0211733_10251935All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Nostocales → Aphanizomenonaceae → Aphanizomenon → Aphanizomenon flos-aquae → Aphanizomenon flos-aquae WA102538Open in IMG/M
3300020160|Ga0211733_10369213All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Nostocales → Aphanizomenonaceae → Aphanizomenon → Aphanizomenon flos-aquae → Aphanizomenon flos-aquae WA102572Open in IMG/M
3300020162|Ga0211735_10643680All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Nostocales → Aphanizomenonaceae → Aphanizomenon → Aphanizomenon flos-aquae → Aphanizomenon flos-aquae WA102624Open in IMG/M
3300020172|Ga0211729_10395087All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Nostocales → Aphanizomenonaceae → Aphanizomenon → Aphanizomenon flos-aquae → Aphanizomenon flos-aquae WA102507Open in IMG/M
3300020524|Ga0208858_1011414All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Nostocales → Aphanizomenonaceae → Aphanizomenon → Aphanizomenon flos-aquae → Aphanizomenon flos-aquae WA1021475Open in IMG/M
3300021516|Ga0194045_1106924All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage697Open in IMG/M
3300021961|Ga0222714_10110670All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1716Open in IMG/M
3300021961|Ga0222714_10250837All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Nostocales → Aphanizomenonaceae → Aphanizomenon → Aphanizomenon flos-aquae → Aphanizomenon flos-aquae WA102993Open in IMG/M
3300021962|Ga0222713_10087900All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Nostocales → Aphanizomenonaceae → Aphanizomenon → Aphanizomenon flos-aquae → Aphanizomenon flos-aquae WA1022255Open in IMG/M
3300021962|Ga0222713_10253392All Organisms → Viruses → Predicted Viral1145Open in IMG/M
3300021962|Ga0222713_10597220All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage644Open in IMG/M
3300022179|Ga0181353_1008619All Organisms → Viruses → Predicted Viral2521Open in IMG/M
3300022190|Ga0181354_1098541All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Nostocales → Aphanizomenonaceae → Aphanizomenon → Aphanizomenon flos-aquae → Aphanizomenon flos-aquae WA102954Open in IMG/M
3300022190|Ga0181354_1195858All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage605Open in IMG/M
3300024306|Ga0255148_1028657All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1040Open in IMG/M
3300024343|Ga0244777_10800195All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Nostocales → Aphanizomenonaceae → Aphanizomenon → Aphanizomenon flos-aquae → Aphanizomenon flos-aquae WA102557Open in IMG/M
3300024348|Ga0244776_10434806All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Nostocales → Aphanizomenonaceae → Aphanizomenon → Aphanizomenon flos-aquae → Aphanizomenon flos-aquae WA102862Open in IMG/M
3300024351|Ga0255141_1054532Not Available585Open in IMG/M
3300024352|Ga0255142_1018131All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1140Open in IMG/M
3300024358|Ga0255173_1047544Not Available727Open in IMG/M
3300024495|Ga0255164_1015440All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Nostocales → Aphanizomenonaceae → Aphanizomenon → Aphanizomenon flos-aquae → Aphanizomenon flos-aquae WA1021303Open in IMG/M
3300024503|Ga0255152_1020821All Organisms → Viruses → Predicted Viral1262Open in IMG/M
3300024513|Ga0255144_1037086All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Nostocales → Aphanizomenonaceae → Aphanizomenon → Aphanizomenon flos-aquae → Aphanizomenon flos-aquae WA102829Open in IMG/M
3300025818|Ga0208542_1103584All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage815Open in IMG/M
3300026573|Ga0255269_1052591All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1131Open in IMG/M
3300027221|Ga0208557_1047367All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage743Open in IMG/M
3300027223|Ga0208169_1032786All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Nostocales → Aphanizomenonaceae → Aphanizomenon → Aphanizomenon flos-aquae → Aphanizomenon flos-aquae WA102986Open in IMG/M
3300027223|Ga0208169_1076552All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Nostocales → Aphanizomenonaceae → Aphanizomenon → Aphanizomenon flos-aquae → Aphanizomenon flos-aquae WA102581Open in IMG/M
3300027396|Ga0255146_1081215All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Nostocales → Aphanizomenonaceae → Aphanizomenon → Aphanizomenon flos-aquae → Aphanizomenon flos-aquae WA102670Open in IMG/M
3300027467|Ga0255154_1055265All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Nostocales → Aphanizomenonaceae → Aphanizomenon → Aphanizomenon flos-aquae → Aphanizomenon flos-aquae WA102889Open in IMG/M
3300027754|Ga0209596_1331692All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage594Open in IMG/M
3300027764|Ga0209134_10341997All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage505Open in IMG/M
3300027770|Ga0209086_10128224All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1257Open in IMG/M
3300027808|Ga0209354_10441988All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage501Open in IMG/M
3300027899|Ga0209668_10400509All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage898Open in IMG/M
3300031951|Ga0315904_10317852All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Nostocales → Aphanizomenonaceae → Aphanizomenon → Aphanizomenon flos-aquae → Aphanizomenon flos-aquae WA1021450Open in IMG/M
3300031997|Ga0315278_11514753All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage645Open in IMG/M
3300031999|Ga0315274_11673603All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage592Open in IMG/M
3300032116|Ga0315903_11132092All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Nostocales → Aphanizomenonaceae → Aphanizomenon → Aphanizomenon flos-aquae → Aphanizomenon flos-aquae WA102534Open in IMG/M
3300032173|Ga0315268_12247639All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage559Open in IMG/M
3300033493|Ga0316631_10334182All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage614Open in IMG/M
3300033978|Ga0334977_0110073All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Nostocales → Aphanizomenonaceae → Aphanizomenon → Aphanizomenon flos-aquae → Aphanizomenon flos-aquae WA1021464Open in IMG/M
3300033994|Ga0334996_0533960All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Nostocales → Aphanizomenonaceae → Aphanizomenon → Aphanizomenon flos-aquae → Aphanizomenon flos-aquae WA102517Open in IMG/M
3300034060|Ga0334983_0261001All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1050Open in IMG/M
3300034066|Ga0335019_0120132All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Nostocales → Aphanizomenonaceae → Aphanizomenon → Aphanizomenon flos-aquae → Aphanizomenon flos-aquae WA1021750Open in IMG/M
3300034066|Ga0335019_0764757All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage548Open in IMG/M
3300034073|Ga0310130_0022153Not Available2017Open in IMG/M
3300034096|Ga0335025_0592859All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Nostocales → Aphanizomenonaceae → Aphanizomenon → Aphanizomenon flos-aquae → Aphanizomenon flos-aquae WA102547Open in IMG/M
3300034101|Ga0335027_0369093All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Nostocales → Aphanizomenonaceae → Aphanizomenon → Aphanizomenon flos-aquae → Aphanizomenon flos-aquae WA102942Open in IMG/M
3300034102|Ga0335029_0638365All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Nostocales → Aphanizomenonaceae → Aphanizomenon → Aphanizomenon flos-aquae → Aphanizomenon flos-aquae WA102589Open in IMG/M
3300034102|Ga0335029_0753849All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Nostocales → Aphanizomenonaceae → Aphanizomenon → Aphanizomenon flos-aquae → Aphanizomenon flos-aquae WA102520Open in IMG/M
3300034106|Ga0335036_0388543All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Nostocales → Aphanizomenonaceae → Aphanizomenon → Aphanizomenon flos-aquae → Aphanizomenon flos-aquae WA102900Open in IMG/M
3300034107|Ga0335037_0093690All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Nostocales → Aphanizomenonaceae → Aphanizomenon → Aphanizomenon flos-aquae → Aphanizomenon flos-aquae WA1021629Open in IMG/M
3300034110|Ga0335055_0380319All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Nostocales → Aphanizomenonaceae → Aphanizomenon → Aphanizomenon flos-aquae → Aphanizomenon flos-aquae WA102586Open in IMG/M
3300034118|Ga0335053_0186822All Organisms → Viruses → Predicted Viral1372Open in IMG/M
3300034118|Ga0335053_0409901All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage820Open in IMG/M
3300034272|Ga0335049_0811939All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Nostocales → Aphanizomenonaceae → Aphanizomenon → Aphanizomenon flos-aquae → Aphanizomenon flos-aquae WA102552Open in IMG/M
3300034355|Ga0335039_0671272All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Nostocales → Aphanizomenonaceae → Aphanizomenon → Aphanizomenon flos-aquae → Aphanizomenon flos-aquae WA102502Open in IMG/M



 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
FreshwaterEnvironmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater15.69%
Freshwater LakeEnvironmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake14.71%
Freshwater LakeEnvironmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lake13.73%
FreshwaterEnvironmental → Aquatic → Freshwater → River → Unclassified → Freshwater9.80%
AqueousEnvironmental → Aquatic → Marine → Coastal → Unclassified → Aqueous8.82%
FreshwaterEnvironmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater6.86%
EstuarineEnvironmental → Aquatic → Marine → Intertidal Zone → Estuary → Estuarine6.86%
Estuarine WaterEnvironmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine Water4.90%
Freshwater, PlanktonEnvironmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater, Plankton2.94%
SedimentEnvironmental → Aquatic → Freshwater → Lake → Sediment → Sediment2.94%
Freshwater SedimentEnvironmental → Aquatic → Freshwater → Sediment → Unclassified → Freshwater Sediment1.96%
Freshwater Lake SedimentEnvironmental → Aquatic → Freshwater → Lentic → Sediment → Freshwater Lake Sediment1.96%
Freshwater LakeEnvironmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake1.96%
FreshwaterEnvironmental → Aquatic → Freshwater → Unclassified → Unclassified → Freshwater1.96%
SedimentEnvironmental → Aquatic → Freshwater → Sediment → Unclassified → Sediment0.98%
FreshwaterEnvironmental → Aquatic → Freshwater → Lentic → Epilimnion → Freshwater0.98%
Anoxic Zone FreshwaterEnvironmental → Aquatic → Freshwater → Lake → Unclassified → Anoxic Zone Freshwater0.98%
SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Soil0.98%
Fracking WaterEnvironmental → Terrestrial → Deep Subsurface → Unclassified → Unclassified → Fracking Water0.98%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
3300003860Freshwater lake sediment microbial communities from the University of Notre Dame, USA, for methane emissions studies - PLP11 PLEnvironmentalOpen in IMG/M
3300004481Combined Assembly of Gp0112041, Gp0112042, Gp0112043EnvironmentalOpen in IMG/M
3300006641Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_0.19_D_>0.8_DNAEnvironmentalOpen in IMG/M
3300006803Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_20_>0.8_DNAEnvironmentalOpen in IMG/M
3300006805Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_0.19_<0.8_DNAEnvironmentalOpen in IMG/M
3300006875Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_0.19_N_>0.8_DNAEnvironmentalOpen in IMG/M
3300006920Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_12EnvironmentalOpen in IMG/M
3300007234Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Fall_15_<0.8_DNAEnvironmentalOpen in IMG/M
3300007540Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1504_2 Viral MetaGEnvironmentalOpen in IMG/M
3300007555Estuarine microbial communities from the Columbia River estuary - Ebb tide non-ETM metaG S.555EnvironmentalOpen in IMG/M
3300007636Estuarine microbial communities from the Columbia River estuary - metaG 1371A-3EnvironmentalOpen in IMG/M
3300008259Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, sample HABS-E2014-0132-C-NAEnvironmentalOpen in IMG/M
3300008263Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE2, Sample E2014-0106-53-LTREnvironmentalOpen in IMG/M
3300008266Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, Sample HABS-E2014-0108-C-NAEnvironmentalOpen in IMG/M
3300008450Freshwater viral communities during cyanobacterial harmful algal blooms (CHABs) in Western Lake Erie, USA - Oct 27, 2014 all contigsEnvironmentalOpen in IMG/M
3300009068Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_140807_MF_MetaGEnvironmentalOpen in IMG/M
3300009081Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (1) Depth 19-21cm May2015EnvironmentalOpen in IMG/M
3300009151Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_130820_MF_MetaGEnvironmentalOpen in IMG/M
3300009152Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140806_EF_MetaGEnvironmentalOpen in IMG/M
3300009158Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130805_MF_MetaGEnvironmentalOpen in IMG/M
3300009160Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140806_MF_MetaGEnvironmentalOpen in IMG/M
3300009164Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130626_EF_MetaGEnvironmentalOpen in IMG/M
3300009170Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (1) Depth 1-3cm May2015EnvironmentalOpen in IMG/M
3300009181Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130807_MF_MetaGEnvironmentalOpen in IMG/M
3300009182Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_130625_EF_MetaGEnvironmentalOpen in IMG/M
3300009184Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130805_EF_MetaGEnvironmentalOpen in IMG/M
3300010157Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_131016_MF_MetaGEnvironmentalOpen in IMG/M
3300010158Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_130625_MF_MetaGEnvironmentalOpen in IMG/M
3300017716Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM110.DCM.DEnvironmentalOpen in IMG/M
3300017723Freshwater viral communities from Lake Michigan, USA - Su13.ND.MM110.S.NEnvironmentalOpen in IMG/M
3300017754Freshwater viral communities from Lake Michigan, USA - Su13.VD.MLB.D.DEnvironmentalOpen in IMG/M
3300017761Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM110.S.NEnvironmentalOpen in IMG/M
3300017766Freshwater viral communities from Lake Michigan, USA - Su13.VD.MLB.S.DEnvironmentalOpen in IMG/M
3300017785Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM15.D.NEnvironmentalOpen in IMG/M
3300019784Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM15.S.DEnvironmentalOpen in IMG/M
3300020141Freshwater lake microbial communities from Lake Erken, Sweden - P4710_104 megahit1EnvironmentalOpen in IMG/M
3300020151Freshwater lake microbial communities from Lake Erken, Sweden - P4710_202 megahit1EnvironmentalOpen in IMG/M
3300020159Freshwater lake microbial communities from Lake Erken, Sweden - P4710_108 megahit1EnvironmentalOpen in IMG/M
3300020160Freshwater lake microbial communities from Lake Erken, Sweden - P4710_105 megahit1EnvironmentalOpen in IMG/M
3300020162Freshwater lake microbial communities from Lake Erken, Sweden - P4710_201 megahit1EnvironmentalOpen in IMG/M
3300020172Freshwater lake microbial communities from Lake Erken, Sweden - P4710_102 megahit1EnvironmentalOpen in IMG/M
3300020524Freshwater microbial communities from Lake Mendota, WI - 16NOV2012 deep hole epilimnion (SPAdes)EnvironmentalOpen in IMG/M
3300021516Anoxic zone freshwater microbial communities from boreal shield lake in IISD Experimental Lakes Area, Ontario, Canada - Jun2016-L626-11mEnvironmentalOpen in IMG/M
3300021961Estuarine water microbial communities from San Francisco Bay, California, United States - C33_3DEnvironmentalOpen in IMG/M
3300021962Estuarine water microbial communities from San Francisco Bay, California, United States - C33_649DEnvironmentalOpen in IMG/M
3300022179Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MLB.D.NEnvironmentalOpen in IMG/M
3300022190Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM15.S.NEnvironmentalOpen in IMG/M
3300024306Freshwater microbial communities from Altamaha River, Georgia, United States - Atl_Miss_RepB_8hEnvironmentalOpen in IMG/M
3300024343Combined assembly of estuarine microbial communities from Columbia River, Washington, USA >3um size fractionEnvironmentalOpen in IMG/M
33000243480.2um to 3um size fraction coassemblyEnvironmentalOpen in IMG/M
3300024351Freshwater microbial communities from Altamaha River, Georgia, United States - Atl_Cont_RepA_0hEnvironmentalOpen in IMG/M
3300024352Freshwater microbial communities from Altamaha River, Georgia, United States - Atl_Cont_RepB_0hEnvironmentalOpen in IMG/M
3300024358Freshwater microbial communities from Altamaha River, Georgia, United States - Atl_Atl_RepA_8dEnvironmentalOpen in IMG/M
3300024495Freshwater microbial communities from Altamaha River, Georgia, United States - Atl_Cont_RepA_8dEnvironmentalOpen in IMG/M
3300024503Freshwater microbial communities from Altamaha River, Georgia, United States - Atl_Yuk_RepC_8hEnvironmentalOpen in IMG/M
3300024513Freshwater microbial communities from Altamaha River, Georgia, United States - Atl_Cont_RepA_8hEnvironmentalOpen in IMG/M
3300025818Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Fall_15_<0.8_DNA (SPAdes)EnvironmentalOpen in IMG/M
3300026573Metatranscriptome of freshwater microbial communities from Altamaha River, Georgia, United States - Atl_Yuk_RepC_8h (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300027221Estuarine microbial communities from the Columbia River estuary - metaG 1548A-3 (SPAdes)EnvironmentalOpen in IMG/M
3300027223Estuarine microbial communities from the Columbia River estuary - metaG 1548B-3 (SPAdes)EnvironmentalOpen in IMG/M
3300027396Freshwater microbial communities from Altamaha River, Georgia, United States - Atl_Cont_RepC_8hEnvironmentalOpen in IMG/M
3300027467Freshwater microbial communities from Altamaha River, Georgia, United States - Atl_Atl_RepB_8hEnvironmentalOpen in IMG/M
3300027754Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130807_MF_MetaG (SPAdes)EnvironmentalOpen in IMG/M
3300027764Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MLB.SN (SPAdes)EnvironmentalOpen in IMG/M
3300027770Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130207_XF_MetaG (SPAdes)EnvironmentalOpen in IMG/M
3300027808Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM15.DD (SPAdes)EnvironmentalOpen in IMG/M
3300027899Freshwater lake sediment microbial communities from the University of Notre Dame, USA, for methane emissions studies - PLP11 PL (SPAdes)EnvironmentalOpen in IMG/M
3300031951Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 12 MA120EnvironmentalOpen in IMG/M
3300031997Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G06_0EnvironmentalOpen in IMG/M
3300031999Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G02_20EnvironmentalOpen in IMG/M
3300032116Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 2 MA119EnvironmentalOpen in IMG/M
3300032173Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - C1_topEnvironmentalOpen in IMG/M
3300033493Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_May_M1_C1_D3_AEnvironmentalOpen in IMG/M
3300033978Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME28Sep2014-rr0002EnvironmentalOpen in IMG/M
3300033994Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME25Jul2006D11-rr0046EnvironmentalOpen in IMG/M
3300034060Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME16May2013-rr0016EnvironmentalOpen in IMG/M
3300034066Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME11Jul2017-rr0087EnvironmentalOpen in IMG/M
3300034073Fracking water microbial communities from deep shales in Oklahoma, United States - MC-6-XLEnvironmentalOpen in IMG/M
3300034096Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME15Oct2015-rr0098EnvironmentalOpen in IMG/M
3300034101Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME19Sep2005-rr0107EnvironmentalOpen in IMG/M
3300034102Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME17Jul2002-rr0112EnvironmentalOpen in IMG/M
3300034106Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME23Aug2013-rr0131EnvironmentalOpen in IMG/M
3300034107Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME21Apr2017-rr0133EnvironmentalOpen in IMG/M
3300034110Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME01Jun2009D10-rr0171EnvironmentalOpen in IMG/M
3300034118Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME05Aug2017-rr0165EnvironmentalOpen in IMG/M
3300034272Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME18Jul2017-rr0156EnvironmentalOpen in IMG/M
3300034355Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME18Oct2015-rr0135EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap



 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
Ga0031658_105440413300003860Freshwater Lake SedimentMSNFKHLDGMVALLSEIYEINERIMTGXXCSAKTAIASGKMKKLLHHYHEALHEDG
Ga0069718_1590100713300004481SedimentMSAFKHLDGMVALLSEIYEINERVMCGDICSAKAAIASTRMKKLLNHYHEALHEDGASKVSLQAYVAA
Ga0075471_1018467843300006641AqueousMSAFKHLDGMVALLSEVYEINERVMCGDLCSAKTAIASTKMKKLLHHYHEALHEDGASKVSLQAYVAAG
Ga0075467_1053413023300006803AqueousMSNFKHLDGMVARLSEVYEINERIMTGDICSAKAAIASTNVKKILSHYHEALHEDGAVKVSLQAYVAAGGWVGI
Ga0075464_1006567613300006805AqueousMSNFKHLDGMVALLSEVYEINERIMTGDICSSKTALASDKMKKLLHHYHEA
Ga0075464_1088248223300006805AqueousMTDFRHLDAMRHLIEELFFVNERIMTGDIVSAKAAIASTNVKKILNHYHEALSEEGATMISLQAYVAAGGW
Ga0075473_1028947013300006875AqueousMSAFKHLDGMVALLSEVYEINERVMCGDLCSAKTAIASTKMKKLLHHYHEALHEDGASKVSLQAYV
Ga0070748_134334113300006920AqueousMRNLLAEIYEVNERIMTGDICSAKAAIASTNVKKILNHYHEALHEDGATKVSLQAYIAAGGWV
Ga0075460_1015286823300007234AqueousMSSFRHLDGMVALLSELYEINERIMTGDICSAKTAIHSDRMKKLLNHYHEALSEDGA
Ga0099847_120615023300007540AqueousMSSFRHLDGMVALLSELYEINERIMTRDICSAKTAIHSDRMKKLLNHYHEALSEDGATK
Ga0102817_102824753300007555EstuarineMSNFKHLDGMVALLSEVYEINERIMTGDICSAKTAIASGRMKKLLHHYHEALHED
Ga0102856_103598813300007636EstuarineMSNFQHLEGMRNLLAEIYEVNERIMTGDIVSPKAAIASTNVKKILNHYHEALHEDGAVKVSLQAYV
Ga0114841_126547413300008259Freshwater, PlanktonMSAFQHLDGMVALLSELYEINCRVECGDIVSAKAAIKSKRMEKLLNHYHEALSED
Ga0114349_1012081123300008263Freshwater, PlanktonMSAFQHLDGMVALLSELYEINCRVECGDIVSAKAAIKSKRMEKLLNHYH
Ga0114363_112310543300008266Freshwater, PlanktonMSSFRHLDGMTALLSEVYEINERIMCGDICSAKSAIASTRMKKLLNHYHEAL
Ga0114880_106156933300008450Freshwater LakeMSAFKHLDGMVALLSEVYEINERIMCGDICSAKAAIASTKMKKLLHHYHEALHEDGATKVSLQAYVAA
Ga0114880_113020343300008450Freshwater LakeMSSFRHLDGMTALLSEIYEINERVMSGDICSAKAAIASTKMKKLLHHYHEALHEDGATKVSLQAYVAA
Ga0114973_1035760133300009068Freshwater LakeMSSFKHLEGMRNLILEIYEVNERIMTGDIVSAKAAIASTNVKKILNHYHEALHEDGAVKVSLQAYVAAGG
Ga0105098_1029005033300009081Freshwater SedimentMSAFQHLDGMTALLSELYEVNERVLTGDIISAKAAIKSSRMPKLIRHYHEALSEDGAEA
Ga0114962_1034716113300009151Freshwater LakeMSNFQHLEGMRNLLLEIYEVNERIMTGDIVSAKAAIASTNVKKILNHYHEALHEDGAVKVSLQ
Ga0114962_1038079813300009151Freshwater LakeMLALLSELYEINERVMCGDIVSAKAAIASTRMKKCLNHYHEAISEDGGTKVWLRVYVAAGGW
Ga0114962_1040382433300009151Freshwater LakeMSEFKHTDGMLSLLSELYEINERIRTGDICSPKTAIASDRMKKLLNHYAEAISEDGASNIHLQAYVAAGG
Ga0114980_1048179113300009152Freshwater LakeMSSFAHLEGMRNLILEIYEVNERIMTGDICSAKSAIASTNVKKILNHYHEALHEDGAVKVSLQA
Ga0114977_1049744313300009158Freshwater LakeMTDFRHLEGMRNLLAEIYEVNERIMTGDICSAKSAIASTNVKKILNHYHEALHEDGAVK
Ga0114981_1038144933300009160Freshwater LakeMSSFAHLEGMRNLILEIYEVNERIMTGDICSAKSAIASTNVKKILNHYHEALHEDGAVKVSLQAYVAAGGWVGIQ
Ga0114975_1071970113300009164Freshwater LakeMSNFKHLDGMVALLYDIYEINERIMTGDICSAKAALASGNMKKLLAHYHEALHEDGAVKVSLQAY
Ga0105096_1022599743300009170Freshwater SedimentMSAFQHLDGMTALLSELYEINERVLTGDIISAKAAIKSSKMPKLIRHYH
Ga0114969_1062825513300009181Freshwater LakeMSSFAHLEGMRNLILEIYAVNERIMTGDICSAKAAIASTNVKKILNHYHEALHEDGA
Ga0114959_10003386223300009182Freshwater LakeMSEFKHSDGMLALLSELYEINERILTGDICSPKTAIASDRMKKLLNHYAEAISEDG
Ga0114976_1053901933300009184Freshwater LakeMSNFKHLDGMVALLYDIYEINERIMTGDICSAKAALASGNMKKLLAHYHEALHEDGAVKVSLQAYVAAGGWVGIQ
Ga0114964_1046600113300010157Freshwater LakeMSNFAHLEGMRNLLAEIYEVNERIMTGDICSAKAAIASTNVKKILTHYHEALHEDGAVKVSLQAYVAAGGWV
Ga0114960_1053164633300010158Freshwater LakeMSEFKHTDGMLSLLSELYEINERIRTGDICSPKTAIASDRMKKLLNHYAEAISEDGASNIHLQAY
Ga0181350_114372523300017716Freshwater LakeMSSFEHLEGMRNLLAEIYEVNERIMTGDILGPKSAIASANMKKILAHYHEALHEDGATKVSLQAY
Ga0181362_109995813300017723Freshwater LakeMSSFKHLDGMVALLYDIYEINERIMTGDICSAKAALASGNMKKLLLHYHEALHED
Ga0181344_101505413300017754Freshwater LakeMSSFRHLDGMVALLSEIYEINERIMTGDICSAKAAIASTRMKKLLNHYHEALSEDGATKISLQAY
Ga0181356_124038723300017761Freshwater LakeMSSFEHLEGMRNLLAEIYEVNERILTGDILGPKSAIASANMKKILAHYHEALHEDGAVKVSLQAY
Ga0181343_1010080103300017766Freshwater LakeMSSFRHLDGMVALLSEIYEINERIMTGDICSAKAAIASTRMKKLLNHYHEALSEDGATKISLQAYAAAGGWV
Ga0181343_104818353300017766Freshwater LakeMSSFRHLDGMVALLSEIYEINERILTLDIVSAKAAIASTRMKKLLNHYHEALSEDGATKISLQAYAAAGGWV
Ga0181343_119045333300017766Freshwater LakeMSSFRHLDGMVALLSEVYEINERIMTGDICSNKTAIASGRMKKLLHHYHEALHEDGAVKVSLQAYAAAGGW
Ga0181355_109421933300017785Freshwater LakeMSSFRHLDGMVALLSEIYEINERIMTGDICSAKSAIASDRMKKLLHHYHEALHEDGAVK
Ga0181359_126164713300019784Freshwater LakeMIALLYDIYEINERIMTGDICSAKAALASGNMKKLLLHYHEALHEDGAVKVSLQAYIAAG
Ga0211732_151523013300020141FreshwaterMRHLLEELFFVNERIMTGDIISAKAAIASTNLKKILNHYHEALSEEGATMISLQVYIAAGGWIG
Ga0211736_1040583313300020151FreshwaterMSAFKHLDGMVALLSEVYEINERVMCGDICSAKTAIASTRMKKLLNHYHEALHE
Ga0211734_1073074413300020159FreshwaterMSSFKHLDGMVALLSEVYEINCRVECGDIASAKAAIASTRMKKLLNHYHEALHEDGASKVSLQAYVAAGGWVGIA
Ga0211733_1025193513300020160FreshwaterMSAFKHLDGMVALLSEVYEINERVMCGDICSAKTAIASTRMKKLLNHYHEALHEDGASK
Ga0211733_1036921323300020160FreshwaterMSSFKHLDGMVALLSEVYEINERVMCGDICSAKTAIASTRMKKLLNHYHEALHEDGASKVSLQAYVAAGGWVGI
Ga0211735_1064368013300020162FreshwaterMSSFKHLDGMVALLSEVYEINCRVECGDIASAKAAIASTRMKKLLNHYHEALHEDGASKV
Ga0211729_1039508723300020172FreshwaterVSSFKHLDALVALLSEIYEINERILTLDICSAKTAIASTRMKKLLHHYHEALHEDGAVKVSLQAYVAAGGWVGI
Ga0208858_101141413300020524FreshwaterMSSFRHLDGMVALLSEIYEINERILTGDICSNKTAIASGRMKKLLHHYHEA
Ga0194045_110692413300021516Anoxic Zone FreshwaterMSEFKHTDGMLSLLSELYEINERILTGDICSPKTAIASDRMKKLLNHYAEAISED
Ga0222714_1011067013300021961Estuarine WaterMSSFRHLDGMVALLSEIYEINERILTGDICSNKTAIASHRMNKLLNHYHEALHEDGASKV
Ga0222714_1025083733300021961Estuarine WaterMSGSFQHLDGMAALLSELYEINERIMCGDIVSAKAAIASTRMTKLLRHYHEALSEDGAVSISLD
Ga0222713_1008790063300021962Estuarine WaterMAAFQHLDGMMALMSELYEINERILTGDIVSSKAAIKSPRMKKLLDH
Ga0222713_1025339213300021962Estuarine WaterMSSFRHLDGMVALLSEIYEINERILTGDICSNKTAIASHRMNKLLNHYHEALHEDGA
Ga0222713_1059722033300021962Estuarine WaterMTALMSELYEINERILTGDIISAKAAIKSPRMKKLLDHYHEALSEDGASAIYLDTYD
Ga0181353_100861913300022179Freshwater LakeMPNLMSSFRHLDGMTALLSEVYEINERIMCGDICSAKSAIASTRMKKLLNHYHEALHES
Ga0181354_109854143300022190Freshwater LakeVSAFQHLDGLVALLSEIYEINERILTLDICSAKTAIASTRMKKLLNHYHEALHEDGAVKVSLQAYVAAGGWVGITY
Ga0181354_119585813300022190Freshwater LakeMSSFEHLEGMRNLLIEIYEVNERILTGDIISAKAAIASTNVKKILNHYHEALHEDGAVKV
Ga0255148_102865713300024306FreshwaterVSAFQHLDGMTALLSELYEINERILTGDIISAKAAIKSPRMKKLLDHYHEALSEDGVSDIYLDTYEAAGSWV
Ga0244777_1080019523300024343EstuarineVSAFKHLDGMVALLSEVYEINERILTGDICSNKTAIASGRMKKLLHHYHEALHEDGAT
Ga0244776_1043480613300024348EstuarineMSAFRHLDGMVALLSEIYEINERILTGDICSNKTAIASGRMKKLLHHYNEALHEDGAVKV
Ga0255141_105453223300024351FreshwaterMAAFQHLDGMTALMSELYEINERILTGDIISAKAAIKSPRMKK
Ga0255142_101813153300024352FreshwaterVSAFQHLDGMTALLSELYEINERILTGDIISAKAAIKSPRMKKLLD
Ga0255173_104754413300024358FreshwaterMAAFQHLDGMTALMSELYEINERILTGDIISAKAAIKSPRMK
Ga0255164_101544053300024495FreshwaterMTALMSELYEINERILTGDIISAKAAIKSPRMKKLLDHYHEALSEDGAVEIY
Ga0255152_102082113300024503FreshwaterMAAFQHLDGMTALMSELYEINERILTGDIISAKAAIKSPRMKKL
Ga0255144_103708643300024513FreshwaterVSAFQHLDGMTALLSELYEINERILTGDIISAKAAIKSPRMKKLLDHYHEALSED
Ga0208542_110358423300025818AqueousMSSFRHLDGMVALLSELYEINERIMTGDICSAKTAIHSDRMKKLLNHYHEALSEDGASK
Ga0255269_105259143300026573FreshwaterMAAFQHLDGMTALMSELYEINERILTGDIISAKAAIKSPRMKKLLDHYHEALSEDGA
Ga0208557_104736713300027221EstuarineMSNFAHLEGMRNLILEIYEVNERIMTGDIISAKAAIASTNVKKILNHYHEALHEDGATNVSLQAYVAAGGWV
Ga0208169_103278613300027223EstuarineMSAFRHLDGMVALLSEIYEINERILTGDICSNKTAIASGRMKKLLHHYHEALHEDGAVKV
Ga0208169_107655213300027223EstuarineMSAFKHLDGMVALLSEVYEINERIMTGDICSNKTAIASTRMKKLLHHYHEALHEDGAVKVSLQAYCAAGG
Ga0255146_108121533300027396FreshwaterVSAFQHLDGMTALMSELYEINERILTGDIISAKAAIKSPRMKKLLDHYHEALSED
Ga0255154_105526513300027467FreshwaterMSAFQHLDGMTALMSELYEINERILTGDIISAKAAIKSPRMKKLLD
Ga0209596_133169233300027754Freshwater LakeMSNFQHLEGMRNLLAEIYEVNERIMTGDICSAKAAIASTNVKKILTHYHEALHEDGAVKVSLQAY
Ga0209134_1034199713300027764Freshwater LakeMTDFRHLEGMRNLLIEIYEVNERIMTGDICSAKSAIASTNVKKILAHYHEALHEDGAVKVSLQAYVAAGGWVG
Ga0209086_1012822453300027770Freshwater LakeMSNFKHLDGMRNLLAEIYEVNERIMTGDIISAKAAIASTNVKKILNHYHEALHEDGAVKVSLQAYVAAGGWV
Ga0209354_1044198813300027808Freshwater LakeMSNFKHLDGMVALLYDIFEINERIMTGDICSAKAALASGNMKKLLLHYHEALHEDGAVKVSLQAYVAAGGWV
Ga0209668_1040050913300027899Freshwater Lake SedimentMSNFKHLDGMVALLYDIYEINERIMTGDICSAKAALASGNMKKLLAHYHE
Ga0315904_1031785253300031951FreshwaterMSTFKHLDGMVALLSEVYEINERIMCGDICSAKAAIASTKMKKLLHHYHEALHEDGATKVSLQAYVAAG
Ga0315278_1151475333300031997SedimentMSSFQHLEGMRNLILEIYEVNERIMTGDICSAKAAIASTNVKKILAHYHEALHEDGAVKV
Ga0315274_1167360313300031999SedimentMSSFQHLEGMRNLILEIYEVNERIMTGDICSAKAAIASTNVKKILAHYHEALHEDGAVKVSLQAY
Ga0315903_1113209233300032116FreshwaterMTSFKHLDGMTALLSEVYEINERVMSGDICSAKAAIASTKMKKLLHHYHEALHEDG
Ga0315268_1224763913300032173SedimentMSSFQHLEGMRNLIQEIYFINERIMTGDICSAKAAIASTNVKKILNHYHEALHEDGATKVSLQAYVAAGGWV
Ga0316631_1033418233300033493SoilMSGSFQHLDGMLALMSELYEINERIMCGDIVSAKAAIKSTRMDKLLRHYHEALSEDGASAISLDVF
Ga0334977_0110073_2_1843300033978FreshwaterMSTFKHLDGMVALLSEVYEINERIMTGDICSSKTAIASTRMKKLLHHYHEALHEDGAVKV
Ga0334996_0533960_3_2273300033994FreshwaterMSSFRHLDGMVALLSEVYEINERILTGDITSNKTAIASGRMKKLLHHYHEALHEDGAVKVSLQAYAAAGGWVGIT
Ga0334983_0261001_859_10503300034060FreshwaterMTDFRHLDGMRNLILEIYEVNERIMTGDICSAKSAIASTNVKKILNHYHEALHEDGAVKVSLQA
Ga0335019_0120132_3_1643300034066FreshwaterMSSFRHLDGMVALLSEVYEINERILTGDITSNKTAIASGRMKKLLHHYHEALHE
Ga0335019_0764757_373_5463300034066FreshwaterMSSFRHLDGMVALLSEVYEINERIMTGDICSAKSAIASSRMKKLLHHYHEALHEDGAV
Ga0310130_0022153_1835_20173300034073Fracking WaterMTALLSELYEINERIMCGDIVSAKAAIKSDRMKKLLNHYHEALSEDGATKISLQAYAAIT
Ga0335025_0592859_3_1823300034096FreshwaterMSSFRHLDGMVALLSEVYEINERIMTGDICSAKTAIQSDRMKKLLHHYHEALHEDGAVKV
Ga0335027_0369093_754_9423300034101FreshwaterMSTFKHLDGMVALLSEVYEINERIMTGDICSAKTAIASTRMKKLLHHYHEALHEDGAVKVSLQ
Ga0335029_0638365_395_5893300034102FreshwaterMSSFRHLDGMVALLSEVYEINERILTGDICSNKTAIQSDRMKKLLNHYHEALSEDGAAKISLQAY
Ga0335029_0753849_3_1703300034102FreshwaterMSTFKHLDGMVALLSEVFEINERILTGDICSSKTAIASTRMKKLLHHYHEALHEDG
Ga0335036_0388543_731_8983300034106FreshwaterMSGSFQHLDGMTALLSELYEINERILTGDICSAKSAIASTRMKKLLHHYHEALHED
Ga0335037_0093690_1_2043300034107FreshwaterMSNFRHLDGMVALLSEIYEINERIMTGDICSNKTAIASGRMKKLLHHYHEALHEDGAVKVSLQAYAAA
Ga0335055_0380319_1_1893300034110FreshwaterMVGLLSEIFEINERILTGDICSNKSAIASTRMKKLLHHYHEALHEDGAVKVSLQAYAAAGGWV
Ga0335053_0186822_1202_13723300034118FreshwaterMSSFRHLDGMVALLSEVYEINERIMTGDICSAKTAIQSERMKKMLNHYHEALHEDGA
Ga0335053_0409901_1_1983300034118FreshwaterMSSFRHLDGMVALLSEVYEINERILTGDICSNKTAIQSDRMKKLLNHYHEALSEDGAAKISLQAYA
Ga0335049_0811939_1_2253300034272FreshwaterMSSFRHLDGMVALLSEIYEINERIMTGDICSNKTAIASGRMKKLLHHYHEALHEDGAVKVSLQAYAAAGGWVGIQ
Ga0335039_0671272_294_5003300034355FreshwaterMSSFRHLDGMVALLSEVYEINERIMTGDICSAKSAIASTRMKKLLHHYHEALHEDGAVKVSLQAYCAAG


 ⦗Top⦘


© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.