| Basic Information | |
|---|---|
| Family ID | F100896 |
| Family Type | Metagenome |
| Number of Sequences | 102 |
| Average Sequence Length | 47 residues |
| Representative Sequence | MKRRDAVQLLAVAPLTAAFRWAPESVREASARAREALARGAPYEPKQF |
| Number of Associated Samples | 87 |
| Number of Associated Scaffolds | 102 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | No |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 98.04 % |
| % of genes near scaffold ends (potentially truncated) | 97.06 % |
| % of genes from short scaffolds (< 2000 bps) | 86.27 % |
| Associated GOLD sequencing projects | 81 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.48 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (55.882 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil (29.412 % of family members) |
| Environment Ontology (ENVO) | Unclassified (47.059 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (54.902 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | Yes | Secondary Structure distribution: | α-helix: 44.74% β-sheet: 0.00% Coil/Unstructured: 55.26% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.48 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 102 Family Scaffolds |
|---|---|---|
| PF05199 | GMC_oxred_C | 86.27 |
| PF07676 | PD40 | 3.92 |
| PF01261 | AP_endonuc_2 | 2.94 |
| PF00764 | Arginosuc_synth | 0.98 |
| PF13618 | Gluconate_2-dh3 | 0.98 |
| PF13798 | PCYCGC | 0.98 |
| PF14279 | HNH_5 | 0.98 |
| COG ID | Name | Functional Category | % Frequency in 102 Family Scaffolds |
|---|---|---|---|
| COG2303 | Choline dehydrogenase or related flavoprotein | Lipid transport and metabolism [I] | 86.27 |
| COG0137 | Argininosuccinate synthase | Amino acid transport and metabolism [E] | 0.98 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 55.88 % |
| Unclassified | root | N/A | 44.12 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300001661|JGI12053J15887_10219878 | Not Available | 956 | Open in IMG/M |
| 3300002561|JGI25384J37096_10145581 | Not Available | 762 | Open in IMG/M |
| 3300004781|Ga0062379_10145940 | Not Available | 591 | Open in IMG/M |
| 3300005172|Ga0066683_10326482 | Not Available | 954 | Open in IMG/M |
| 3300005177|Ga0066690_10552552 | Not Available | 771 | Open in IMG/M |
| 3300005178|Ga0066688_10119020 | Not Available | 1631 | Open in IMG/M |
| 3300005180|Ga0066685_10692578 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes | 699 | Open in IMG/M |
| 3300005439|Ga0070711_101731417 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 548 | Open in IMG/M |
| 3300005440|Ga0070705_100008919 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae → Gemmatirosa → Gemmatirosa kalamazoonesis | 4973 | Open in IMG/M |
| 3300005440|Ga0070705_101941165 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes | 501 | Open in IMG/M |
| 3300005447|Ga0066689_10126399 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1497 | Open in IMG/M |
| 3300005447|Ga0066689_10827604 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes | 574 | Open in IMG/M |
| 3300005450|Ga0066682_10679703 | Not Available | 635 | Open in IMG/M |
| 3300005454|Ga0066687_10061683 | All Organisms → cellular organisms → Bacteria | 1785 | Open in IMG/M |
| 3300005467|Ga0070706_100968997 | Not Available | 785 | Open in IMG/M |
| 3300005471|Ga0070698_102158760 | Not Available | 510 | Open in IMG/M |
| 3300005536|Ga0070697_100254480 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1502 | Open in IMG/M |
| 3300005540|Ga0066697_10639301 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes | 587 | Open in IMG/M |
| 3300005542|Ga0070732_10043748 | All Organisms → cellular organisms → Bacteria | 2577 | Open in IMG/M |
| 3300005546|Ga0070696_100108360 | Not Available | 1998 | Open in IMG/M |
| 3300005546|Ga0070696_100839445 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes | 758 | Open in IMG/M |
| 3300005546|Ga0070696_101619381 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes | 556 | Open in IMG/M |
| 3300005554|Ga0066661_10706531 | Not Available | 592 | Open in IMG/M |
| 3300005560|Ga0066670_10023606 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 2901 | Open in IMG/M |
| 3300005568|Ga0066703_10057951 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 2188 | Open in IMG/M |
| 3300005574|Ga0066694_10033599 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 2299 | Open in IMG/M |
| 3300005574|Ga0066694_10585157 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes | 520 | Open in IMG/M |
| 3300005586|Ga0066691_10533067 | All Organisms → cellular organisms → Bacteria | 700 | Open in IMG/M |
| 3300006032|Ga0066696_10053692 | All Organisms → cellular organisms → Bacteria | 2273 | Open in IMG/M |
| 3300006755|Ga0079222_11837770 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes | 588 | Open in IMG/M |
| 3300006796|Ga0066665_10456513 | All Organisms → cellular organisms → Bacteria | 1053 | Open in IMG/M |
| 3300006796|Ga0066665_10697393 | Not Available | 804 | Open in IMG/M |
| 3300006796|Ga0066665_11404466 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes | 540 | Open in IMG/M |
| 3300006806|Ga0079220_10018064 | All Organisms → cellular organisms → Bacteria | 2914 | Open in IMG/M |
| 3300006854|Ga0075425_100305623 | Not Available | 1830 | Open in IMG/M |
| 3300006904|Ga0075424_100284090 | Not Available | 1760 | Open in IMG/M |
| 3300009012|Ga0066710_100574561 | Not Available | 1708 | Open in IMG/M |
| 3300009088|Ga0099830_10850854 | Not Available | 753 | Open in IMG/M |
| 3300009089|Ga0099828_10742369 | Not Available | 881 | Open in IMG/M |
| 3300009090|Ga0099827_11608536 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes | 566 | Open in IMG/M |
| 3300009090|Ga0099827_11949039 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes | 511 | Open in IMG/M |
| 3300009137|Ga0066709_103139587 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes | 603 | Open in IMG/M |
| 3300009143|Ga0099792_11101214 | Not Available | 535 | Open in IMG/M |
| 3300010303|Ga0134082_10033527 | Not Available | 1936 | Open in IMG/M |
| 3300010320|Ga0134109_10027005 | Not Available | 1802 | Open in IMG/M |
| 3300010321|Ga0134067_10405494 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes | 547 | Open in IMG/M |
| 3300010325|Ga0134064_10273066 | Not Available | 634 | Open in IMG/M |
| 3300010329|Ga0134111_10352261 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes | 622 | Open in IMG/M |
| 3300010329|Ga0134111_10511045 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes | 528 | Open in IMG/M |
| 3300010335|Ga0134063_10058523 | All Organisms → cellular organisms → Bacteria | 1696 | Open in IMG/M |
| 3300010361|Ga0126378_12568856 | Not Available | 582 | Open in IMG/M |
| 3300010373|Ga0134128_12969866 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes | 522 | Open in IMG/M |
| 3300012189|Ga0137388_11233137 | Not Available | 686 | Open in IMG/M |
| 3300012189|Ga0137388_11923707 | Not Available | 521 | Open in IMG/M |
| 3300012199|Ga0137383_10797726 | All Organisms → cellular organisms → Bacteria | 689 | Open in IMG/M |
| 3300012200|Ga0137382_10032544 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae | 3130 | Open in IMG/M |
| 3300012200|Ga0137382_11344646 | All Organisms → cellular organisms → Bacteria | 503 | Open in IMG/M |
| 3300012201|Ga0137365_10155626 | All Organisms → cellular organisms → Bacteria | 1715 | Open in IMG/M |
| 3300012202|Ga0137363_11510921 | Not Available | 563 | Open in IMG/M |
| 3300012205|Ga0137362_11476024 | Not Available | 566 | Open in IMG/M |
| 3300012208|Ga0137376_11512657 | Not Available | 562 | Open in IMG/M |
| 3300012211|Ga0137377_10370103 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1370 | Open in IMG/M |
| 3300012285|Ga0137370_10571750 | Not Available | 696 | Open in IMG/M |
| 3300012357|Ga0137384_10064234 | Not Available | 3044 | Open in IMG/M |
| 3300012360|Ga0137375_11289315 | Not Available | 552 | Open in IMG/M |
| 3300012532|Ga0137373_10656963 | Not Available | 785 | Open in IMG/M |
| 3300012917|Ga0137395_10758415 | Not Available | 702 | Open in IMG/M |
| 3300012927|Ga0137416_10299525 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 1332 | Open in IMG/M |
| 3300012930|Ga0137407_11015092 | Not Available | 786 | Open in IMG/M |
| 3300012944|Ga0137410_10157611 | Not Available | 1734 | Open in IMG/M |
| 3300014150|Ga0134081_10030393 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1562 | Open in IMG/M |
| 3300014150|Ga0134081_10402476 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes | 514 | Open in IMG/M |
| 3300014157|Ga0134078_10191095 | All Organisms → cellular organisms → Bacteria | 830 | Open in IMG/M |
| 3300015052|Ga0137411_1235298 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 1163 | Open in IMG/M |
| 3300018431|Ga0066655_10718949 | Not Available | 677 | Open in IMG/M |
| 3300018431|Ga0066655_11085723 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes | 559 | Open in IMG/M |
| 3300018433|Ga0066667_11412781 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes | 612 | Open in IMG/M |
| 3300020170|Ga0179594_10293703 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 615 | Open in IMG/M |
| 3300025327|Ga0209751_10907903 | Not Available | 676 | Open in IMG/M |
| 3300025906|Ga0207699_10336899 | Not Available | 1062 | Open in IMG/M |
| 3300025910|Ga0207684_10847869 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes | 770 | Open in IMG/M |
| 3300025939|Ga0207665_10006063 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae → Gemmatirosa → Gemmatirosa kalamazoonesis | 8028 | Open in IMG/M |
| 3300026296|Ga0209235_1003925 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae → Gemmatirosa → Gemmatirosa kalamazoonesis | 8294 | Open in IMG/M |
| 3300026318|Ga0209471_1000849 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae | 19061 | Open in IMG/M |
| 3300026318|Ga0209471_1091766 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1326 | Open in IMG/M |
| 3300026322|Ga0209687_1146268 | Not Available | 761 | Open in IMG/M |
| 3300026325|Ga0209152_10027201 | All Organisms → cellular organisms → Bacteria | 1960 | Open in IMG/M |
| 3300026328|Ga0209802_1074376 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1595 | Open in IMG/M |
| 3300026330|Ga0209473_1251844 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes | 608 | Open in IMG/M |
| 3300026523|Ga0209808_1003840 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae → Gemmatirosa → Gemmatirosa kalamazoonesis | 7683 | Open in IMG/M |
| 3300026538|Ga0209056_10289681 | Not Available | 1137 | Open in IMG/M |
| 3300026540|Ga0209376_1020883 | All Organisms → cellular organisms → Bacteria | 4355 | Open in IMG/M |
| 3300026540|Ga0209376_1290032 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes | 656 | Open in IMG/M |
| 3300026542|Ga0209805_1348457 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes | 564 | Open in IMG/M |
| 3300026700|Ga0208474_102588 | Not Available | 552 | Open in IMG/M |
| 3300027013|Ga0209884_1015663 | Not Available | 745 | Open in IMG/M |
| 3300027633|Ga0208988_1131518 | Not Available | 609 | Open in IMG/M |
| 3300027725|Ga0209178_1192120 | Not Available | 720 | Open in IMG/M |
| 3300027882|Ga0209590_10173461 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1351 | Open in IMG/M |
| 3300027950|Ga0209885_1016966 | Not Available | 773 | Open in IMG/M |
| 3300031577|Ga0316602_10102878 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes | 508 | Open in IMG/M |
| 3300031720|Ga0307469_11321810 | Not Available | 685 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 29.41% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 25.49% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 11.76% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 9.80% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 6.86% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 2.94% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 1.96% |
| Groundwater Sand | Environmental → Terrestrial → Soil → Sand → Unclassified → Groundwater Sand | 1.96% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 1.96% |
| Wetland Sediment | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Wetland Sediment | 0.98% |
| Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 0.98% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 0.98% |
| Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 0.98% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 0.98% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 0.98% |
| Soil | Environmental → Terrestrial → Soil → Loam → Grasslands → Soil | 0.98% |
| Soil | Environmental → Terrestrial → Soil → Loam → Unclassified → Soil | 0.98% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300001661 | Mediterranean Blodgett CA OM1_O3 (Mediterranean Blodgett coassembly) | Environmental | Open in IMG/M |
| 3300002561 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 09_25_2013_1_40cm | Environmental | Open in IMG/M |
| 3300004781 | Wetland sediment microbial communities from St. Louis River estuary, USA, under dissolved organic matter induced mercury methylation - T0Bare2Fresh | Environmental | Open in IMG/M |
| 3300005172 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_132 | Environmental | Open in IMG/M |
| 3300005177 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_139 | Environmental | Open in IMG/M |
| 3300005178 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_137 | Environmental | Open in IMG/M |
| 3300005180 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_134 | Environmental | Open in IMG/M |
| 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Environmental | Open in IMG/M |
| 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Environmental | Open in IMG/M |
| 3300005447 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_138 | Environmental | Open in IMG/M |
| 3300005450 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_131 | Environmental | Open in IMG/M |
| 3300005454 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_136 | Environmental | Open in IMG/M |
| 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Environmental | Open in IMG/M |
| 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Environmental | Open in IMG/M |
| 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Environmental | Open in IMG/M |
| 3300005540 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_146 | Environmental | Open in IMG/M |
| 3300005542 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen04_05102014_R1 | Environmental | Open in IMG/M |
| 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Environmental | Open in IMG/M |
| 3300005554 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_110 | Environmental | Open in IMG/M |
| 3300005560 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_119 | Environmental | Open in IMG/M |
| 3300005568 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_152 | Environmental | Open in IMG/M |
| 3300005574 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_143 | Environmental | Open in IMG/M |
| 3300005586 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_140 | Environmental | Open in IMG/M |
| 3300006032 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_145 | Environmental | Open in IMG/M |
| 3300006755 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Plitter | Environmental | Open in IMG/M |
| 3300006796 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_114 | Environmental | Open in IMG/M |
| 3300006806 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS100 | Environmental | Open in IMG/M |
| 3300006854 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD4 | Host-Associated | Open in IMG/M |
| 3300006904 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD3 | Host-Associated | Open in IMG/M |
| 3300009012 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_159 | Environmental | Open in IMG/M |
| 3300009088 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H3.8 metaG | Environmental | Open in IMG/M |
| 3300009089 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H1.8 metaG | Environmental | Open in IMG/M |
| 3300009090 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaG | Environmental | Open in IMG/M |
| 3300009137 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_158 | Environmental | Open in IMG/M |
| 3300009143 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_2 | Environmental | Open in IMG/M |
| 3300010303 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_5_09182015 | Environmental | Open in IMG/M |
| 3300010320 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_2_11112015 | Environmental | Open in IMG/M |
| 3300010321 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_5_09212015 | Environmental | Open in IMG/M |
| 3300010325 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_20cm_2_0_1 metaG | Environmental | Open in IMG/M |
| 3300010329 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_2_11112015 | Environmental | Open in IMG/M |
| 3300010335 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_5_09082015 | Environmental | Open in IMG/M |
| 3300010361 | Tropical forest soil microbial communities from Panama - MetaG Plot_23 | Environmental | Open in IMG/M |
| 3300010373 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-4 | Environmental | Open in IMG/M |
| 3300012189 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4A metaG | Environmental | Open in IMG/M |
| 3300012199 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_40_16 metaG | Environmental | Open in IMG/M |
| 3300012200 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_20_16 metaG | Environmental | Open in IMG/M |
| 3300012201 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_40_16 metaG | Environmental | Open in IMG/M |
| 3300012202 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_115_16 metaG | Environmental | Open in IMG/M |
| 3300012205 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_100_16 metaG | Environmental | Open in IMG/M |
| 3300012208 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_20_16 metaG | Environmental | Open in IMG/M |
| 3300012211 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_40_16 metaG | Environmental | Open in IMG/M |
| 3300012285 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_20_16 metaG | Environmental | Open in IMG/M |
| 3300012357 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_60_16 metaG | Environmental | Open in IMG/M |
| 3300012360 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_113_16 metaG | Environmental | Open in IMG/M |
| 3300012532 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_80_16 metaG | Environmental | Open in IMG/M |
| 3300012917 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czobulk2.16 metaG | Environmental | Open in IMG/M |
| 3300012927 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012930 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_2_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012944 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300014150 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Met_20cm_5_24_1 metaG | Environmental | Open in IMG/M |
| 3300014157 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Met_20cm_2_24_1 metaG | Environmental | Open in IMG/M |
| 3300015052 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_16fungal (PacBio error correction) | Environmental | Open in IMG/M |
| 3300018431 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_104 | Environmental | Open in IMG/M |
| 3300018433 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_116 | Environmental | Open in IMG/M |
| 3300020170 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad1_1_08_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300025327 | Soil microbial communities from Rifle, Colorado - Rifle CSP2_sed 13_1 (SPAdes) | Environmental | Open in IMG/M |
| 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300026296 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 09_25_2013_1_20cm (SPAdes) | Environmental | Open in IMG/M |
| 3300026318 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_128 (SPAdes) | Environmental | Open in IMG/M |
| 3300026322 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_136 (SPAdes) | Environmental | Open in IMG/M |
| 3300026325 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_107 (SPAdes) | Environmental | Open in IMG/M |
| 3300026328 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_129 (SPAdes) | Environmental | Open in IMG/M |
| 3300026330 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_133 (SPAdes) | Environmental | Open in IMG/M |
| 3300026523 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_157 (SPAdes) | Environmental | Open in IMG/M |
| 3300026538 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_114 (SPAdes) | Environmental | Open in IMG/M |
| 3300026540 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_134 (SPAdes) | Environmental | Open in IMG/M |
| 3300026542 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_148 (SPAdes) | Environmental | Open in IMG/M |
| 3300026700 | Grasslands soil microbial communities from Chapel Hill, North Carolina, USA that are Nitrogen fertilized -NN350 (SPAdes) | Environmental | Open in IMG/M |
| 3300027013 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW N3_30_40 (SPAdes) | Environmental | Open in IMG/M |
| 3300027633 | Forest soil microbial communities from El Dorado National Forest, California, USA - Mediterranean Blodgett CA Ref_M1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027725 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS200 (SPAdes) | Environmental | Open in IMG/M |
| 3300027882 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027950 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW S3_40_50 (SPAdes) | Environmental | Open in IMG/M |
| 3300031577 | Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_soil_day10_CT | Environmental | Open in IMG/M |
| 3300031720 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM2C_515 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| JGI12053J15887_102198781 | 3300001661 | Forest Soil | MKRRDAVQLLAVAPLATAFRWTPESVRDASARARDAL |
| JGI25384J37096_101455811 | 3300002561 | Grasslands Soil | MKRRDAVHLXAVAPLAAAFRWAPESVREASALAREALERAAPY |
| Ga0062379_101459402 | 3300004781 | Wetland Sediment | MQRREAVRVLAVAPLAAAFRWAPESVRQAAVQTRAALARGAPYEPS |
| Ga0066683_103264822 | 3300005172 | Soil | MADMNRREVVGLIAAAPLAAAFPWTAELVREASARAREALARGTPYEPK |
| Ga0066690_105525522 | 3300005177 | Soil | MADMNRREVIGLIAAAPLAAAFPWTAESVREASARAREALARG |
| Ga0066688_101190201 | 3300005178 | Soil | MKRRDAVHLFAVAPLAAAFRWAPESVREASALAREALERAAPY |
| Ga0066685_106925781 | 3300005180 | Soil | MADMNRREVVGLIAAAPLAAAFRWTPESVREASARVREALARGIPYEPKQFT |
| Ga0070711_1017314171 | 3300005439 | Corn, Switchgrass And Miscanthus Rhizosphere | MKRRDAVRVLAMAPVAAAFRWTPESVREASARAREALARSTPYEP |
| Ga0070705_1000089195 | 3300005440 | Corn, Switchgrass And Miscanthus Rhizosphere | MTDLNRREAIALLTAAPLAAGFPWTAESVRKASARAREALAHGTAYEPKQFTPHE |
| Ga0070705_1019411651 | 3300005440 | Corn, Switchgrass And Miscanthus Rhizosphere | MADMNRREVIGLIAGAPLAAGFPWTAESVRKASARAREALAHGTAYEPKQFTPHE |
| Ga0066689_101263991 | 3300005447 | Soil | MADMNRREVVGLIAGAPLAAGFPWAAESVREASARAREAL |
| Ga0066689_108276043 | 3300005447 | Soil | MADMNRREVIGLIAGAPLAAGFPWTAESVREASARAREALARGTPYEPKQFT |
| Ga0066682_106797032 | 3300005450 | Soil | MKRRDAVRTLAVAPLAAAFRWTPESVREASARAREALARG |
| Ga0066687_100616832 | 3300005454 | Soil | MDRRNAVQLLVIGPVAAAFRWAPESVREAAALARETLQRGVPYEPKQFTA |
| Ga0070706_1009689971 | 3300005467 | Corn, Switchgrass And Miscanthus Rhizosphere | MERRDAVQLLTMAPLAAAFSWTPDSIREASARAREALARGTPYQPKRF |
| Ga0070698_1021587601 | 3300005471 | Corn, Switchgrass And Miscanthus Rhizosphere | MADMKRREVIGLIAGAPLAAGFPWTAESVREASARAREALARGTTYEPKQFTAHEWETV |
| Ga0070697_1002544801 | 3300005536 | Corn, Switchgrass And Miscanthus Rhizosphere | MTHLDRREALALLAGAPFAAAWQWAPDAVREAAARAREVIARGAP |
| Ga0066697_106393012 | 3300005540 | Soil | MDRRSAIRVLAAAPVATAFRWAPESVREAAALARETLQRG |
| Ga0070732_100437481 | 3300005542 | Surface Soil | MAMNRRDAARLLAVAPVAAAFRWAPESVREAAALA |
| Ga0070696_1001083601 | 3300005546 | Corn, Switchgrass And Miscanthus Rhizosphere | MTDLNRREVIGMLAAAPLAAAFRWTPESVREASARAQEALARGTPYEPKQFTPHE |
| Ga0070696_1008394452 | 3300005546 | Corn, Switchgrass And Miscanthus Rhizosphere | MADMNRREVIGLIAGAPLAAGFPWTAESVRKASARAREALAHGTAYEPKQFTPH |
| Ga0070696_1016193811 | 3300005546 | Corn, Switchgrass And Miscanthus Rhizosphere | MTDLSRREVIGMLAAAPLAAAFRWTPESVREASARAQEALARGTPYEPKQFTPHE |
| Ga0066661_107065311 | 3300005554 | Soil | MKRRDAVHLLAAAPLAAAFRWAPESVREASALARGALARGAPFEPKHFTA |
| Ga0066670_100236063 | 3300005560 | Soil | MDRRSAIRVLGVAPVATAFRWAPESVREAAAQAREALGRGAPYEPKHFT |
| Ga0066703_100579513 | 3300005568 | Soil | MDRRSAIRVLAAAPVATAFRWAPESVREAAALARETLQRGVPYEPK |
| Ga0066694_100335993 | 3300005574 | Soil | MADMNRREVIGLIAAAPLAAAFPWTAESVREASARAREALARGTPYEPK |
| Ga0066694_105851571 | 3300005574 | Soil | MDRRSAIRVLAAAPVATAFRWAPESVREAAALARETLQRGVPYEPKQFTAREWETVRL |
| Ga0066691_105330671 | 3300005586 | Soil | MSAINRRKAVQILATVPLAAALRWPPESVREAAARTRDALARAAPYEPKHFTAHEWDTVR |
| Ga0066696_100536921 | 3300006032 | Soil | MDRRSAVRMLAMAPVAAAFRWAPDSVREAAARARAALGRGAPYEPKHFTAHEWDTVR |
| Ga0079222_118377702 | 3300006755 | Agricultural Soil | MTHLDRREVLALLAGAPLSAAFQWAPESVREAAALARESLARGASYEPKQFTLHEW |
| Ga0066665_104565132 | 3300006796 | Soil | MDRRSAVGLLAAAPLATAFRWAPESVREASALAREALERGAPYDPKNFTAHEWETVRL |
| Ga0066665_106973933 | 3300006796 | Soil | MADMNRREVIGLLATAPLAAAFRWTPESVREASARAREALARGIPYEPK |
| Ga0066665_114044661 | 3300006796 | Soil | MKRREAVQLLAVAPLATAFRWAPESVSRAAALARGALDRGAPYEPKFFTAH |
| Ga0079220_100180641 | 3300006806 | Agricultural Soil | MKRRDAVHVLAAAPIAAAFGWTPESVREASALARRA |
| Ga0075425_1003056231 | 3300006854 | Populus Rhizosphere | MADMNRREVIGLIAGAPLAAGFPWTAESVREASAR |
| Ga0075424_1002840902 | 3300006904 | Populus Rhizosphere | MADMNRRDVIGMLATAPLAAAFRWTPESVREASARARE |
| Ga0066710_1005745611 | 3300009012 | Grasslands Soil | MQRRDAVQVLAVAPLAAAFRWAPESVREASALARTAVARG |
| Ga0099830_108508542 | 3300009088 | Vadose Zone Soil | MQRRDAVHVLAVAPLAAAFRWAPESVREASALAPMAVARGS* |
| Ga0099828_107423692 | 3300009089 | Vadose Zone Soil | MKRRDAVQLLAVAPLTAAFRWAPESVREASARAREALARGAPYEPKQFTT |
| Ga0099827_116085362 | 3300009090 | Vadose Zone Soil | MTTMNRRDVVQLLAVAPLAAAFRWAPESVREATALAREALARGLPYEPKNFTAHE |
| Ga0099827_119490392 | 3300009090 | Vadose Zone Soil | MDRRSAIGLFAMAPVATAFRWAPESVREAAAQAREALAPTRGPTG |
| Ga0066709_1031395872 | 3300009137 | Grasslands Soil | MLAMAPVAAAFRWAPDSVREAAARARAALGRGAPYEPKHF |
| Ga0099792_111012142 | 3300009143 | Vadose Zone Soil | MKRRDAVQLLAVAPLTAAFRWAPESVREASARAREALARGAPYEPKQF |
| Ga0134082_100335271 | 3300010303 | Grasslands Soil | MGEAMDRRSVIGLLASAPVATAFRWAPESVREAAALARETLQRGVPYE |
| Ga0134109_100270052 | 3300010320 | Grasslands Soil | MKRRDAVHLFAVAPLAAAFRWAPESVRDASALARQALETG |
| Ga0134067_104054942 | 3300010321 | Grasslands Soil | MDRRSVIGLLASAPVAAAFRWAPDSVREAAARARAALGRGAPYEPKHFTAHEWDTV |
| Ga0134064_102730662 | 3300010325 | Grasslands Soil | MDRREAVRLLAVTPLVAAFAFTPDSVREASARAREALA |
| Ga0134111_103522611 | 3300010329 | Grasslands Soil | MNRREVIGMLAAAPLAAAFRWTPESVREASARAHDALARGTPYEPKQ |
| Ga0134111_105110452 | 3300010329 | Grasslands Soil | MSTMNRRDVVRLLTVAPLATAFRWAPESVSRAAALA |
| Ga0134063_100585231 | 3300010335 | Grasslands Soil | MDRRNAVQLLVIGPVAAAFRWAPESVREAAALARETLQRGVPY* |
| Ga0126378_125688562 | 3300010361 | Tropical Forest Soil | MKRRDAAKIVVVAPVTAAFRWAPESVREAAARAREVIGVDPPYAP |
| Ga0134128_129698661 | 3300010373 | Terrestrial Soil | MQRRDMVHLLAVAPLAAAFQWAPESVRQAALQARAAIKRGSPNEPKI |
| Ga0137388_112331371 | 3300012189 | Vadose Zone Soil | MERREAVRILAIAPLAAAFRWAPESVREATALAREA |
| Ga0137388_119237071 | 3300012189 | Vadose Zone Soil | MKRRDAVQLLAVAPLTAAFRWTPQSVREASARAREALARGTPYE |
| Ga0137383_107977261 | 3300012199 | Vadose Zone Soil | MKRRDAVRTLAVAPLAAAFRWTPELVREASARAREALARGTTYEPKAFTAHEWET |
| Ga0137382_100325444 | 3300012200 | Vadose Zone Soil | MSTIDRREIVRLLAVAPLAATFRWAPDSVREAAARAREALGRGAPYEPKHFTAHEWDTVR |
| Ga0137382_113446461 | 3300012200 | Vadose Zone Soil | MDRRSVIGLLASAPVAAAFRWAPDSVREAAARAREALGRGAPYEPKHFTAHEWDTVRL |
| Ga0137365_101556261 | 3300012201 | Vadose Zone Soil | MDRRSVVSLLTVAPLATAFRWAPESVREASALAREAFERRTPYQPKNFTAHEWDTVR |
| Ga0137363_115109212 | 3300012202 | Vadose Zone Soil | MKRRDAVQLLAVAPLTAAFRWTPESVREASARARDALA |
| Ga0137362_114760241 | 3300012205 | Vadose Zone Soil | MKRRDAVQLLAVAPLTAAFRWAPESVREASARARDALARGAP |
| Ga0137376_115126572 | 3300012208 | Vadose Zone Soil | MKRREAVHLLAVAPLAAAFQWAPESVRQAALRARETITSGDPYEPKIF |
| Ga0137377_103701031 | 3300012211 | Vadose Zone Soil | MDRRSVIGLLASAPVAAAFRWAPESVREAAALARETLQRGVPYEPKQFTAHEW |
| Ga0137370_105717502 | 3300012285 | Vadose Zone Soil | MSRREAVHLLAVAPVAAAFGWAPESVREASALARQALENRAPYEPKNFTAR |
| Ga0137384_100642341 | 3300012357 | Vadose Zone Soil | MRTMNRRDVVQLLAVAPLAAAFRWTPESVQRAAALAREALRGGAPYEPKHFTAH |
| Ga0137375_112893152 | 3300012360 | Vadose Zone Soil | MCAMSTINRREVVQLLAVAPLAAAFRWTPESVREASALAREALSRGVPYEPK |
| Ga0137373_106569632 | 3300012532 | Vadose Zone Soil | MKRREAVHLLAVAPLAAAFRWAPESVRQAALRARETIK |
| Ga0137395_107584151 | 3300012917 | Vadose Zone Soil | MKRRDAVQLLAVAPLTAAFRWTPQSVREASSRAREALARGTP |
| Ga0137416_102995251 | 3300012927 | Vadose Zone Soil | VKRRDAVRVLAVAPLAAAFRWTPESVREASARARDALAR |
| Ga0137407_110150921 | 3300012930 | Vadose Zone Soil | MTDLNRREAVALLATAPLAAGFPWTAESVREASARARDALARGTPYEPKQFTAHEWDTV |
| Ga0137410_101576112 | 3300012944 | Vadose Zone Soil | MKRRDAVRLLAVAPLAAAFQWAPESVRLAALQTREAIKRGSRYEP |
| Ga0134081_100303932 | 3300014150 | Grasslands Soil | MNRREVIGLIAAAPLAAAFPWTTESVRDASARARAALA |
| Ga0134081_104024762 | 3300014150 | Grasslands Soil | MSRREAVRLLAVAPVAAAFSWAPESVRDAVALAREARAR |
| Ga0134078_101910952 | 3300014157 | Grasslands Soil | MDRREAVRLLAVTPLVAAFAFTPDSVREASARAREALARGLP |
| Ga0137411_12352982 | 3300015052 | Vadose Zone Soil | MKRRDAVRVLTVAPLAAAFRWTPESVREASARAQEALARGTPYEPK |
| Ga0066655_107189492 | 3300018431 | Grasslands Soil | MDRRSAVSLLAVAPVAAAFRWAPESVREASALARVALERAAPYDPKNF |
| Ga0066655_110857231 | 3300018431 | Grasslands Soil | MTDMNRREVIGLIAAAPLAAAFPWTTESVRDASARARAALARGTPYEPKQ |
| Ga0066667_114127812 | 3300018433 | Grasslands Soil | MADMNRREVIGLIAAAPLAAAFPWTAESVREASARAREAL |
| Ga0179594_102937031 | 3300020170 | Vadose Zone Soil | MKRRDAVRVLAVAPVAAAFRWTPESVREASARARDALTRGTPYQPKQFTTHQ |
| Ga0209751_109079032 | 3300025327 | Soil | MKRREAVRLLAVAPLAAAFRWAPESVRQAAVQTRAAL |
| Ga0207699_103368991 | 3300025906 | Corn, Switchgrass And Miscanthus Rhizosphere | LTTHLDRREVLALLAGAPLAAAFQWAPDSVREAAARAREVIARGAPYEPKRF |
| Ga0207684_108478692 | 3300025910 | Corn, Switchgrass And Miscanthus Rhizosphere | MADMNRREVIGLIAGAPLAAGFPWTAESVRKASARAREALAHGTAYEPKQFTP |
| Ga0207665_100060631 | 3300025939 | Corn, Switchgrass And Miscanthus Rhizosphere | MTDLNRREVIGMLAAAPLAAAFRWTPESVREASARAQEALARGTPYEPKQFT |
| Ga0209235_10039251 | 3300026296 | Grasslands Soil | VTDLSRREVVALLATAPLAAAFPWTADSVREASARARAALARGTPYEP |
| Ga0209471_10008491 | 3300026318 | Soil | MADMNRREVVGLIAGAPLAAGFPWAAESVREASARAREALA |
| Ga0209471_10917662 | 3300026318 | Soil | MDRRSVIGLLASAPVAAAFRWAPESVREAAARAREALARGAVYEPKHFS |
| Ga0209687_11462681 | 3300026322 | Soil | MDRRNAVQLLVIGPVAAAFRWAPESVREAAALARETLQRGVP |
| Ga0209152_100272013 | 3300026325 | Soil | MADMNRREVVGLIAAAPLAAAFPWTAESVREASARAQEALARGTPYEPKRSWT |
| Ga0209802_10743762 | 3300026328 | Soil | VADMNRREVVSLIAAAPLAAAFPWTAESVREASARAREALALGTPYEPKQFTAHEWDTVR |
| Ga0209473_12518441 | 3300026330 | Soil | MADMNRREVIGLIAAAPLSAAFPWTAESVREASARAREALARGTP |
| Ga0209808_10038401 | 3300026523 | Soil | MKRRDAVRTLAVAPLAAAFRWTPESVRDASARAREALARGTTYEPKAFTAHERETVRV |
| Ga0209056_102896812 | 3300026538 | Soil | VAERVTRRDVVRLLAVAPLATAFRWAPESVSRAAALA |
| Ga0209376_10208835 | 3300026540 | Soil | MADMNRREVIGLIAAAPLAAAFPWTTESVRDASARARE |
| Ga0209376_12900321 | 3300026540 | Soil | MSTMNRRDVVRLLTVAPLATAFRWAPESVSRAAALAR |
| Ga0209805_13484571 | 3300026542 | Soil | MDRRSVIGLLASAPVATAFRWAPESVREAAALARETL |
| Ga0208474_1025882 | 3300026700 | Soil | LTTHLDRREALALLAGAPLATAFQWAPDAVREAAARAREVIARGAPYEPKQFTPHE |
| Ga0209884_10156631 | 3300027013 | Groundwater Sand | MQRRDAVQLLAVAPLAAAFRWRPESVREASARAREALARG |
| Ga0208988_11315182 | 3300027633 | Forest Soil | MKRRDAVQLLAVGPLAAAFRWTPESVREASARACEALARGT |
| Ga0209178_11921202 | 3300027725 | Agricultural Soil | MTHLDRREALALLAGAPLATAFQWAPDAVREAAARAREVIARGAPYEPKQFTPH |
| Ga0209590_101734611 | 3300027882 | Vadose Zone Soil | MKRRDAVRTLAVAPLAAAFRWTPESVREASARAREALARGTTYEPKALTAHEWETVR |
| Ga0209885_10169661 | 3300027950 | Groundwater Sand | MQRRDAVQLLAVAPLAAAFRWRPESVREASARAREA |
| Ga0316602_101028781 | 3300031577 | Soil | VTDGMDRREAVRLLALGPLAVAFGYTPESVREASALAREALARGTPYEPKHFTAHEWD |
| Ga0307469_113218101 | 3300031720 | Hardwood Forest Soil | MAMNRRDAARLLVVAPVATAFRWAPESVREAAALAREALAGQGPPF |
| ⦗Top⦘ |