| Basic Information | |
|---|---|
| Family ID | F100985 |
| Family Type | Metagenome |
| Number of Sequences | 102 |
| Average Sequence Length | 44 residues |
| Representative Sequence | MEALYAGLTAWGIELTVAGLAFYLLYREEQKVYKRRATKKEKV |
| Number of Associated Samples | 64 |
| Number of Associated Scaffolds | 102 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | No |
| Most common taxonomic group | Unclassified |
| % of genes with valid RBS motifs | 88.24 % |
| % of genes near scaffold ends (potentially truncated) | 14.71 % |
| % of genes from short scaffolds (< 2000 bps) | 64.71 % |
| Associated GOLD sequencing projects | 57 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.56 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Unclassified (49.020 % of family members) |
| NCBI Taxonomy ID | N/A |
| Taxonomy | N/A |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Aquatic → Marine → Unclassified → Unclassified → Marine (36.274 % of family members) |
| Environment Ontology (ENVO) | Unclassified (74.510 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Saline → Water (saline) (78.431 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Transmembrane (alpha-helical) | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 57.75% β-sheet: 0.00% Coil/Unstructured: 42.25% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.56 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 102 Family Scaffolds |
|---|---|---|
| PF01467 | CTP_transf_like | 10.78 |
| PF14354 | Lar_restr_allev | 3.92 |
| PF13589 | HATPase_c_3 | 2.94 |
| PF00436 | SSB | 2.94 |
| PF07499 | RuvA_C | 2.94 |
| PF04542 | Sigma70_r2 | 2.94 |
| PF03332 | PMM | 2.94 |
| PF01244 | Peptidase_M19 | 1.96 |
| PF01050 | MannoseP_isomer | 1.96 |
| PF00719 | Pyrophosphatase | 0.98 |
| PF13662 | Toprim_4 | 0.98 |
| PF00268 | Ribonuc_red_sm | 0.98 |
| PF10504 | DUF2452 | 0.98 |
| PF07394 | DUF1501 | 0.98 |
| PF08003 | Methyltransf_9 | 0.98 |
| COG ID | Name | Functional Category | % Frequency in 102 Family Scaffolds |
|---|---|---|---|
| COG0561 | Hydroxymethylpyrimidine pyrophosphatase and other HAD family phosphatases | Coenzyme transport and metabolism [H] | 2.94 |
| COG0568 | DNA-directed RNA polymerase, sigma subunit (sigma70/sigma32) | Transcription [K] | 2.94 |
| COG0629 | Single-stranded DNA-binding protein | Replication, recombination and repair [L] | 2.94 |
| COG0632 | Holliday junction resolvasome RuvABC DNA-binding subunit | Replication, recombination and repair [L] | 2.94 |
| COG1191 | DNA-directed RNA polymerase specialized sigma subunit | Transcription [K] | 2.94 |
| COG1595 | DNA-directed RNA polymerase specialized sigma subunit, sigma24 family | Transcription [K] | 2.94 |
| COG2965 | Primosomal replication protein N | Replication, recombination and repair [L] | 2.94 |
| COG4941 | Predicted RNA polymerase sigma factor, contains C-terminal TPR domain | Transcription [K] | 2.94 |
| COG2355 | Zn-dependent dipeptidase, microsomal dipeptidase homolog | Posttranslational modification, protein turnover, chaperones [O] | 1.96 |
| COG0208 | Ribonucleotide reductase beta subunit, ferritin-like domain | Nucleotide transport and metabolism [F] | 0.98 |
| COG0221 | Inorganic pyrophosphatase | Energy production and conversion [C] | 0.98 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 50.98 % |
| Unclassified | root | N/A | 49.02 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300000115|DelMOSum2011_c10013296 | All Organisms → Viruses → Predicted Viral | 4210 | Open in IMG/M |
| 3300002231|KVRMV2_100127114 | All Organisms → Viruses → Predicted Viral | 2574 | Open in IMG/M |
| 3300002483|JGI25132J35274_1093269 | Not Available | 615 | Open in IMG/M |
| 3300002483|JGI25132J35274_1095971 | Not Available | 604 | Open in IMG/M |
| 3300003894|Ga0063241_1016088 | All Organisms → Viruses → Predicted Viral | 4128 | Open in IMG/M |
| 3300005433|Ga0066830_10004325 | All Organisms → Viruses → Predicted Viral | 2589 | Open in IMG/M |
| 3300005837|Ga0078893_11314761 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales | 7550 | Open in IMG/M |
| 3300006735|Ga0098038_1051384 | All Organisms → Viruses → Predicted Viral | 1487 | Open in IMG/M |
| 3300006751|Ga0098040_1183540 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Chloroflexi incertae sedis → SAR202 cluster → SAR202 cluster bacterium | 614 | Open in IMG/M |
| 3300006754|Ga0098044_1000120 | Not Available | 41974 | Open in IMG/M |
| 3300006754|Ga0098044_1336740 | Not Available | 573 | Open in IMG/M |
| 3300006789|Ga0098054_1054171 | All Organisms → Viruses → Predicted Viral | 1532 | Open in IMG/M |
| 3300006789|Ga0098054_1183898 | Not Available | 765 | Open in IMG/M |
| 3300006789|Ga0098054_1255872 | Not Available | 631 | Open in IMG/M |
| 3300006793|Ga0098055_1240724 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Balneolaeota → Balneolia → Balneolales → Balneolaceae → Balneola → unclassified Balneola → Balneola sp. | 682 | Open in IMG/M |
| 3300006929|Ga0098036_1003915 | All Organisms → cellular organisms → Bacteria | 5143 | Open in IMG/M |
| 3300006929|Ga0098036_1009662 | All Organisms → cellular organisms → Archaea → DPANN group → Candidatus Pacearchaeota → Candidatus Pacearchaeota archaeon | 3146 | Open in IMG/M |
| 3300006929|Ga0098036_1017833 | All Organisms → Viruses → Predicted Viral | 2256 | Open in IMG/M |
| 3300007113|Ga0101666_1015128 | All Organisms → cellular organisms → Bacteria | 1298 | Open in IMG/M |
| 3300007276|Ga0070747_1068649 | Not Available | 1335 | Open in IMG/M |
| 3300007963|Ga0110931_1072501 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Chloroflexi incertae sedis → SAR202 cluster → SAR202 cluster bacterium | 1040 | Open in IMG/M |
| 3300008050|Ga0098052_1308295 | Not Available | 597 | Open in IMG/M |
| 3300008624|Ga0115652_1005516 | Not Available | 7085 | Open in IMG/M |
| 3300009409|Ga0114993_10506217 | Not Available | 897 | Open in IMG/M |
| 3300009481|Ga0114932_10001096 | Not Available | 31741 | Open in IMG/M |
| 3300009481|Ga0114932_10007988 | Not Available | 8634 | Open in IMG/M |
| 3300009481|Ga0114932_10008677 | All Organisms → cellular organisms → Bacteria | 8140 | Open in IMG/M |
| 3300009481|Ga0114932_10010916 | All Organisms → cellular organisms → Bacteria | 6948 | Open in IMG/M |
| 3300009481|Ga0114932_10556893 | Not Available | 672 | Open in IMG/M |
| 3300009481|Ga0114932_10789407 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Chloroflexi incertae sedis → SAR202 cluster → SAR202 cluster bacterium | 550 | Open in IMG/M |
| 3300009481|Ga0114932_10789792 | Not Available | 550 | Open in IMG/M |
| 3300009593|Ga0115011_10472553 | Not Available | 990 | Open in IMG/M |
| 3300009605|Ga0114906_1174461 | All Organisms → cellular organisms → Archaea → DPANN group → Candidatus Pacearchaeota → Candidatus Pacearchaeota archaeon | 730 | Open in IMG/M |
| 3300009703|Ga0114933_10052547 | All Organisms → Viruses → Predicted Viral | 2978 | Open in IMG/M |
| 3300010149|Ga0098049_1222783 | Not Available | 576 | Open in IMG/M |
| 3300010150|Ga0098056_1206163 | Not Available | 656 | Open in IMG/M |
| 3300010153|Ga0098059_1085268 | All Organisms → Viruses → Predicted Viral | 1258 | Open in IMG/M |
| 3300012952|Ga0163180_10484552 | Not Available | 921 | Open in IMG/M |
| 3300012953|Ga0163179_10059317 | All Organisms → cellular organisms → Archaea → DPANN group → Candidatus Pacearchaeota → Candidatus Pacearchaeota archaeon | 2661 | Open in IMG/M |
| 3300012953|Ga0163179_10110983 | Not Available | 1997 | Open in IMG/M |
| 3300017720|Ga0181383_1112168 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Chloroflexi incertae sedis → SAR202 cluster → SAR202 cluster bacterium | 732 | Open in IMG/M |
| 3300020351|Ga0211601_1126307 | All Organisms → cellular organisms → Archaea → DPANN group → Candidatus Pacearchaeota → Candidatus Pacearchaeota archaeon | 578 | Open in IMG/M |
| 3300020380|Ga0211498_10166226 | Not Available | 833 | Open in IMG/M |
| 3300020387|Ga0211590_10192558 | Not Available | 634 | Open in IMG/M |
| 3300020387|Ga0211590_10262080 | Not Available | 544 | Open in IMG/M |
| 3300020403|Ga0211532_10020923 | All Organisms → cellular organisms → Archaea → DPANN group → Candidatus Pacearchaeota → Candidatus Pacearchaeota archaeon | 3613 | Open in IMG/M |
| 3300020410|Ga0211699_10000778 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Chloroflexi incertae sedis → SAR202 cluster → SAR202 cluster bacterium | 18043 | Open in IMG/M |
| 3300020410|Ga0211699_10003482 | Not Available | 7326 | Open in IMG/M |
| 3300020410|Ga0211699_10004249 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → Maribacter → unclassified Maribacter → Maribacter sp. | 6495 | Open in IMG/M |
| 3300020410|Ga0211699_10036861 | All Organisms → Viruses → Predicted Viral | 1845 | Open in IMG/M |
| 3300020410|Ga0211699_10111937 | Not Available | 1017 | Open in IMG/M |
| 3300020410|Ga0211699_10345236 | All Organisms → cellular organisms → Archaea → DPANN group → Candidatus Pacearchaeota → Candidatus Pacearchaeota archaeon | 585 | Open in IMG/M |
| 3300020411|Ga0211587_10009662 | Not Available | 5266 | Open in IMG/M |
| 3300020411|Ga0211587_10125163 | Not Available | 1102 | Open in IMG/M |
| 3300020438|Ga0211576_10145057 | All Organisms → Viruses → Predicted Viral | 1287 | Open in IMG/M |
| 3300020439|Ga0211558_10001701 | Not Available | 11935 | Open in IMG/M |
| 3300020439|Ga0211558_10188732 | Not Available | 986 | Open in IMG/M |
| 3300020439|Ga0211558_10261441 | Not Available | 816 | Open in IMG/M |
| 3300020441|Ga0211695_10270424 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales | 618 | Open in IMG/M |
| 3300020442|Ga0211559_10071079 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1694 | Open in IMG/M |
| 3300020451|Ga0211473_10236907 | Not Available | 939 | Open in IMG/M |
| 3300020451|Ga0211473_10369096 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Chloroflexi incertae sedis → SAR202 cluster → SAR202 cluster bacterium | 735 | Open in IMG/M |
| 3300020457|Ga0211643_10130247 | Not Available | 1239 | Open in IMG/M |
| 3300020460|Ga0211486_10254773 | Not Available | 760 | Open in IMG/M |
| 3300020464|Ga0211694_10415840 | All Organisms → cellular organisms → Archaea → DPANN group → Candidatus Pacearchaeota → Candidatus Pacearchaeota archaeon | 578 | Open in IMG/M |
| 3300020470|Ga0211543_10061665 | All Organisms → Viruses → Predicted Viral | 1964 | Open in IMG/M |
| 3300020470|Ga0211543_10124822 | Not Available | 1303 | Open in IMG/M |
| 3300020470|Ga0211543_10156614 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Chloroflexi incertae sedis → SAR202 cluster → SAR202 cluster bacterium | 1141 | Open in IMG/M |
| 3300020471|Ga0211614_10279095 | Not Available | 730 | Open in IMG/M |
| 3300020473|Ga0211625_10011487 | Not Available | 6808 | Open in IMG/M |
| 3300020474|Ga0211547_10059128 | Not Available | 2045 | Open in IMG/M |
| 3300020478|Ga0211503_10222040 | Not Available | 1055 | Open in IMG/M |
| 3300024344|Ga0209992_10000867 | Not Available | 36725 | Open in IMG/M |
| 3300024344|Ga0209992_10005003 | Not Available | 10052 | Open in IMG/M |
| 3300024344|Ga0209992_10006463 | All Organisms → cellular organisms → Bacteria | 8279 | Open in IMG/M |
| 3300024344|Ga0209992_10006694 | All Organisms → cellular organisms → Bacteria | 8060 | Open in IMG/M |
| 3300024344|Ga0209992_10007786 | Not Available | 7179 | Open in IMG/M |
| 3300024344|Ga0209992_10008393 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → Maribacter → unclassified Maribacter → Maribacter sp. | 6762 | Open in IMG/M |
| 3300024344|Ga0209992_10104890 | All Organisms → Viruses → Predicted Viral | 1265 | Open in IMG/M |
| 3300025070|Ga0208667_1071078 | Not Available | 525 | Open in IMG/M |
| 3300025084|Ga0208298_1103595 | Not Available | 514 | Open in IMG/M |
| 3300025108|Ga0208793_1121143 | Not Available | 714 | Open in IMG/M |
| 3300025112|Ga0209349_1035883 | All Organisms → Viruses → Predicted Viral | 1629 | Open in IMG/M |
| 3300025128|Ga0208919_1018992 | All Organisms → Viruses → Predicted Viral | 2617 | Open in IMG/M |
| 3300025151|Ga0209645_1003202 | Not Available | 7554 | Open in IMG/M |
| 3300025151|Ga0209645_1007938 | All Organisms → Viruses → Predicted Viral | 4409 | Open in IMG/M |
| 3300025652|Ga0208134_1031557 | All Organisms → Viruses → Predicted Viral | 1858 | Open in IMG/M |
| 3300027838|Ga0209089_10663466 | Not Available | 540 | Open in IMG/M |
| 3300028022|Ga0256382_1107954 | All Organisms → cellular organisms → Archaea → DPANN group → Candidatus Pacearchaeota → Candidatus Pacearchaeota archaeon | 668 | Open in IMG/M |
| 3300029301|Ga0135222_1000739 | Not Available | 1736 | Open in IMG/M |
| 3300029319|Ga0183748_1005144 | Not Available | 6286 | Open in IMG/M |
| 3300029319|Ga0183748_1007564 | All Organisms → Viruses → Predicted Viral | 4840 | Open in IMG/M |
| 3300029319|Ga0183748_1018586 | All Organisms → Viruses → Predicted Viral | 2530 | Open in IMG/M |
| 3300029319|Ga0183748_1062156 | All Organisms → cellular organisms → Archaea → DPANN group → Candidatus Pacearchaeota → Candidatus Pacearchaeota archaeon | 999 | Open in IMG/M |
| 3300029319|Ga0183748_1086101 | All Organisms → cellular organisms → Bacteria | 759 | Open in IMG/M |
| 3300029787|Ga0183757_1051299 | Not Available | 711 | Open in IMG/M |
| 3300031785|Ga0310343_10269432 | All Organisms → Viruses → Predicted Viral | 1194 | Open in IMG/M |
| 3300032011|Ga0315316_10795322 | Not Available | 780 | Open in IMG/M |
| 3300032011|Ga0315316_11291011 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Chloroflexi incertae sedis → SAR202 cluster → SAR202 cluster bacterium | 583 | Open in IMG/M |
| 3300032073|Ga0315315_10375631 | Not Available | 1323 | Open in IMG/M |
| 3300032073|Ga0315315_10910764 | All Organisms → cellular organisms → Bacteria → FCB group → Fibrobacteres | 794 | Open in IMG/M |
| 3300032274|Ga0316203_1047748 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Chloroflexi incertae sedis → SAR202 cluster → SAR202 cluster bacterium | 1232 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Marine | Environmental → Aquatic → Marine → Unclassified → Unclassified → Marine | 36.27% |
| Marine | Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine | 28.43% |
| Deep Subsurface | Environmental → Aquatic → Marine → Volcanic → Unclassified → Deep Subsurface | 14.71% |
| Seawater | Environmental → Aquatic → Marine → Intertidal Zone → Unclassified → Seawater | 3.92% |
| Seawater | Environmental → Aquatic → Marine → Oceanic → Unclassified → Seawater | 2.94% |
| Aqueous | Environmental → Aquatic → Marine → Coastal → Unclassified → Aqueous | 1.96% |
| Deep Ocean | Environmental → Aquatic → Marine → Oceanic → Unclassified → Deep Ocean | 0.98% |
| Seawater | Environmental → Aquatic → Marine → Oceanic → Unclassified → Seawater | 0.98% |
| Microbial Mat | Environmental → Aquatic → Marine → Coastal → Sediment → Microbial Mat | 0.98% |
| Marine | Environmental → Aquatic → Marine → Coastal → Unclassified → Marine | 0.98% |
| Marine Surface Water | Environmental → Aquatic → Marine → Coastal → Unclassified → Marine Surface Water | 0.98% |
| Marine | Environmental → Aquatic → Marine → Coastal → Unclassified → Marine | 0.98% |
| Seawater | Environmental → Aquatic → Marine → Pelagic → Unclassified → Seawater | 0.98% |
| Marine | Environmental → Aquatic → Marine → Neritic Zone → Unclassified → Marine | 0.98% |
| Marine Sediment | Environmental → Aquatic → Marine → Hydrothermal Vents → Sediment → Marine Sediment | 0.98% |
| Seawater | Environmental → Aquatic → Marine → Strait → Unclassified → Seawater | 0.98% |
| Marine Harbor | Environmental → Aquatic → Marine → Harbor → Unclassified → Marine Harbor | 0.98% |
| Volcanic Co2 Seep Seawater | Environmental → Aquatic → Marine → Volcanic → Unclassified → Volcanic Co2 Seep Seawater | 0.98% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300000115 | Marine microbial communities from Delaware Coast, sample from Delaware MO Summer July 2011 | Environmental | Open in IMG/M |
| 3300002231 | Marine sediment microbial communities from Santorini caldera mats, Greece - red mat | Environmental | Open in IMG/M |
| 3300002483 | Marine viral communities from the Pacific Ocean - ETNP_6_30 | Environmental | Open in IMG/M |
| 3300003894 | Marine microbial communities from the northern Gulf of Mexico hypoxic zone - Cultivation independent assessment | Environmental | Open in IMG/M |
| 3300005433 | Marine microbial and viral communities from oxygen minimum zone, Eastern Pacific Ocean - ETNP201306PF45B | Environmental | Open in IMG/M |
| 3300005837 | Exploring phylogenetic diversity in Port Hacking ocean in Sydney, Australia - Port Hacking PH4 TJ4-TJ18 | Environmental | Open in IMG/M |
| 3300006735 | Marine viral communities from the Subarctic Pacific Ocean - 5B_ETSP_OMZ_AT15132_CsCl metaG | Environmental | Open in IMG/M |
| 3300006751 | Marine viral communities from the Subarctic Pacific Ocean - 7_ETSP_OMZ_AT15161 metaG | Environmental | Open in IMG/M |
| 3300006754 | Marine viral communities from the Subarctic Pacific Ocean - 10_ETSP_OMZ_AT15264 metaG | Environmental | Open in IMG/M |
| 3300006789 | Marine viral communities from the Subarctic Pacific Ocean - 16_ETSP_OMZ_AT15313 metaG | Environmental | Open in IMG/M |
| 3300006793 | Marine viral communities from the Subarctic Pacific Ocean - 17_ETSP_OMZ_AT15314 metaG | Environmental | Open in IMG/M |
| 3300006929 | Marine viral communities from the Subarctic Pacific Ocean - 4_ETSP_OMZ_AT15127 metaG | Environmental | Open in IMG/M |
| 3300007113 | Seawater microbiome, Papua New Guinea CO2 seep, Upa-Upasina 'bubble' site, Water-is | Environmental | Open in IMG/M |
| 3300007276 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Mar_31 | Environmental | Open in IMG/M |
| 3300007963 | Marine viral communities from the Subarctic Pacific Ocean - 4_ETSP_OMZ_AT15127 metaG (version 2) | Environmental | Open in IMG/M |
| 3300008050 | Marine viral communities from the Subarctic Pacific Ocean - 15_ETSP_OMZ_AT15312 metaG | Environmental | Open in IMG/M |
| 3300008624 | Marine water column microbial communities of the permanently stratified Cariaco Basin, Venezuela, November cruise - 200m, 250-2.7um | Environmental | Open in IMG/M |
| 3300009409 | Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB2_150 | Environmental | Open in IMG/M |
| 3300009481 | Deep subsurface microbial communities from Kolumbo volcano to uncover new lineages of life (NeLLi) - 2SBTROV12_ACTIVE470 metaG | Environmental | Open in IMG/M |
| 3300009593 | Marine eukaryotic phytoplankton communities from Atlantic Ocean - Tropical Atlantic ANT8 Metagenome | Environmental | Open in IMG/M |
| 3300009605 | Marine viral communities from the Global Malaspina Expedition - Malaspina viral metaG DeepMed_M9 | Environmental | Open in IMG/M |
| 3300009703 | Deep subsurface microbial communities from Kolumbo volcano to uncover new lineages of life (NeLLi) - 4SBTROV12_W25 metaG | Environmental | Open in IMG/M |
| 3300010149 | Marine viral communities from the Subarctic Pacific Ocean - 13B_ETSP_OMZ_AT15268_CsCl metaG | Environmental | Open in IMG/M |
| 3300010150 | Marine viral communities from the Subarctic Pacific Ocean - 17B_ETSP_OMZ_AT15314_CsCl metaG | Environmental | Open in IMG/M |
| 3300010153 | Marine viral communities from the Subarctic Pacific Ocean - 20_ETSP_OMZ_AT15318 metaG | Environmental | Open in IMG/M |
| 3300012952 | Marine eukaryotic phytoplankton communities from the Atlantic Ocean - Atlantic ANT 4 Metagenome | Environmental | Open in IMG/M |
| 3300012953 | Marine eukaryotic phytoplankton communities from the Atlantic Ocean - Atlantic ANT 2 Metagenome | Environmental | Open in IMG/M |
| 3300017720 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 6 SPOT_SRF_2009-12-23 | Environmental | Open in IMG/M |
| 3300020351 | Marine microbial communities from Tara Oceans - TARA_B100000676 (ERX555955-ERR599089) | Environmental | Open in IMG/M |
| 3300020380 | Marine microbial communities from Tara Oceans - TARA_B000000565 (ERX555945-ERR599058) | Environmental | Open in IMG/M |
| 3300020387 | Marine microbial communities from Tara Oceans - TARA_B100000405 (ERX556119-ERR599023) | Environmental | Open in IMG/M |
| 3300020403 | Marine microbial communities from Tara Oceans - TARA_B100000085 (ERX556015-ERR599145) | Environmental | Open in IMG/M |
| 3300020410 | Marine microbial communities from Tara Oceans - TARA_B100000519 (ERX555959-ERR599148) | Environmental | Open in IMG/M |
| 3300020411 | Marine microbial communities from Tara Oceans - TARA_B100000131 (ERX556098-ERR599130) | Environmental | Open in IMG/M |
| 3300020438 | Marine microbial communities from Tara Oceans - TARA_B100001094 (ERX555907-ERR598942) | Environmental | Open in IMG/M |
| 3300020439 | Marine microbial communities from Tara Oceans - TARA_B100001939 (ERX556062-ERR599029) | Environmental | Open in IMG/M |
| 3300020441 | Marine prokaryotic communities collected during Tara Oceans survey from station TARA_078 - TARA_B100000524 (ERX556088-ERR599006) | Environmental | Open in IMG/M |
| 3300020442 | Marine microbial communities from Tara Oceans - TARA_B100002019 (ERX556121-ERR599162) | Environmental | Open in IMG/M |
| 3300020451 | Marine microbial communities from Tara Oceans - TARA_B100001778 (ERX555927-ERR598996) | Environmental | Open in IMG/M |
| 3300020457 | Marine microbial communities from Tara Oceans - TARA_B100001113 (ERX555941-ERR599014) | Environmental | Open in IMG/M |
| 3300020460 | Marine microbial communities from Tara Oceans - TARA_A100001037 (ERX555931-ERR599097) | Environmental | Open in IMG/M |
| 3300020464 | Marine microbial communities from Tara Oceans - TARA_B100000530 (ERX556075-ERR599101) | Environmental | Open in IMG/M |
| 3300020470 | Marine microbial communities from Tara Oceans - TARA_B100000287 (ERX555976-ERR599053) | Environmental | Open in IMG/M |
| 3300020471 | Marine microbial communities from Tara Oceans - TARA_B100000214 (ERX556063-ERR599002) | Environmental | Open in IMG/M |
| 3300020473 | Marine microbial communities from Tara Oceans - TARA_B100000700 (ERX555932-ERR598948) | Environmental | Open in IMG/M |
| 3300020474 | Marine prokaryotic communities collected during Tara Oceans survey from station TARA_151 - TARA_B100001564 (ERX555957-ERR598976) | Environmental | Open in IMG/M |
| 3300020478 | Marine microbial communities from Tara Oceans - TARA_B100000029 (ERX556025-ERR599111) | Environmental | Open in IMG/M |
| 3300024344 | Deep subsurface microbial communities from Kolumbo volcano to uncover new lineages of life (NeLLi) - 2SBTROV12_ACTIVE470 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025070 | Marine viral communities from the Subarctic Pacific Ocean - 11B_ETSP_OMZ_AT15265_CsCl metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025084 | Marine viral communities from the Subarctic Pacific Ocean - 14B_ETSP_OMZ_AT15311_CsCl metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025108 | Marine viral communities from the Subarctic Pacific Ocean - 17_ETSP_OMZ_AT15314 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025112 | Marine viral communities from the Pacific Ocean - ETNP_2_130 (SPAdes) | Environmental | Open in IMG/M |
| 3300025128 | Marine viral communities from the Subarctic Pacific Ocean - 4_ETSP_OMZ_AT15127 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025151 | Marine viral communities from the Pacific Ocean - ETNP_6_30 (SPAdes) | Environmental | Open in IMG/M |
| 3300025652 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Mar_31 (SPAdes) | Environmental | Open in IMG/M |
| 3300027838 | Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB2_150 (SPAdes) | Environmental | Open in IMG/M |
| 3300028022 | Seawater viral communities from deep brine pools at the bottom of the Mediterranean Sea - LS1 750m | Environmental | Open in IMG/M |
| 3300029301 | Marine harbor viral communities from the Indian Ocean - SRH1 | Environmental | Open in IMG/M |
| 3300029319 | Marine viral communities collected during Tara Oceans survey from station TARA_032 - TARA_A100001516 | Environmental | Open in IMG/M |
| 3300029787 | Marine viral communities collected during Tara Oceans survey from station TARA_018 - TARA_A100000172 | Environmental | Open in IMG/M |
| 3300031785 | Marine microbial communities from station ALOHA, North Pacific Subtropical Gyre - HC15-DNA-20-25_MG | Environmental | Open in IMG/M |
| 3300032011 | Ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M1 60m 3416 | Environmental | Open in IMG/M |
| 3300032073 | Ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M1 40m 3416 | Environmental | Open in IMG/M |
| 3300032274 | Microbial mat bacterial communities from mineral coupon in-situ incubated in ocean water Damariscotta River, Maine, United States - 6-month pyrrhotite 1 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| DelMOSum2011_100132962 | 3300000115 | Marine | MQAFYAGLTAWGIELVVAGLAFYLLYREEQKVYKRRASKKEEV* |
| KVRMV2_1001271141 | 3300002231 | Marine Sediment | MQALYAGLTAWGIELAVAGLAFYLLYREEQKVYKRRATKKEKVQS* |
| JGI25132J35274_10932692 | 3300002483 | Marine | MKAMYAGILAWAIELSVAGLAFYLLYREEQKVYKKRASKKEIHTE* |
| JGI25132J35274_10959712 | 3300002483 | Marine | MKAMYAGILAWAIELSVAGLAFYLLYREEQKVYKRRASKKEIHTE* |
| Ga0063241_10160888 | 3300003894 | Marine | MEALYAGLSAWAIEIGIAILAFYLLYREEQKVYKRRAAKKEKV* |
| Ga0066830_1000432511 | 3300005433 | Marine | MQALYAGLAAWGIELAVAGLAFYLLYREEQKVYKRRATKKEK |
| Ga0078893_113147613 | 3300005837 | Marine Surface Water | MQALYAGLAAWGIELAVAGLAFYLLYREEQKVYKRRATKKEKVQS* |
| Ga0098038_10513847 | 3300006735 | Marine | MQAFYAGLTAWGIELVVAGLAFYLLYREEQKVYKRRASK |
| Ga0098040_11835403 | 3300006751 | Marine | MEAFYAGLTAWTIELTIAGIILYILHREEQKVYKRRQGDMDNE* |
| Ga0098044_100012014 | 3300006754 | Marine | MEAFYAGLTAWTIELTIAGIILYILHREEQKVYKRRASKKEEV* |
| Ga0098044_13367403 | 3300006754 | Marine | MEALYAGLTAWTIELTIAGIILYILHREEQKVYKRRQGDMDNE* |
| Ga0098054_10541717 | 3300006789 | Marine | MEAFYAGLTAWTIELTIAGIILYILHREEQKVYKRRVSKKEEV* |
| Ga0098054_11838983 | 3300006789 | Marine | MEALYAGLSAWAIELGIAALAFYLLHREEQKVYKRRASKKEEV* |
| Ga0098054_12558723 | 3300006789 | Marine | MNALWAGLTAWAIELTVAGIMMFVLKREEQKVYKRRKNK* |
| Ga0098055_12407244 | 3300006793 | Marine | DGEAMNALWAGLTAWAIELTVAGIMMFVLKREEQKVYKRRKNK* |
| Ga0098036_100391513 | 3300006929 | Marine | MEPLYAGLLAWLIELSVAGVAFYLLRREENKVYRRREDDKTRKS* |
| Ga0098036_10096628 | 3300006929 | Marine | MEALYAGLAAWGIELTVAGIAFYLLYREEQKVYRRREDDKTR* |
| Ga0098036_10178333 | 3300006929 | Marine | MEALYAGLSAWAIELSIAALAFYLLYREEQKVYKRRAAKKEEVQ* |
| Ga0101666_10151282 | 3300007113 | Volcanic Co2 Seep Seawater | MQALYAGLLAWGIEITVAGLAFYLLYREEQKVYRRRKDGKTRQD* |
| Ga0070747_10686492 | 3300007276 | Aqueous | MEAFYAGLTAWAIELSVAGIAFYLLYREEQKVYKRRGSKKEKIHSE* |
| Ga0110931_10725012 | 3300007963 | Marine | MQALYAGLTAWTIELAVAGLAFYLLYKEEQKVYKKRATKKEKISTNED* |
| Ga0098052_13082952 | 3300008050 | Marine | MEAFYAGLTAWTIELTIAGIILYTLHREEQKVYKRRQGDMDNE* |
| Ga0115652_10055164 | 3300008624 | Marine | MEAFYAGLTAWTIELTIAGIILYILYREEQKVYKRRASKKEEV* |
| Ga0114993_105062172 | 3300009409 | Marine | MEAFYAGTTAWTIELAIAGIILYMLYREEQKVYKRRKKEIKND* |
| Ga0114932_1000109650 | 3300009481 | Deep Subsurface | MEALYAGLTAWGIELTVAGLAFYLLYREEQKVYKRRATKKEKV* |
| Ga0114932_100079889 | 3300009481 | Deep Subsurface | MEALYAGLSAWGIELSIAALAFYLLYREEQKVYKRRAAKKEEV* |
| Ga0114932_100086774 | 3300009481 | Deep Subsurface | MEALYAGLAAWGIELTVAGIAFYLLYREEQKVYKRRAAKKEEV* |
| Ga0114932_1001091612 | 3300009481 | Deep Subsurface | MEAFYAGLTAWAIELSVAGLAFYLLYKEEQKVYKKRASKKEIHTE* |
| Ga0114932_105568933 | 3300009481 | Deep Subsurface | MQAFYAGLTAWGIELVVAGLAFYLLYREEQKVNNRRASKKEED* |
| Ga0114932_107894073 | 3300009481 | Deep Subsurface | AGLTAWGIELAIAGLLLYVLYREEQKVYRRRRNKDE* |
| Ga0114932_107897922 | 3300009481 | Deep Subsurface | MNAIYAGILAWFIELSVAGAMFLILKREESKVYKRRDAKKKEKH* |
| Ga0115011_104725532 | 3300009593 | Marine | MEALYAGLTAWGIELTVAGIAFYLLYREEQKVYKRRAAKKKEVQ* |
| Ga0114906_11744612 | 3300009605 | Deep Ocean | MEALYAGLTAWGIELTVAGIAFYLLYREEQKVYRRRRDDKTK* |
| Ga0114933_100525474 | 3300009703 | Deep Subsurface | MDALYAGLTAWAIEISVALFAFYLLYREEQKVYKRRNTKTSKVKQDG* |
| Ga0098049_12227832 | 3300010149 | Marine | MEAFYAGLTAWAIELSVAGIAFYLLYREEQKVYKRRGSKKEKIHTE* |
| Ga0098056_12061633 | 3300010150 | Marine | MEALLAGLTAGGIELTVAGLAFYLLYREEQKVFRRRENAKEEK* |
| Ga0098059_10852683 | 3300010153 | Marine | MQALYAGLTAWTIELSVAALAFYLLYKEEQKVYKKRATKEEKVSSNED* |
| Ga0163180_104845523 | 3300012952 | Seawater | MEAMYAGILAWAIELSVAGLAFYLLYREEQKVYKRRATKKEKV* |
| Ga0163179_100593174 | 3300012953 | Seawater | MEALYAGLTAWGIEITVAAIAFYLLYREEQKVYRRRKNGKTK* |
| Ga0163179_101109837 | 3300012953 | Seawater | MEPLYAGLLAWLIELGVAGAAFYLLRREENKVYRRREDDKTRKS* |
| Ga0181383_11121681 | 3300017720 | Seawater | MEAFYAGLTAWAIELSVAGIAFYLLYREEQKVYKRRGSKKE |
| Ga0211601_11263072 | 3300020351 | Marine | MQALYAGLLAWGIEIAVAGLAFYLLYREEQKVYRRRKDGKTRQD |
| Ga0211498_101662263 | 3300020380 | Marine | MQALYAGLAAWGIELAVAGLAFYLLYREEQKVYKRRATKKEEVCSEENR |
| Ga0211590_101925582 | 3300020387 | Marine | MQALYAGLAAWVIELGVAGLAFYLLYREEQKVYKRRAAKKEKI |
| Ga0211590_102620803 | 3300020387 | Marine | AIYAGLSAWAIEISIAALAFYLLYREEQKVYKRRAAKKEEVQ |
| Ga0211532_100209237 | 3300020403 | Marine | MQALYAGLLAWGIEIAVASLAFYLLYREEQKVYRRRKNGKTRQD |
| Ga0211699_1000077836 | 3300020410 | Marine | MQALYAGLAAWVIELGVAGLAFYLLYREEQKVYKRRATKKEKV |
| Ga0211699_100034827 | 3300020410 | Marine | MEPLYAGLLAWLIELGVAGAAFYLLRREENKVYRRREDDKTKQS |
| Ga0211699_1000424911 | 3300020410 | Marine | MQALYAGLAAWGIELAVAGLAFYLLYREEQKVYKRRASKKEEIHTE |
| Ga0211699_100368614 | 3300020410 | Marine | MEALYAGLSAWAIELSIAALAFYLLYREEQKVYKRRAAKKEEVQ |
| Ga0211699_101119373 | 3300020410 | Marine | MEAIYAGLSAWAIEISIAALAFYLLYREEQKVYKRRAAKKEKV |
| Ga0211699_103452362 | 3300020410 | Marine | MEALYAGLTAWGIELTVAGIAFYLLYREEQKVYRRRKDGKR |
| Ga0211587_100096627 | 3300020411 | Marine | MQALYAGLLAWGVELAVAGLAFYLLYREEQKVYRRRKNGKR |
| Ga0211587_101251633 | 3300020411 | Marine | MEALYAGLSAWAIELAIAALAFYLLYREEQKVYKRRAAKKEKV |
| Ga0211576_101450571 | 3300020438 | Marine | TAWGIELTVAGLAFYLLYREEQKVFRRRENAKEEK |
| Ga0211558_1000170110 | 3300020439 | Marine | MQALYAGLLAWGIELAVAGFAFYLLYREEQKVYRRRKNGKREE |
| Ga0211558_101887321 | 3300020439 | Marine | MQAFYAGLAAWGIELAVAGLAFYLLYREEQKVYKRRAAKKEE |
| Ga0211558_102614412 | 3300020439 | Marine | MEALYAGLSAWAIEIGIAALAFYLLYREEQKVYKRRAAKKEEVQ |
| Ga0211695_102704243 | 3300020441 | Marine | MNAIYAGILAWFIELSVAGTMFLILKREESKVYKRRDAKKKEKH |
| Ga0211559_100710792 | 3300020442 | Marine | MQALYAGLAAWGIELAVAGLAFYLLYREEQKVYKRRASKKEEVHTK |
| Ga0211473_102369073 | 3300020451 | Marine | MEALYAGLTAWAIELSVAGIAFYLLYKEEQKVYKKRASKKEIHTE |
| Ga0211473_103690962 | 3300020451 | Marine | MQAIYAGLTAWVVEVTIVLTILYLVYREEQKVYKRRTISSLL |
| Ga0211643_101302472 | 3300020457 | Marine | MDALFAGMSAWAIELTVAALAFYLLYREEQKVYKKRATNKEKISKTQD |
| Ga0211486_102547731 | 3300020460 | Marine | MEALYAGLAAWGIEITVAGIAFYLLYREEQKVYRRRKDDQTKKG |
| Ga0211694_104158402 | 3300020464 | Marine | YVDMEPLYAGLLAWLIELGVAGAAFYLLRREENKVYRRREDDKTKQS |
| Ga0211543_100616651 | 3300020470 | Marine | MEALYAGLSAWVIEIGIAALAFYLLYREEQKVYKRRA |
| Ga0211543_101248222 | 3300020470 | Marine | MQALYAGLAAWGIELAVAGLAFYLLYREEQKVYKRRATKKEEVCAEENR |
| Ga0211543_101566141 | 3300020470 | Marine | MQALYAGLLAWVLELSVAGLAFYLLYREEQKVYRRRKNG |
| Ga0211614_102790951 | 3300020471 | Marine | AGLSAWAIEIGIAALAFYLLYREEQKVYKRRAAKKEEVQ |
| Ga0211625_100114873 | 3300020473 | Marine | MEALYAGLTAWAIEIGIAILAFYLLHREEQKVYKRRAAKKEKV |
| Ga0211547_100591283 | 3300020474 | Marine | MEPLYAGLLAWLIELGVAGAAFYLLRREENKVYRRREDDKTRKS |
| Ga0211503_102220402 | 3300020478 | Marine | MEALYAGLSAWAIEIGIAALAFYLLYREEQKVYKRRAAKKEKV |
| Ga0209992_1000086755 | 3300024344 | Deep Subsurface | MEALYAGLTAWGIELTVAGLAFYLLYREEQKVYKRRATKKEKV |
| Ga0209992_100050038 | 3300024344 | Deep Subsurface | MEALYAGLAAWGIELTVAGIAFYLLYREEQKVYRRREDDKTR |
| Ga0209992_100064631 | 3300024344 | Deep Subsurface | SVERELHMEALYAGLAAWGIELTVAGIAFYLLYREEQKVYKRRAAKKEEV |
| Ga0209992_100066949 | 3300024344 | Deep Subsurface | MEAFYAGLTAWAIELSVAGLAFYLLYKEEQKVYKKRASKKEIHTE |
| Ga0209992_100077863 | 3300024344 | Deep Subsurface | MEALYAGLSAWGIELSIAALAFYLLYREEQKVYKRRAAKKEEV |
| Ga0209992_1000839311 | 3300024344 | Deep Subsurface | MQALYAGLTAWGIELAVAGLAFYLLYREEQKVYKRRATKKEKVQS |
| Ga0209992_101048903 | 3300024344 | Deep Subsurface | MEALMAGMLAWGIEITIALSMFYILHREEQKVFQRRKK |
| Ga0208667_10710781 | 3300025070 | Marine | MQAFYAGLTAWGIELVVAGLAFYLLYREEQKVYKRRASKKE |
| Ga0208298_11035951 | 3300025084 | Marine | MQAFYAGLTAWGIELVVAGLAFYLLYREEQKVYKRRASKKEEV |
| Ga0208793_11211433 | 3300025108 | Marine | MEAFYAGLTAWTIELTIAGIILYILHREEQKVYKRRASKKEEV |
| Ga0209349_10358832 | 3300025112 | Marine | MYALYAGLTAWTIELTIAGIILYILHREEQKVYKRRQGDMDNE |
| Ga0208919_10189925 | 3300025128 | Marine | MQALYAGLTAWTIELAVAGLAFYLLYKEEQKVYKKRATKKEKISTNED |
| Ga0209645_100320214 | 3300025151 | Marine | MQALYAGLTAWGIEITIAGIAFYLLYREEQKVYRRRKDDQTKKG |
| Ga0209645_10079389 | 3300025151 | Marine | MKAMYAGILAWAIELSVAGLAFYLLYREEQKVYKRRASKKEIHTE |
| Ga0208134_10315572 | 3300025652 | Aqueous | MEAFYAGLTAWAIELSVAGIAFYLLYREEQKVYKRRGSKKEKIHSE |
| Ga0209089_106634661 | 3300027838 | Marine | MEAFYAGTTAWTIELAIAGIILYMLYREEQKVYKRRKKEIKND |
| Ga0256382_11079543 | 3300028022 | Seawater | MEALYAGLTAWGIELTVAGIAFYLLYREEQKVYRRRRDDKTK |
| Ga0135222_10007393 | 3300029301 | Marine Harbor | MQALYAGLAAWGIELAVAGLAFYLLYREEQKVYKRRAAKKEEIHTEENR |
| Ga0183748_100514410 | 3300029319 | Marine | MQALYAGLAAWGIELAVAGLAFYLLYREEQKVYKRRGSKKEEIHTE |
| Ga0183748_100756412 | 3300029319 | Marine | MQALYAGLAAWGIELAVAGLAFYLLYREEQKVYKRRAAKKEEICTEENR |
| Ga0183748_10185865 | 3300029319 | Marine | MEALYAGLSAWAIEIGIAALAFYLLYREEQKVYKRRAAKKEKVQ |
| Ga0183748_10621563 | 3300029319 | Marine | MQALYAGLLAWGIEIAVASLAFYLLYREEQKVYRRRKNDKTRQD |
| Ga0183748_10861011 | 3300029319 | Marine | MQALYAGLAAWGIELAVAGLAFYLLYREEQKVYKRRATKKEKVQS |
| Ga0183757_10512993 | 3300029787 | Marine | MEALYAGLTAWAIELSVAGVAFYLLNKEEQKVYKRRASKKEIHTE |
| Ga0310343_102694323 | 3300031785 | Seawater | MQAFYAGLAAWGIELAVAGLAFYLLYREEQKVYKRRASKKEEVHTK |
| Ga0315316_107953221 | 3300032011 | Seawater | MEALYAGLTAWAIELSVAGVAFYLLNKEEQKVYKKRASKKEVSTSED |
| Ga0315316_112910111 | 3300032011 | Seawater | MEALYAGLTAWTIELTIAGIILYILHREEQKVYKRRQGDM |
| Ga0315315_103756314 | 3300032073 | Seawater | MDALFAGMSAWAIELTVAALGFYLLYREEQKVYKRRATKKEKISNTQD |
| Ga0315315_109107642 | 3300032073 | Seawater | MEALYAGLTAWGIELTIAGLMFYLLYREERKCIARRSKNDDR |
| Ga0316203_10477484 | 3300032274 | Microbial Mat | MQALYAGLAAWTIELAVAGLAFYLLYREEQKVYKKRATKKEEVSTNED |
| ⦗Top⦘ |