NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F100925

Metagenome / Metatranscriptome Family F100925

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F100925
Family Type Metagenome / Metatranscriptome
Number of Sequences 102
Average Sequence Length 76 residues
Representative Sequence MSTRPILILNPRDDTAFTGYAEELATASDLTPDDLQRRLRERYPLAAVRPRDLSSERTTVWYVYRDGHWVPRA
Number of Associated Samples 89
Number of Associated Scaffolds 102

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 67.65 %
% of genes near scaffold ends (potentially truncated) 34.31 %
% of genes from short scaffolds (< 2000 bps) 97.06 %
Associated GOLD sequencing projects 85
AlphaFold2 3D model prediction No

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (100.000 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil
(33.333 % of family members)
Environment Ontology (ENVO) Unclassified
(27.451 % of family members)
Earth Microbiome Project Ontology (EMPO) Free-living → Non-saline → Soil (non-saline)
(56.863 % of family members)



 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      


 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 26.03%    β-sheet: 12.33%    Coil/Unstructured: 61.64%
Feature Viewer
Powered by Feature Viewer


 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 102 Family Scaffolds
PF06803DUF1232 28.43
PF10531SLBB 3.92
PF12836HHH_3 1.96
PF13649Methyltransf_25 0.98

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 102 Family Scaffolds
COG3339Uncharacterized membrane protein YkvA, DUF1232 familyFunction unknown [S] 28.43


 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms100.00 %
UnclassifiedrootN/A0.00 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
3300004081|Ga0063454_101168227All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium634Open in IMG/M
3300004114|Ga0062593_101506213All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium725Open in IMG/M
3300004479|Ga0062595_102392822All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium523Open in IMG/M
3300004480|Ga0062592_102652104All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium506Open in IMG/M
3300004643|Ga0062591_100491426All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium1050Open in IMG/M
3300005093|Ga0062594_101714025All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium657Open in IMG/M
3300005455|Ga0070663_100870978All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium776Open in IMG/M
3300005459|Ga0068867_100917700All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium789Open in IMG/M
3300005547|Ga0070693_100645602All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium769Open in IMG/M
3300005564|Ga0070664_102019669All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium547Open in IMG/M
3300005564|Ga0070664_102044804All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium544Open in IMG/M
3300005615|Ga0070702_101106860All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium633Open in IMG/M
3300005616|Ga0068852_100750121All Organisms → cellular organisms → Bacteria988Open in IMG/M
3300006755|Ga0079222_10167936All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium1273Open in IMG/M
3300006755|Ga0079222_10636894All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium825Open in IMG/M
3300009148|Ga0105243_10510310All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium1141Open in IMG/M
3300009553|Ga0105249_11256903All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium812Open in IMG/M
3300009789|Ga0126307_10149371All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium1869Open in IMG/M
3300009789|Ga0126307_10308707All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium1272Open in IMG/M
3300009840|Ga0126313_11258203All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium611Open in IMG/M
3300010036|Ga0126305_10400701All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium904Open in IMG/M
3300010037|Ga0126304_10551614All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium775Open in IMG/M
3300010041|Ga0126312_10966329All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium622Open in IMG/M
3300010147|Ga0126319_1633837All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium746Open in IMG/M
3300010147|Ga0126319_1649185All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium616Open in IMG/M
3300010154|Ga0127503_11079615All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium549Open in IMG/M
3300010166|Ga0126306_10449107All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium1014Open in IMG/M
3300011332|Ga0126317_10593465All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium617Open in IMG/M
3300011332|Ga0126317_10998894All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium571Open in IMG/M
3300012212|Ga0150985_100062080All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium558Open in IMG/M
3300012212|Ga0150985_113256111All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium749Open in IMG/M
3300012469|Ga0150984_107433834All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium517Open in IMG/M
3300012469|Ga0150984_113316494All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium783Open in IMG/M
3300012891|Ga0157305_10292964All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium507Open in IMG/M
3300012895|Ga0157309_10263510All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium567Open in IMG/M
3300012896|Ga0157303_10097385All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium706Open in IMG/M
3300012898|Ga0157293_10082066All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium793Open in IMG/M
3300012898|Ga0157293_10288232All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium537Open in IMG/M
3300012900|Ga0157292_10187907All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium683Open in IMG/M
3300012903|Ga0157289_10354502All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium537Open in IMG/M
3300012907|Ga0157283_10382162All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium517Open in IMG/M
3300012911|Ga0157301_10356091All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium553Open in IMG/M
3300012912|Ga0157306_10098087All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium844Open in IMG/M
3300012913|Ga0157298_10172479All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium669Open in IMG/M
3300012915|Ga0157302_10043361All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium RBG_16_72_141243Open in IMG/M
3300012937|Ga0162653_100068271All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium571Open in IMG/M
3300012943|Ga0164241_10127383All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium1826Open in IMG/M
3300012955|Ga0164298_10241696All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium1083Open in IMG/M
3300012957|Ga0164303_11382454All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium525Open in IMG/M
3300012985|Ga0164308_10208102All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium RBG_16_72_141496Open in IMG/M
3300012985|Ga0164308_10562764All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium964Open in IMG/M
3300012987|Ga0164307_10070503All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi2086Open in IMG/M
3300012988|Ga0164306_10434235All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi995Open in IMG/M
3300013306|Ga0163162_11826510All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium695Open in IMG/M
3300014969|Ga0157376_12057999All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium609Open in IMG/M
3300015077|Ga0173483_10257684All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium834Open in IMG/M
3300015201|Ga0173478_10698303All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium542Open in IMG/M
3300015372|Ga0132256_102475448All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium621Open in IMG/M
3300017965|Ga0190266_10003675All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium3268Open in IMG/M
3300018432|Ga0190275_11099532All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium868Open in IMG/M
3300018476|Ga0190274_10027178All Organisms → cellular organisms → Bacteria3853Open in IMG/M
3300018476|Ga0190274_11570230All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium750Open in IMG/M
3300019362|Ga0173479_10113706All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium1026Open in IMG/M
3300022906|Ga0247766_1042846All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium1135Open in IMG/M
3300022911|Ga0247783_1261787All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium503Open in IMG/M
3300023272|Ga0247760_1070296All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium889Open in IMG/M
3300023275|Ga0247776_10213091All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium727Open in IMG/M
3300025925|Ga0207650_11920856All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium500Open in IMG/M
3300025935|Ga0207709_10753150All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium783Open in IMG/M
3300025945|Ga0207679_12171669All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium504Open in IMG/M
3300025981|Ga0207640_10852649All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium793Open in IMG/M
3300026089|Ga0207648_11205488All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium711Open in IMG/M
3300026118|Ga0207675_102636764All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium512Open in IMG/M
3300027787|Ga0209074_10058100All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium1204Open in IMG/M
3300028587|Ga0247828_10735405All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium618Open in IMG/M
3300028589|Ga0247818_11161358All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium550Open in IMG/M
3300028592|Ga0247822_10285126All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium1258Open in IMG/M
3300028597|Ga0247820_10920052All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium621Open in IMG/M
3300028704|Ga0307321_1101726All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium584Open in IMG/M
3300028754|Ga0307297_10174230All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium743Open in IMG/M
3300028790|Ga0307283_10045365All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium1031Open in IMG/M
3300028803|Ga0307281_10263792All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium635Open in IMG/M
3300028812|Ga0247825_10467540All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium895Open in IMG/M
3300028876|Ga0307286_10286552All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium607Open in IMG/M
3300028889|Ga0247827_10935312All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium584Open in IMG/M
3300030336|Ga0247826_10346158All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium1081Open in IMG/M
3300030336|Ga0247826_10538022All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium888Open in IMG/M
3300030336|Ga0247826_10673041All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium800Open in IMG/M
3300030902|Ga0308202_1130330All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium545Open in IMG/M
3300031092|Ga0308204_10157260All Organisms → cellular organisms → Bacteria → Terrabacteria group679Open in IMG/M
3300031854|Ga0310904_10258377All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium1083Open in IMG/M
3300031938|Ga0308175_101796673All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium687Open in IMG/M
3300031938|Ga0308175_102325996All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium601Open in IMG/M
3300031939|Ga0308174_11098161All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium677Open in IMG/M
3300031940|Ga0310901_10140049All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium917Open in IMG/M
3300031944|Ga0310884_10406797All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium783Open in IMG/M
3300032000|Ga0310903_10704475All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium546Open in IMG/M
3300032012|Ga0310902_11340419All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium508Open in IMG/M
3300032074|Ga0308173_10703260All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium924Open in IMG/M
3300032080|Ga0326721_11045773All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium524Open in IMG/M
3300032126|Ga0307415_101689442All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium610Open in IMG/M
3300033551|Ga0247830_10666765All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium825Open in IMG/M



 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil33.33%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural → Soil18.63%
Serpentine SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Serpentine Soil6.86%
SoilEnvironmental → Aquatic → Freshwater → Groundwater → Unclassified → Soil4.90%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil4.90%
Plant LitterEnvironmental → Terrestrial → Plant Litter → Unclassified → Unclassified → Plant Litter3.92%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere3.92%
Agricultural SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil2.94%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere1.96%
Avena Fatua RhizosphereHost-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Avena Fatua Rhizosphere1.96%
Corn RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere1.96%
Miscanthus RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere1.96%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere1.96%
Avena Fatua RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Avena Fatua Rhizosphere1.96%
SoilEnvironmental → Terrestrial → Soil → Loam → Grasslands → Soil0.98%
SoilEnvironmental → Terrestrial → Agricultural Field → Unclassified → Unclassified → Soil0.98%
Switchgrass RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere0.98%
Switchgrass RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere0.98%
RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere0.98%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere0.98%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere0.98%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere0.98%
Arabidopsis RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Arabidopsis Rhizosphere0.98%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
3300004081Grasslands soil microbial communities from Hopland, California, USA - 2 (version 2)EnvironmentalOpen in IMG/M
3300004114Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of AARS Block 5EnvironmentalOpen in IMG/M
3300004479Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of All WPAsEnvironmentalOpen in IMG/M
3300004480Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of AARS Block 4EnvironmentalOpen in IMG/M
3300004643Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Combined assembly of AARS Block 3EnvironmentalOpen in IMG/M
3300005093Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of KBS All BlocksEnvironmentalOpen in IMG/M
3300005455Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaGHost-AssociatedOpen in IMG/M
3300005459Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2Host-AssociatedOpen in IMG/M
3300005547Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaGEnvironmentalOpen in IMG/M
3300005564Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaGHost-AssociatedOpen in IMG/M
3300005615Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaGEnvironmentalOpen in IMG/M
3300005616Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2Host-AssociatedOpen in IMG/M
3300006755Agricultural soil microbial communities from Georgia to study Nitrogen management - GA PlitterEnvironmentalOpen in IMG/M
3300009148Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaGHost-AssociatedOpen in IMG/M
3300009553Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaGHost-AssociatedOpen in IMG/M
3300009789Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot28EnvironmentalOpen in IMG/M
3300009840Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot105AEnvironmentalOpen in IMG/M
3300010036Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot26EnvironmentalOpen in IMG/M
3300010037Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot25EnvironmentalOpen in IMG/M
3300010041Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot104AEnvironmentalOpen in IMG/M
3300010147Soil microbial communities from California, USA to study soil gas exchange rates - BB-CA-RED metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300010154Soil microbial communities from Willow Creek, Wisconsin, USA - WC-WI-TBF metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300010166Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot27EnvironmentalOpen in IMG/M
3300011332Soil microbial communities from California, USA to study soil gas exchange rates - SR-CA-SC2 metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300012212Combined assembly of Hopland grassland soilHost-AssociatedOpen in IMG/M
3300012469Combined assembly of Soil carbon rhizosphereHost-AssociatedOpen in IMG/M
3300012891Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S148-409B-2EnvironmentalOpen in IMG/M
3300012895Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S208-509C-2EnvironmentalOpen in IMG/M
3300012896Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S118-311C-2EnvironmentalOpen in IMG/M
3300012898Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S194-509B-1EnvironmentalOpen in IMG/M
3300012900Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S179-409R-1EnvironmentalOpen in IMG/M
3300012903Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S134-311R-1EnvironmentalOpen in IMG/M
3300012907Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S044-104R-1EnvironmentalOpen in IMG/M
3300012911Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S088-202R-2EnvironmentalOpen in IMG/M
3300012912Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S163-409C-2EnvironmentalOpen in IMG/M
3300012913Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S043-104R-2EnvironmentalOpen in IMG/M
3300012915Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S103-311B-2EnvironmentalOpen in IMG/M
3300012937Agricultural soil microbial communities from Tamara ranch near Red Deer, Alberta, Canada - d1t5i015EnvironmentalOpen in IMG/M
3300012943Backyard soil microbial communities from Emeryville, California, USA - Original compost - Back yard soil (BY)EnvironmentalOpen in IMG/M
3300012955Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_216_MGEnvironmentalOpen in IMG/M
3300012957Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_207_MGEnvironmentalOpen in IMG/M
3300012985Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_246_MGEnvironmentalOpen in IMG/M
3300012987Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_243_MGEnvironmentalOpen in IMG/M
3300012988Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_242_MGEnvironmentalOpen in IMG/M
3300013306Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaGHost-AssociatedOpen in IMG/M
3300014969Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaGHost-AssociatedOpen in IMG/M
3300015077Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S178-409R-2 (version 2)EnvironmentalOpen in IMG/M
3300015201Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S014-104B-1 (version 2)EnvironmentalOpen in IMG/M
3300015372Soil combined assemblyHost-AssociatedOpen in IMG/M
3300017965Populus adjacent soil microbial communities from riparian zone of Indian Creek, Utah, USA - 220 TEnvironmentalOpen in IMG/M
3300018432Populus adjacent soil microbial communities from riparian zone of Yellowstone River, Montana, USA - 550 TEnvironmentalOpen in IMG/M
3300018476Populus adjacent soil microbial communities from riparian zone of Yellowstone River, Montana, USA - 531 TEnvironmentalOpen in IMG/M
3300019362Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S104-311B-1 (version 2)EnvironmentalOpen in IMG/M
3300022906Plant litter microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-L223-509R-6EnvironmentalOpen in IMG/M
3300022911Plant litter microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-L064-202C-5EnvironmentalOpen in IMG/M
3300023272Plant litter microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-L171-409R-4EnvironmentalOpen in IMG/M
3300023275Plant litter microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-L199-509C-5EnvironmentalOpen in IMG/M
3300025925Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025935Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025945Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025981Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026089Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026118Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300027787Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Plitter (SPAdes)EnvironmentalOpen in IMG/M
3300028587Soil microbial communities from agricultural site in Penn Yan, New York, United States - 12C_Control_Day3EnvironmentalOpen in IMG/M
3300028589Soil microbial communities from agricultural site in Penn Yan, New York, United States - 13C_Glucose_Day1EnvironmentalOpen in IMG/M
3300028592Soil microbial communities from agricultural site in Penn Yan, New York, United States - 13C_Cellulose_Day30EnvironmentalOpen in IMG/M
3300028597Soil microbial communities from agricultural site in Penn Yan, New York, United States - 13C_Glucose_Day14EnvironmentalOpen in IMG/M
3300028704Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_379EnvironmentalOpen in IMG/M
3300028754Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_157EnvironmentalOpen in IMG/M
3300028790Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_122EnvironmentalOpen in IMG/M
3300028803Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_120EnvironmentalOpen in IMG/M
3300028812Soil microbial communities from agricultural site in Penn Yan, New York, United States - 13C_Vanillin_Day48EnvironmentalOpen in IMG/M
3300028876Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_140EnvironmentalOpen in IMG/M
3300028889Soil microbial communities from agricultural site in Penn Yan, New York, United States - 12C_Control_Day2EnvironmentalOpen in IMG/M
3300030336Soil microbial communities from agricultural site in Penn Yan, New York, United States - 12C_Control_Day1EnvironmentalOpen in IMG/M
3300030902Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_356 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300031092Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_367 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300031854Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C48D1EnvironmentalOpen in IMG/M
3300031938Soil microbial communities from UC Gill Tract Community Farm, Albany, California, United States - DLSLS.C.R1EnvironmentalOpen in IMG/M
3300031939Soil microbial communities from UC Gill Tract Community Farm, Albany, California, United States - DLSLS.P.R2EnvironmentalOpen in IMG/M
3300031940Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C24D2EnvironmentalOpen in IMG/M
3300031944Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T60D1EnvironmentalOpen in IMG/M
3300032000Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C0D3EnvironmentalOpen in IMG/M
3300032012Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C24D3EnvironmentalOpen in IMG/M
3300032074Soil microbial communities from UC Gill Tract Community Farm, Albany, California, United States - DLSLS.P.R1EnvironmentalOpen in IMG/M
3300032080Soil microbial communities from Southern Great Plains, Lamont, Oklahoma, United States - SGP_1_2016EnvironmentalOpen in IMG/M
3300032126Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2Host-AssociatedOpen in IMG/M
3300033551Soil microbial communities from agricultural site in Penn Yan, New York, United States - 12C_Control_Day5EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap



 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
Ga0063454_10116822723300004081SoilMPTRPVLILNPRDDVEFTGFAEAEVGAGASTAADLQLRLRERYPLANVRPRDLSSEQTSVWYVYREGHWVPSGG*
Ga0062593_10150621323300004114SoilMSTRPILILNPRDDTAFTGYAEELATASDLTPDDLQRRLRERYPLAAVRPRDLSSERTTVWYVYRDGHWVPRA*
Ga0062595_10239282213300004479SoilMSTRPILILNPRDDTAFTGYAEELATASDLTPDDLQRRLRERYPVAAVRPRDLSSERTTVWYVYRDGHWVPRA*
Ga0062592_10265210423300004480SoilGDARHGRLGPMSTRPILILNPRDDTAFTGYAEELATANDLTPDDLQRRLRERFPLAAVRPRDLSSERTTVWYVYRDGHWVPRA*
Ga0062591_10049142623300004643SoilMSTRPILILNPRDDTAFTGYAEELATANDLTPDDLQRRLRERYPLAAVRPRDLSSERTTVWYVYRDGHWVPRA*
Ga0062594_10171402523300005093SoilMSQRPVLILNPRDDTGFTAYAEQLVDSGALDARELQGKLRERYPLAVVRPRDLSSERTAVWYVYREGSWVPSTRIEEG*
Ga0070663_10087097823300005455Corn RhizosphereMSQQPVLILNPRDDTGFTAYAEELVEIGALDAQELQGKLRERYPLAVVRPRDLSSERTAVWYVYREGHWVPSTRIEES*
Ga0068867_10091770023300005459Miscanthus RhizosphereMSQRPVLILNPRDDNGFTAYAEELLDNGAPDAQELQGKLRERYPLAVVRPRDLSSERTAVWYVYREGSWVPSTRIEEG*
Ga0070693_10064560223300005547Corn, Switchgrass And Miscanthus RhizosphereMSTRPILILNPRDDTAFTGYADDLATADDLTPDDLQRRLRERYPLAAVRPRDLSSERTTVWYVYRDGHWVPRA*
Ga0070664_10201966923300005564Corn RhizosphereNPRDDTAFTGYAEDLATASDLTPDDLQRRLRERYPLAAVRPRDLSSERTTVWYVYRDGHWVPRA*
Ga0070664_10204480413300005564Corn RhizosphereMSQRPVLILNPRDDTGFTVYAEELVENGALDAQELQGKLRERYPLAIVRPRDLSSERTAVWYVYREGHWVPSTRIEES*
Ga0070702_10110686013300005615Corn, Switchgrass And Miscanthus RhizosphereLILNPRDDTGFTVYAEELVETVALDAQELQGKLRERYPLAVVRPRDLSSERTAVWYVYREGHWVPSTRIEES*
Ga0068852_10075012113300005616Corn RhizosphereNPRDDTAFTGYADDLATADDLTPDDLQRRLRERYPLAAVRPRDLSSERTTVWYVYRDGHWVPRA*
Ga0079222_1016793623300006755Agricultural SoilMTTRPVLILNPRDDAEFAGYAEELAGEGGLDAQELQGKLRGRYPKAVVRPRDLSSERTAIWYVYREGSWVPSARIEEG*
Ga0079222_1063689423300006755Agricultural SoilMTTRPVLILNPRDDTDFAGFAEELADTGGLDAEGLQGRLRGRYPKAVVRPRDLSSERTAVWYVYREGYWVPSTRAEET*
Ga0105243_1051031033300009148Miscanthus RhizosphereMSTRPILILNPRDDTAFTGYAEELATANDLTPDDLQRQLRERYPLAAVRPRDLSSERTTVWYVYRDGHWVPRA*
Ga0105249_1125690323300009553Switchgrass RhizosphereMSTRSILILNPRDDTAFTGYAEELATANDLTPDDLQRRLRERYPLAAVRPRDLSSERTTVWYVYRDGHWVPRA*
Ga0126307_1014937133300009789Serpentine SoilMPTRPLLILNPRDDTGFATFAETLVAEGAAAATSLEAQLRERYPRAAVRPRELSSERTVVWYVYRDGHWVPHRTTKEESA*
Ga0126307_1030870723300009789Serpentine SoilMPTRPVLILNPRDDTEFMVFAEDLVEEGAVDAPELQGKLRSRYSRAVVRPRDLSSERTAVWYVYREGYWVPSARSEEG*
Ga0126313_1125820313300009840Serpentine SoilMLPWNRWMPTRPVLILNPRDDAEFVVFAEDLVEHGTIDARELQGKLRTRYSKAVVRPRDLSSERTAVWYVYREGSWVPSTRREEG*
Ga0126305_1040070133300010036Serpentine SoilMSQRPVLILNPRDDTGFTAYAEELVVNGALDAQELQGKLRDRYPLAVVRPRDLSSERTAVWYVYREGFWVPSTRIEEG*
Ga0126304_1055161423300010037Serpentine SoilMPTRPLLILNPRDDTGFATFAETLVAEGAAAATSLEAQLRERYPRAAVRPRELSSERTVVWYVYRDWHWVPHRTTKEESA*
Ga0126312_1096632913300010041Serpentine SoilMPTRPLLILNPRDDTGFATFAETLVAEGAAAATSLEAQLRERYPRAAVRPRELSSERTVVWYVYRDGHWVPHRTTKEE*
Ga0126319_163383713300010147SoilLNPRDDTAFTGYAEELATASDLTPDDLQRRLRERYPLAAVRPRDLSSERTTVWYVYRDGHWVPRA*
Ga0126319_164918513300010147SoilMSTRPILILNPRDDTAFTGYAEDLATADDLTPDDLQRRLRERYPQAAVRPRDLSSERTTVWYVYRDGHWVPRA*
Ga0127503_1107961523300010154SoilILNPRDDTAFTGWAEELATASDLTPDDLQRLLRERYPLAAVRPRDLSSERTTVWYVYRDGHWVPRA*
Ga0126306_1044910723300010166Serpentine SoilMSQRPVLILNPRDDTGFTAYAEELVVNGALEAQELQGKLRDRYPLAVVRPRDLSSERTAVWYVYREGFWVPSTRIEEG*
Ga0126317_1059346513300011332SoilECGAREGPLHFMAIRPILILNPRDDPAFTGLAQELAAGGDLAPDDLQRRLREQYPLAAVRPRDLSSERTTVWYVYRDGRWVPRA*
Ga0126317_1099889413300011332SoilMSQRPVLILNPRDDTGFTAYAEELVVNALDAPELQGKLRARYPLAVVRPRDLSSERTAVWYVYREGFWVPSIRTEEG*
Ga0150985_10006208013300012212Avena Fatua RhizosphereILILNPRDDPAFTGLAQELAGGGDLAPDDLQRRLREQYPLAAVRPRDLSSERTTVWYVYRDGRWVPRA*
Ga0150985_11325611113300012212Avena Fatua RhizosphereFMAIRPILILNPRDDPAFTGLAQELAGGGDLAPDDLQRRLREQYPLAAVRPRDLSSERTTVWYVYRDGRWVPRA*
Ga0150984_10743383413300012469Avena Fatua RhizosphereMTTRPVLILNPRDDPDFAAFAEELAVDGGLDAPGLQGRLRGRYPKAVVRPRDLSSERTAVWYVYREGMWVPSARTEGS*
Ga0150984_11331649433300012469Avena Fatua RhizosphereGRLHFMATRPILILNPRDDSAFTGLAQQLAAGGDLAPDDLQRRLREQYPLAAVRPRDLSSERTTVWYVYRDGRWVPRA*
Ga0157305_1029296413300012891SoilMSSRPILILNPRDDTAFTGFAEELATTTDLTPEALQRQLRERYPLAAVRPRDLSSERTTVWYVYRDGHWVPRA*
Ga0157309_1026351013300012895SoilMSTRPILILNPRDDAAFTGYAEELATANDLTPDDLQRRLRERYPLAAVRPRDLSSERTTVWYVYRDGHWVPRA*
Ga0157303_1009738523300012896SoilMSTRPILILNPRDDTAFTGYAEELATANDLTPDDLQRRLRERFPLAAVRPRDLSSERTTVWYVYRDGHWVPRA*
Ga0157293_1008206613300012898SoilILILNPRDDTAFTGYAEELATASDLTPDDLQRRLRERYPLAAVRPRDLSSERTTVWYVYRDGHWVPRA*
Ga0157293_1028823223300012898SoilMSQRQVLILNPRDDNGFAAYAEELVDNGALDAQELQGKLRERYPLAVVRPRDLSSERTAVWYVYREGFWVPSTRIEEG*
Ga0157292_1018790733300012900SoilRWMSQQPVLILNPRDDNGFAAYAEELVDNGALDAQELQGKLRERYPLAVVRPRDLSSERTAVWYVYREGSWVPSTRIEEG*
Ga0157289_1035450213300012903SoilMSTRPILILNPRDDTAFTGYAEDLATASDLTPDDLQRRLRERYPLAAVRPRDLSSERTTVWYVYRDGHWVPRAGPP
Ga0157283_1038216223300012907SoilMSQRPVLILNPRDDTGFTVYAEELVENGALDAQELQGKLRERYPLAVVRPRDLSSERTAVWYVYREGSWVPSTRIEES*
Ga0157301_1035609123300012911SoilMSQQPVLILNPRDDNGFAAYAEELVDNGALDAQELQGKLRERYPLAVVRPRDLSSERTAVWYVYREGSWVPSTRIEEG*
Ga0157306_1009808723300012912SoilMSQRPVLILNPRDDTGFTAHAEELVDHGVLDARELQGKLRERYPLAVVRPRDLSSERTAVWYVYREGSWVPSTRIEEG*
Ga0157298_1017247923300012913SoilMSTRPILILNPRDDTAFTGYAEELATASDLTPDDLQRRLRERYPLAAVRPRDLSSERTTVWYVYRDGHWVPRAGPPVEEEQR*
Ga0157302_1004336133300012915SoilRHGRLETMSTRPILILNPRDDTAFTGYAEELATASDLTPDDLQRRLRERYPLAAVRPRDLSSERTTVWYVYRDGHWVPRA*
Ga0162653_10006827113300012937SoilLNPRDDTGFTAYAEELVVNGALDAQELQGKLRERYPLAVVRPRDLSSERTAVWYVYREGFWVPSTRIEEG*
Ga0164241_1012738333300012943SoilMSQRPVLILNPRDDTGFTAYAEALVVEGALDAPELQGKLRERYPLAVVRPRDLSSESTAVWYVYREGFWVPSTRIEEG*
Ga0164298_1024169633300012955SoilMSNRPILILNPRDDTTFTGYAEELATAGDLTPDDLQRLLRERYPLAAVRPRDLSSERTTVWYVYRDGHWVPRA*
Ga0164303_1138245423300012957SoilMSTRPILILNPRDDTAFTGYAEELATANDLTPDDLQRLLRERYPLAAVRPRDLSSERATVWYVYRDGHWVPRA*
Ga0164308_1020810213300012985SoilGRLEAMSNRPILILNPRDDTTFTGYAEELASAGDLTPDDLQRLLRERYPLAAVRPRDLSSERTTVWYVYRDGHWVPRA*
Ga0164308_1056276423300012985SoilMPTRPILILNPRDDTAFTGYADDLATADDLTPDDLQRRLRERYPLAAVRPRDLSSERTTVWYVYRDGHWVPRA*
Ga0164307_1007050313300012987SoilMSNRPILILNPRDDTTFTGYAEELATAGDLTPDDLQRRLRERYPQAAVRPRDLSSERTTVWYVYRDGHWVPRA*
Ga0164306_1043423513300012988SoilDTTFTGYAEELASAGDLTPDDLQRLLRERYPLAAVRPRDLSSERTTVWYVYRDGHWVPRA
Ga0163162_1182651013300013306Switchgrass RhizosphereILNPRDDTAFTGYAEELATASDLTPDDLQRRLRERYPLAAVRPRDLSSERTTVWYVYRDGHWVPRA*
Ga0157376_1205799913300014969Miscanthus RhizosphereVAVNASATPIAVAWRLRARSPPATLATDDLEPMSTRPILILNPRDDAAFTGYAEELATASDLTPDDLQRRLRERYPLAAVRPRDLSSERTTVWYVYRDGHWVPRA*
Ga0173483_1025768413300015077SoilRLETMSTRPILILNPRDDTAFTGYAEELATASDLTPDDLQRRLRERYPLAAVRPRDLSSERTTVWYVYRDGHWVPRA*
Ga0173478_1069830313300015201SoilMSQRPVLILNPRDDTGFTVYAEELVENGALDAQELQGKLRERYPLAVVRPRDLSSERTAVWYVYREGSWVPSTRIEEG*
Ga0132256_10247544813300015372Arabidopsis RhizosphereMSTRPILILNPRDDTTFTGYAEKLATASDLTPDDLQRLLRERYPLAAVRPRDLSSERTTVWYVYRDGHWVPRA*
Ga0190266_1000367543300017965SoilMSTRPILILNPRDDTAFTGYAEELATASDLTPDDLQRQLRERYPLAAVRPRDLSSERTTVWYVYRDGHWVPRA
Ga0190275_1109953223300018432SoilMFQRPVLILNPRDDTGFTAYAEELVVEGALDAPELQGKLRERYPLAVVRPRDLSSERTAVWYVYREGFWVPSTRIEEG
Ga0190274_1002717823300018476SoilMSQQPVLILNPRDDNGFAAYAEELVDNGALDAQELQGKLRERYPLAVVRPRDLSSERTAVWYVYREGSWVPSTRIEEG
Ga0190274_1157023023300018476SoilMSSRPILILNPRDDTAFTGFAEELVTTDELTPDALQRQLRERYPLAAVRPRDLSSERTTVWYVYRDGHWVPRA
Ga0173479_1011370623300019362SoilMSTRPILILNPRDDTAFTGYAEELATASDLTPDDLQRRLRERYPLAAVRPRDLSSERTTVWYVYRDGHWVPRA
Ga0247766_104284623300022906Plant LitterMSTRPILILNPRDDTAFTGYAEELATANDLTPDDLQRRLRERYPLAAVRPRDLSSERTTVWYVYRDGHWVPRA
Ga0247783_126178723300022911Plant LitterQLLDTAFTGYAEELATASDLTPDDLQRRLRERYPLAAVRPRDLSSERTTVWYVYRDGHWVPRA
Ga0247760_107029613300023272Plant LitterTDDLEPMSTRPILILNPRDDAAFTGYAEELATANDLTPDDLQRRLRERYPLAAVRPRDLSSERTTVWYVYRDGHWVPRA
Ga0247776_1021309123300023275Plant LitterMLALDEIWMSQRPVLILNPRDDAGFTVYAEELVENGALDAQELQGKLRERYPLAVVRPRDLSSERTAVWYVYREGSWVPSTRIEEG
Ga0207650_1192085623300025925Switchgrass RhizosphereQPPGDARHGRLETMSTRPILILNPRDDTAFTGYAEELATASDLTPDDLQRRLRERYPLAAVRPRDLSSERTTVWYVYRDGHWVPRA
Ga0207709_1075315023300025935Miscanthus RhizosphereMSTRPILILNPRDDTAFTGYAEELATANDLTPDDLQRRLRERFPLAAVRPRDLSSERTTVWYVYRDGHWVPRA
Ga0207679_1217166923300025945Corn RhizosphereRRWMSQQPVLILNPRDDTGFTAYAEELVEIGALDAQELQGKLRERYPLAIVRPRDLSSERTAVWYVYREGHWVPSTRIEES
Ga0207640_1085264923300025981Corn RhizosphereMSQQPVLILNPRDDTGFTAYAEELVEIGALDAQELQGKLRERYPLAVVRPRDLSSERTAVWYVYREGSWVPSTRIEEG
Ga0207648_1120548823300026089Miscanthus RhizosphereMSQRPVLILNPRDDNGFTAYAEELVDNGALDAQELQGKLRERYPLAVVRPRDLSSERTAVWYVYREGSWVPSTRIEEG
Ga0207675_10263676423300026118Switchgrass RhizosphereMSQRPVLILNPRDDTGFTVYAEELVETVALDAQELQGKLRERYPLAVVRPRDLSSERTAVWYVYREGSWVPSTRIEEG
Ga0209074_1005810023300027787Agricultural SoilMTTRPVLILNPRDDAEFAGYAEELAGEGGLDAQELQGKLRGRYPKAVVRPRDLSSERTAIWYVYREGSWVPSARIEEG
Ga0247828_1073540523300028587SoilMSQRPVLILNPRDDTGFTAHAEELVDNGVLDARELQGKLRERYPLAVVRPRDLSSERTAVWYVYREGSWVP
Ga0247818_1116135813300028589SoilMSQRPVLILNPRDDTGFTAHAEELVDNGVLDARELQGKLRERYPLAVVRPRDLSSERTAVWYVYREGSWVPGTRIEEG
Ga0247822_1028512613300028592SoilMSQRPVLILNPRDDTGFTAHAEELVDNGVLDARELQGKLRERYPLAVVRPRDLSSERTAVWYVYREGSWVPSTRIEEG
Ga0247820_1092005223300028597SoilMSTRPILILNPRHDTAFTGYAEELATASDLTPDDLQRQLRERYPLAAVRPRDLSSERTTVWYVYRDGHWVPRA
Ga0307321_110172613300028704SoilSPAPGDARPGRSWMSQRPVLILNPRDDTGFTAYAEELVINALDAQELQGKLRERYPLAVVRPRDLSSERTAVWYVYREGFWVPSTRIEEG
Ga0307297_1017423023300028754SoilGPMSTRPILILNPRDDTAFTGYAEELATANDLTPDDLQRRLRERYPLAAVRPRDLSSERTTVWYVYRDGHWVPRA
Ga0307283_1004536523300028790SoilMSTRPILILNPRDDTAFTGYAEDLATASDLTPDDLQRRLRERYPLAAVRPRDLSSERTTVWYVYRDGHWVPRA
Ga0307281_1026379223300028803SoilMSTRPILILNPRDDTAFTRYAEELAAAGFLTPDALQRGLRERYPNAAVRPRDLSSERTTVWYVYRDGHWVPRA
Ga0247825_1046754023300028812SoilMSQRPVLILNPRDDNGFAAYAEELVDIGALDAQELQGKLRGRYPLAVVRPRDLSSERTAVWYVYREGSWVPSTRIEEG
Ga0307286_1028655223300028876SoilMSTRPILILNPRDDAAFTGYAEELATANDLTPDDLQRRLRERYPLAAVRPRDLSSERTTVWYVYRDGHWVPRA
Ga0247827_1093531213300028889SoilMSQRPVLILNPRDDTGFTAHAEELVDHGVLDARELQGKLRERYPLAVVRPRDLSSERTAAWYVY
Ga0247826_1034615823300030336SoilMSQRPVLILNPRDDTGFTVYAEELVENGALDAQELQGKLRERYPLAVVRPRDLSSERTAVWYVYREGFWVPSTRILEG
Ga0247826_1053802223300030336SoilMSSRPILILNPRDDTAFTGFAEELVTTTDLTPDALQRQLRERYPLAAVRPRDLSSERTTVWYVYRDGHWVPRA
Ga0247826_1067304123300030336SoilMSQRPVLILNPRDDTGFTAHAEELVDNGVLDARELQGKLRERYPLAVVRPRDLSSERTAVWYVYREGS
Ga0308202_113033023300030902SoilSPPATLATDDLEPMSTRPILILNPRDDAAFTGYAEELATANDLTPDDLQRRLRERYPLAAVRPRDLSSERTTVWYVYRDGHWVPRA
Ga0308204_1015726013300031092SoilLNPRDDTAFIGYAEDLATVVDLTPDELQRRLRERYPLAAVRPRDLSSEQTTVWYVYRDGQWVPRA
Ga0310904_1025837733300031854SoilMSQRPVLILNPRDDTGFTAHAEELVDHGVLDARELQGKLRERYPLAVVRPRDLSSERTAVWYVYREGAWVPSTRVEEG
Ga0308175_10179667323300031938SoilMSTRPVLILNPRDDATFTGYAEELATAVGLTPEALQHRLRERYPQAAVRPRDLSSERTTVWYVYRDGHWVPAHDPQ
Ga0308175_10232599623300031938SoilRFRCGGMSAQPVLILNPRDDMMFISLSESLVANENLTPVELQQRLRERYPMATVRPRDLSSERTTVWYVYRDGHWVPATKSEEG
Ga0308174_1109816123300031939SoilMPTRPVLILNPRDDVEFTGFAEALLGAGASTAAELQGRLRERYPLANVRPRDLSSEQTAVWYVYREGHWVPSGG
Ga0310901_1014004933300031940SoilMSQRPVLILNPRDDTGFTVYAEELVENGALDAQELQGKLRERYPLAVVRPRDLSSERTAVWYVYREGSWVPSTRIEEG
Ga0310884_1040679723300031944SoilMSQRPVLILNPRDDTGFTAHAEELVDNGVLDARELQGKLRERYPLAVVRPRDLSSERTAVWYVYREGAWVPSTRVEEG
Ga0310903_1070447513300032000SoilMSQRPVLILNPRDDTGFTAHAEELVDHGVLDARELQGKLRERYPLAVVRPRDLSSERTAVWYVYREGSWVPSTRIEEG
Ga0310902_1134041913300032012SoilPRRCSPWTNIWMSQRPVLILNPRDDTGFTVYAEELVENGALDARELQGKLRERYPLAVVRPRDLSSERTAVWYVYREGSWVPSTRIEEG
Ga0308173_1070326013300032074SoilMPTRPVLILNPRDDVEFTGFAEAEVGAGASTAADLQSRLRERYPLANVRPRDLSSEQTAVWYVYREGH
Ga0326721_1104577313300032080SoilMSQRPVLILNPRDDTGFTAYAEELVVNALDAPELQGKLRERYPLAVVRPRDLSSERTAVWYVYREGFWVPSTRIEEG
Ga0307415_10168944213300032126RhizosphereALDELWMSQRPVLILNPRDDNAFSAHAEELVDNGALDAQELQGKLRERYPLAVVRPRDLSSERTAVWYVYREGSWVPSTRIEEG
Ga0247830_1066676523300033551SoilMSQRPVLILNPRDDTGFTAYAEELVVAGALDAPELQGKLRERYPLAVVRPRDLSSERTAVWYVYREGFWVPSTRIEEG


 ⦗Top⦘


© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.