NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F100843

Metagenome / Metatranscriptome Family F100843

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F100843
Family Type Metagenome / Metatranscriptome
Number of Sequences 102
Average Sequence Length 42 residues
Representative Sequence GMEILVKSVQSQGRHVDRKVSFTDIADDRLATEVAKELGYKIP
Number of Associated Samples 94
Number of Associated Scaffolds 102

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 1.96 %
% of genes near scaffold ends (potentially truncated) 97.06 %
% of genes from short scaffolds (< 2000 bps) 89.22 %
Associated GOLD sequencing projects 92
AlphaFold2 3D model prediction Yes
3D model pTM-score0.36

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (99.020 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere
(10.784 % of family members)
Environment Ontology (ENVO) Unclassified
(22.549 % of family members)
Earth Microbiome Project Ontology (EMPO) Free-living → Non-saline → Soil (non-saline)
(38.235 % of family members)



 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      


 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 38.03%    β-sheet: 0.00%    Coil/Unstructured: 61.97%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  
pTM-score: 0.36
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.


 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 102 Family Scaffolds
PF09084NMT1 36.27
PF00890FAD_binding_2 14.71
PF04392ABC_sub_bind 6.86
PF01061ABC2_membrane 3.92
PF07883Cupin_2 1.96
PF13458Peripla_BP_6 1.96
PF12698ABC2_membrane_3 1.96
PF00011HSP20 0.98
PF13379NMT1_2 0.98
PF10047DUF2281 0.98
PF00440TetR_N 0.98

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 102 Family Scaffolds
COG0715ABC-type nitrate/sulfonate/bicarbonate transport system, periplasmic componentInorganic ion transport and metabolism [P] 36.27
COG4521ABC-type taurine transport system, periplasmic componentInorganic ion transport and metabolism [P] 36.27
COG2984ABC-type uncharacterized transport system, periplasmic componentGeneral function prediction only [R] 6.86
COG0071Small heat shock protein IbpA, HSP20 familyPosttranslational modification, protein turnover, chaperones [O] 0.98


 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms99.02 %
UnclassifiedrootN/A0.98 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
2162886011|MRS1b_contig_7727975All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium882Open in IMG/M
2162886012|MBSR1b_contig_11090568All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium883Open in IMG/M
3300000033|ICChiseqgaiiDRAFT_c0856396All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium5269Open in IMG/M
3300000652|ARCol0yngRDRAFT_1007345All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium793Open in IMG/M
3300000793|AF_2010_repII_A001DRAFT_10118466All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium554Open in IMG/M
3300000891|JGI10214J12806_11590349All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium1323Open in IMG/M
3300000956|JGI10216J12902_100773946All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium1758Open in IMG/M
3300000956|JGI10216J12902_103536795All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium833Open in IMG/M
3300002124|C687J26631_10277466All Organisms → cellular organisms → Bacteria554Open in IMG/M
3300003987|Ga0055471_10123461All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium774Open in IMG/M
3300004067|Ga0055485_10216968All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium550Open in IMG/M
3300004070|Ga0055488_10081309All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium761Open in IMG/M
3300004156|Ga0062589_102359080All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium548Open in IMG/M
3300005354|Ga0070675_100974718All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium778Open in IMG/M
3300005450|Ga0066682_10227478All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium1198Open in IMG/M
3300005518|Ga0070699_100990372All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium771Open in IMG/M
3300005535|Ga0070684_101335396All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium675Open in IMG/M
3300005536|Ga0070697_100860142All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium803Open in IMG/M
3300005874|Ga0075288_1037483All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium728Open in IMG/M
3300005904|Ga0075280_10136514All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium522Open in IMG/M
3300006794|Ga0066658_10008623All Organisms → cellular organisms → Bacteria → Proteobacteria3719Open in IMG/M
3300006845|Ga0075421_100010454All Organisms → cellular organisms → Bacteria → Proteobacteria11475Open in IMG/M
3300006847|Ga0075431_100066479All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium3722Open in IMG/M
3300006853|Ga0075420_100823328All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium799Open in IMG/M
3300006880|Ga0075429_100444980All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium1135Open in IMG/M
3300006914|Ga0075436_100238204All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium1294Open in IMG/M
3300009012|Ga0066710_104770492All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium507Open in IMG/M
3300009100|Ga0075418_10063203All Organisms → cellular organisms → Bacteria3951Open in IMG/M
3300009100|Ga0075418_11026099All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium893Open in IMG/M
3300009100|Ga0075418_11818696All Organisms → cellular organisms → Bacteria663Open in IMG/M
3300009147|Ga0114129_10593610All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium1436Open in IMG/M
3300009157|Ga0105092_10936038All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium513Open in IMG/M
3300009162|Ga0075423_10173119All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium2266Open in IMG/M
3300009610|Ga0105340_1228459All Organisms → cellular organisms → Bacteria791Open in IMG/M
3300009610|Ga0105340_1286732All Organisms → cellular organisms → Bacteria714Open in IMG/M
3300009810|Ga0105088_1006040All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium1700Open in IMG/M
3300010047|Ga0126382_11559364All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium610Open in IMG/M
3300010301|Ga0134070_10401163All Organisms → cellular organisms → Bacteria → Proteobacteria541Open in IMG/M
3300010360|Ga0126372_11754198All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium663Open in IMG/M
3300010362|Ga0126377_10562476All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium1180Open in IMG/M
3300010397|Ga0134124_10643846All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium1043Open in IMG/M
3300010868|Ga0124844_1188258All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium761Open in IMG/M
3300011412|Ga0137424_1115542All Organisms → cellular organisms → Bacteria558Open in IMG/M
3300012198|Ga0137364_10828791All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium699Open in IMG/M
3300012202|Ga0137363_11121014All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium669Open in IMG/M
3300012409|Ga0134045_1339584All Organisms → cellular organisms → Bacteria → Proteobacteria535Open in IMG/M
3300012904|Ga0157282_10163173All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium690Open in IMG/M
3300012922|Ga0137394_11140511All Organisms → cellular organisms → Bacteria644Open in IMG/M
3300012971|Ga0126369_10907448All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium967Open in IMG/M
3300012975|Ga0134110_10031302All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium2080Open in IMG/M
3300012976|Ga0134076_10537727All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium538Open in IMG/M
3300012987|Ga0164307_10009268All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium4717Open in IMG/M
3300015357|Ga0134072_10015407All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium1836Open in IMG/M
3300015374|Ga0132255_101383795All Organisms → cellular organisms → Bacteria1063Open in IMG/M
3300015374|Ga0132255_101394496All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium1059Open in IMG/M
3300016341|Ga0182035_11383575All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium631Open in IMG/M
3300017656|Ga0134112_10471708All Organisms → cellular organisms → Bacteria528Open in IMG/M
3300017947|Ga0187785_10467587All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium621Open in IMG/M
3300018422|Ga0190265_11511946All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium784Open in IMG/M
3300018422|Ga0190265_12598660All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium604Open in IMG/M
3300018431|Ga0066655_10365828All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium949Open in IMG/M
3300018432|Ga0190275_10712082All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium1062Open in IMG/M
3300018482|Ga0066669_10515244All Organisms → cellular organisms → Bacteria1037Open in IMG/M
3300018482|Ga0066669_12274769All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium516Open in IMG/M
3300019881|Ga0193707_1193766All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium525Open in IMG/M
3300020003|Ga0193739_1051258All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium1062Open in IMG/M
3300020060|Ga0193717_1061358All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium1289Open in IMG/M
3300020061|Ga0193716_1232879All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium676Open in IMG/M
3300025165|Ga0209108_10612484All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium507Open in IMG/M
3300025324|Ga0209640_11146100All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium589Open in IMG/M
3300025326|Ga0209342_11232298All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium549Open in IMG/M
3300025537|Ga0210061_1048578All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium718Open in IMG/M
3300025791|Ga0210115_1125240All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium504Open in IMG/M
3300025795|Ga0210114_1099370All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium590Open in IMG/M
3300025903|Ga0207680_10881429All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium641Open in IMG/M
3300025912|Ga0207707_11446752All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium546Open in IMG/M
3300025920|Ga0207649_10431749All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium991Open in IMG/M
3300025993|Ga0208415_1023697All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium597Open in IMG/M
3300026116|Ga0207674_10480502All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium1201Open in IMG/M
3300026317|Ga0209154_1004069All Organisms → cellular organisms → Bacteria → Proteobacteria7796Open in IMG/M
3300026333|Ga0209158_1166007Not Available801Open in IMG/M
3300026334|Ga0209377_1004910All Organisms → cellular organisms → Bacteria → Proteobacteria8348Open in IMG/M
3300027818|Ga0209706_10451798All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium592Open in IMG/M
3300027843|Ga0209798_10347408All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium702Open in IMG/M
3300027873|Ga0209814_10032529All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium2152Open in IMG/M
3300027874|Ga0209465_10096459All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium1448Open in IMG/M
3300027886|Ga0209486_10464962All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium780Open in IMG/M
3300027890|Ga0209496_10673942All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium564Open in IMG/M
3300028809|Ga0247824_10361066All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium831Open in IMG/M
3300030619|Ga0268386_10231476All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium1369Open in IMG/M
3300031229|Ga0299913_11388007All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium658Open in IMG/M
3300031573|Ga0310915_11087963All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium556Open in IMG/M
3300031744|Ga0306918_10836523All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium718Open in IMG/M
3300031854|Ga0310904_10510318All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium808Open in IMG/M
3300031879|Ga0306919_10485450All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium952Open in IMG/M
3300031942|Ga0310916_11692038All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium512Open in IMG/M
3300032002|Ga0307416_101889994All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium700Open in IMG/M
3300032004|Ga0307414_11933322All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium551Open in IMG/M
3300032076|Ga0306924_10475341All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium1426Open in IMG/M
3300032180|Ga0307471_100355135All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium1577Open in IMG/M
3300032180|Ga0307471_102824003All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium616Open in IMG/M
3300034115|Ga0364945_0069119All Organisms → cellular organisms → Bacteria1007Open in IMG/M



 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
Populus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere10.78%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil9.80%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Soil8.82%
Natural And Restored WetlandsEnvironmental → Aquatic → Marine → Wetlands → Unclassified → Natural And Restored Wetlands5.88%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil5.88%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil3.92%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil3.92%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil3.92%
SoilEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Soil2.94%
Vadose Zone SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil2.94%
Rice Paddy SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Rice Paddy Soil2.94%
SoilEnvironmental → Terrestrial → Soil → Loam → Unclassified → Soil2.94%
Freshwater SedimentEnvironmental → Aquatic → Freshwater → Sediment → Unclassified → Freshwater Sediment1.96%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil1.96%
Hardwood Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil1.96%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural → Soil1.96%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil1.96%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere1.96%
Corn RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere1.96%
Arabidopsis RhizosphereHost-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere1.96%
Miscanthus RhizosphereHost-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Miscanthus Rhizosphere1.96%
RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere1.96%
WetlandEnvironmental → Aquatic → Freshwater → Sediment → Unclassified → Wetland0.98%
Wetland SedimentEnvironmental → Aquatic → Freshwater → Wetlands → Unclassified → Wetland Sediment0.98%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil0.98%
Terrestrial SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil0.98%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil0.98%
Agricultural SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil0.98%
Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil0.98%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Uranium Contaminated → Soil0.98%
Tropical PeatlandEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland0.98%
Groundwater SandEnvironmental → Terrestrial → Soil → Sand → Unclassified → Groundwater Sand0.98%
SedimentEnvironmental → Terrestrial → Floodplain → Sediment → Unclassified → Sediment0.98%
Corn RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere0.98%
Arabidopsis RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Rhizosphere0.98%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere0.98%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere0.98%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere0.98%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
2162886011Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1Host-AssociatedOpen in IMG/M
2162886012Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1Host-AssociatedOpen in IMG/M
3300000033Soil microbial communities from Great Prairies - Iowa, Continuous Corn soilEnvironmentalOpen in IMG/M
3300000652Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Col-0 young rhizosphere DNAHost-AssociatedOpen in IMG/M
3300000793Forest soil microbial communities from Amazon forest - 2010 replicate II A001EnvironmentalOpen in IMG/M
3300000891Soil microbial communities from Great Prairies - Wisconsin, Continuous corn soilEnvironmentalOpen in IMG/M
3300000956Soil microbial communities from Great Prairies - Kansas, Native Prairie soilEnvironmentalOpen in IMG/M
3300002124Soil microbial communities from Rifle, Colorado - Rifle CSP2_sed 10_3EnvironmentalOpen in IMG/M
3300003987Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberryNW_TuleB_D2EnvironmentalOpen in IMG/M
3300004067Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - RushMan_ThreeSqA_D2EnvironmentalOpen in IMG/M
3300004070Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - RushOxbow_ThreeSqA_D2EnvironmentalOpen in IMG/M
3300004156Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Combined assembly of AARS Block 1EnvironmentalOpen in IMG/M
3300005354Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaGHost-AssociatedOpen in IMG/M
3300005450Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_131EnvironmentalOpen in IMG/M
3300005518Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaGEnvironmentalOpen in IMG/M
3300005535Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaGEnvironmentalOpen in IMG/M
3300005536Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaGEnvironmentalOpen in IMG/M
3300005874Rice paddy soil microbial communities from Twitchell Island, California, USA - SF_Rice_20C_0N_404EnvironmentalOpen in IMG/M
3300005904Rice paddy soil microbial communities from Twitchell Island, California, USA - SF_Rice_10C_0N_404EnvironmentalOpen in IMG/M
3300006794Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_107EnvironmentalOpen in IMG/M
3300006845Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD5Host-AssociatedOpen in IMG/M
3300006847Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5Host-AssociatedOpen in IMG/M
3300006853Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD4Host-AssociatedOpen in IMG/M
3300006880Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3Host-AssociatedOpen in IMG/M
3300006914Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5Host-AssociatedOpen in IMG/M
3300009012Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_159EnvironmentalOpen in IMG/M
3300009100Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD2Host-AssociatedOpen in IMG/M
3300009147Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2)Host-AssociatedOpen in IMG/M
3300009157Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (1) Depth 19-21cm March2015EnvironmentalOpen in IMG/M
3300009162Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD2Host-AssociatedOpen in IMG/M
3300009610Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMLT700EnvironmentalOpen in IMG/M
3300009810Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW S3_20_30EnvironmentalOpen in IMG/M
3300010047Tropical forest soil microbial communities from Panama - MetaG Plot_30EnvironmentalOpen in IMG/M
3300010301Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_2_09082015EnvironmentalOpen in IMG/M
3300010360Tropical forest soil microbial communities from Panama - MetaG Plot_6EnvironmentalOpen in IMG/M
3300010362Tropical forest soil microbial communities from Panama - MetaG Plot_22EnvironmentalOpen in IMG/M
3300010397Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-4EnvironmentalOpen in IMG/M
3300010868Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (PacBio error correction)EnvironmentalOpen in IMG/M
3300011412Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMZT620_2EnvironmentalOpen in IMG/M
3300012198Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_20_16 metaGEnvironmentalOpen in IMG/M
3300012202Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_115_16 metaGEnvironmentalOpen in IMG/M
3300012409Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Glu_40cm_2_16_1 metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300012904Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S029-104C-1EnvironmentalOpen in IMG/M
3300012922Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czobulk1.16 metaGEnvironmentalOpen in IMG/M
3300012971Tropical forest soil microbial communities from Panama - MetaG Plot_1EnvironmentalOpen in IMG/M
3300012975Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_5_11112015EnvironmentalOpen in IMG/M
3300012976Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_40cm_5_0_1 metaGEnvironmentalOpen in IMG/M
3300012987Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_243_MGEnvironmentalOpen in IMG/M
3300015357Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_20cm_5_0_1 metaGEnvironmentalOpen in IMG/M
3300015374Col-0 rhizosphere combined assemblyHost-AssociatedOpen in IMG/M
3300016341Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170EnvironmentalOpen in IMG/M
3300017656Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_5_11112015EnvironmentalOpen in IMG/M
3300017947Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0815_BV2_4_20_MGEnvironmentalOpen in IMG/M
3300018422Populus adjacent soil microbial communities from riparian zone of Indian Creek, Utah, USA - 124 TEnvironmentalOpen in IMG/M
3300018431Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_104EnvironmentalOpen in IMG/M
3300018432Populus adjacent soil microbial communities from riparian zone of Yellowstone River, Montana, USA - 550 TEnvironmentalOpen in IMG/M
3300018482Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_118EnvironmentalOpen in IMG/M
3300019881Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U3c2EnvironmentalOpen in IMG/M
3300020003Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L2a2EnvironmentalOpen in IMG/M
3300020060Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U2c2EnvironmentalOpen in IMG/M
3300020061Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U2c1EnvironmentalOpen in IMG/M
3300025165Soil microbial communities from Rifle, Colorado, USA - sediment 10ft 1EnvironmentalOpen in IMG/M
3300025324Soil microbial communities from Rifle, Colorado - Rifle CSP2_sed 10_1 (SPAdes)EnvironmentalOpen in IMG/M
3300025326Soil microbial communities from Rifle, Colorado - Rifle CSP2_sed 16_2 (SPAdes)EnvironmentalOpen in IMG/M
3300025537Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberryNW_CattailC_D1 (SPAdes)EnvironmentalOpen in IMG/M
3300025791Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberryNW_TuleB_D2 (SPAdes)EnvironmentalOpen in IMG/M
3300025795Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberryNW_TuleA_D2 (SPAdes)EnvironmentalOpen in IMG/M
3300025903Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025912Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025920Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025993Rice paddy soil microbial communities from Twitchell Island, California, USA - SF_Rice_20C_0N_404 (SPAdes)EnvironmentalOpen in IMG/M
3300026116Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026317Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_121 (SPAdes)EnvironmentalOpen in IMG/M
3300026333Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_140 (SPAdes)EnvironmentalOpen in IMG/M
3300026334Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_141 (SPAdes)EnvironmentalOpen in IMG/M
3300027818Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P8 Core (1) Depth 19-21cm September2015 (SPAdes)EnvironmentalOpen in IMG/M
3300027843Wetland sediment microbial communities from St. Louis River estuary, USA, under dissolved organic matter induced mercury methylation - T4Bare3Fresh (SPAdes)EnvironmentalOpen in IMG/M
3300027873Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD1 (SPAdes)Host-AssociatedOpen in IMG/M
3300027874Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 1 MoBio (SPAdes)EnvironmentalOpen in IMG/M
3300027886Agricultural soil microbial communities from Utah to study Nitrogen management - NC Compost (SPAdes)EnvironmentalOpen in IMG/M
3300027890Wetland microbial communities from Old Woman Creek Reserve in Ohio, USA - Plant_0915_D1 (SPAdes)EnvironmentalOpen in IMG/M
3300028809Soil microbial communities from agricultural site in Penn Yan, New York, United States - 13C_PalmiticAcid_Day48EnvironmentalOpen in IMG/M
3300030619Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT150D86 (Novaseq)EnvironmentalOpen in IMG/M
3300031229Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT155D38EnvironmentalOpen in IMG/M
3300031573Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.AN111EnvironmentalOpen in IMG/M
3300031744Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.00H (v2)EnvironmentalOpen in IMG/M
3300031854Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C48D1EnvironmentalOpen in IMG/M
3300031879Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.172 (v2)EnvironmentalOpen in IMG/M
3300031942Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.LF176EnvironmentalOpen in IMG/M
3300032002Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3Host-AssociatedOpen in IMG/M
3300032004Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3Host-AssociatedOpen in IMG/M
3300032076Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111 (v2)EnvironmentalOpen in IMG/M
3300032180Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515EnvironmentalOpen in IMG/M
3300034115Sediment microbial communities from East River floodplain, Colorado, United States - 29_s17EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap



 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
MRS1b_0971.000003802162886011Miscanthus RhizosphereLVKSVQAQGRHVGRKVNFEDIADDRLATEVAKEMGYKIP
MBSR1b_0612.000015002162886012Miscanthus RhizosphereILVKSVQAQGRHVGRKVNFEDIADDRLATEVAKEMGYKIP
ICChiseqgaiiDRAFT_085639663300000033SoilVKAIQAQGRHADRKVTFNEITDDRLATEVAKELGYKIP*
ARCol0yngRDRAFT_100734523300000652Arabidopsis RhizosphereQSQGRHVDRKVAFNEIADDRLATEVAKELGYKIP*
AF_2010_repII_A001DRAFT_1011846623300000793Forest SoilIQSQGRHVDRRVSFNDIADDRLATEVARELGYKIP*
JGI10214J12806_1159034923300000891SoilLVKSVQAQGRHVGRKVSFEEIADDRLATEVAKEMGYKVP*
JGI10216J12902_10077394613300000956SoilTGMEILVKAIQSQGRFVDRKVSFNDIADDRLATEVAKELGYKMP*
JGI10216J12902_10353679513300000956SoilRTGMEILVKAIQSQGRFVDRKVSFNDIADDRLATEVAKELGYKIP*
C687J26631_1027746623300002124SoilSRIGMEILVKAVQSQGRHLDKKVAFSDIADDRLATEVAKEMGYKIP*
Ga0055471_1012346123300003987Natural And Restored WetlandsPSRTGMDILVKAIQSQGRHVDRKVSFTDIADDRLATEVAKELGYKIP*
Ga0055485_1021696813300004067Natural And Restored WetlandsGMDILVKAIQSQGRHVDKKVTFTDIADDRLAIEVAKEMGYKIP*
Ga0055488_1008130923300004070Natural And Restored WetlandsMETLVKAIQSQGRHVDRKVSFTDIADDRLATEVAKELGYKIP*
Ga0062589_10235908023300004156SoilPTRGGMDILVKSVQAQGRHVGRKVSFEEIADDRLATEVAKEMGYKVP*
Ga0070675_10097471813300005354Miscanthus RhizosphereGMDILVKSVQSQGRFVDRKVAFNDIADDRLATEVAREMGYKIP*
Ga0066682_1022747823300005450SoilMEILVKAIQSQGRFVDRKVSFSDIADDRLATEVAREMGYKIQ*
Ga0070699_10099037213300005518Corn, Switchgrass And Miscanthus RhizosphereGMDILVKSVQAQGRHVGRKVSFEEIADDRLATEVAKEMGYKVP*
Ga0070684_10133539613300005535Corn RhizosphereRVGMDILVKSVQAQGRHVGRKVNFEDIADDRLATEVAKEMGYKIP*
Ga0070697_10086014223300005536Corn, Switchgrass And Miscanthus RhizosphereLVRSLQAQGRFTDRKISFTEIADDRLATEVAKELGYKIP*
Ga0075288_103748313300005874Rice Paddy SoilTGIPTHIGMETLVKAIQAQGRHADRKVTFNEIADDRLATEVAKELGYKIP*
Ga0075280_1013651413300005904Rice Paddy SoilMETLVKAVQAQGRHVDRKVAFNEIADDRLAIEVAKELGYKIP*
Ga0066658_1000862353300006794SoilRTGMEILVKAIQSQGRFVDRKVSFSDIADDRLATEVAREMGYKIQ*
Ga0075421_10001045413300006845Populus RhizosphereSPTGIPTRVGMDILVKSVQSQGRHIDRKVAFNEIADDRLATEVAKELGYKIP*
Ga0075431_10006647943300006847Populus RhizosphereIPSRTGMEILVKAIQSQGRFVDRKVSFNDIADDRLATEVAKELGYKMQ*
Ga0075420_10082332823300006853Populus RhizosphereGMETLVKAVQSQGRHGERKVAFNEIADDRLATEVAKELGYKIP*
Ga0075429_10044498013300006880Populus RhizospherePTGIPSRTGMEILVKAIQSQGRFVDRKVSFNDIADDRLATEVAKELGYKMQ*
Ga0075436_10023820413300006914Populus RhizosphereVQAQGRHVGRKVSFEEIADDRLATEVAKEMGYKVP*
Ga0066710_10477049213300009012Grasslands SoilILVKAIQSQGRFVDRKVSFNEIADDRLATEVAKEMGYKIQ
Ga0075418_1006320313300009100Populus RhizosphereTGIPSRTGMEILVKAIQSQGRFVDRKVSFNDIADDRLATEVAKELGYKIP*
Ga0075418_1102609913300009100Populus RhizosphereSVQAQGRHVERKVAFNEIADDRLATEVAKELGYKIP*
Ga0075418_1181869613300009100Populus RhizosphereQSQGRHVDRKVSFTDIADDRLATEVAKELGYKIP*
Ga0114129_1059361013300009147Populus RhizosphereRQIMVKSVQSQVRHIDRKVSFTDIADDRLATEVAKELGYKIP*
Ga0105092_1093603823300009157Freshwater SedimentSTGIPSRTGMEILVQSVQAQGRHVDRKVAFSDIAADRLATEVEKELGYKLP*
Ga0075423_1017311913300009162Populus RhizosphereGMEILVKSVQSQGRHVDRKVSFTDIADDRLATEVAKELGYKIP*
Ga0105340_122845913300009610SoilIPSRTGMEILVKAVQSQGRHVDRKVSFTDIADDRLATEVAKELGYKIP*
Ga0105340_128673213300009610SoilIGMDILVKSVQSQGRFVDRKVAFYEIADDRLATEVAREMGYKIP*
Ga0105088_100604013300009810Groundwater SandGIDNLVRSLQAQGRFTDRKISFTEIADDRLATEVAKELGYKTP*
Ga0126382_1155936423300010047Tropical Forest SoilQSQGRHVDRRVSFNDIADDRLATEVARELGYKIP*
Ga0134070_1040116323300010301Grasslands SoilMDNLVRSLQSQGRFTDRKISFTDLADDRLATEVAKEMGYKIP*
Ga0126372_1175419813300010360Tropical Forest SoilSHTGMEILVKAIQSQGRFVDRKVAFTDIADDRLATEVAKEMGYKIP*
Ga0126377_1056247623300010362Tropical Forest SoilSGMEILVKAIQSQGRHVDRKVSFNDIADDRLATEVAKELGYKIP*
Ga0134124_1064384613300010397Terrestrial SoilNLVRSLQVQGRFTDRKVAFNDIADDRLATEVAKELGYKLP*
Ga0124844_118825823300010868Tropical Forest SoilKAIQSQGRHVDRRVSFNDIADDRLATEVARELGYKIP*
Ga0137424_111554213300011412SoilVQSQGRFVDRKVAFNEIADDRLATEVAREMGYKIP*
Ga0137364_1082879123300012198Vadose Zone SoilGMYILVKSVHSHGRHLDRKVTFNEIADDRLATEVAKELGYKIP*
Ga0137363_1112101423300012202Vadose Zone SoilGIENLVRSLQAQGRFTDRKISFTEIADDRLATEVAKELGYKIP*
Ga0134045_133958423300012409Grasslands SoilSLQSQGRFTDRKISFTDLADDRLATEVAKEMGYKIP*
Ga0157282_1016317323300012904SoilQSQGRHLDKKVAFTDIADDRLATEVAKEMGYKIP*
Ga0137394_1114051123300012922Vadose Zone SoilVKSVQSQGRHVDRKVSFNEIADDRLATEVAKEMGYKIP*
Ga0126369_1090744813300012971Tropical Forest SoilGMEILVKAIQSQGRFVDRKVAFTDIADDRLATEVAKEMGYKIP*
Ga0134110_1003130233300012975Grasslands SoilILVKAIQSQGRFVDRKVSFNEIADDRLATEVAKEMG*
Ga0134076_1053772713300012976Grasslands SoilTGMDILVKSVQSQGRHVDRKVAFNEIADDRLATEVAKEMGYKIP*
Ga0164307_1000926813300012987SoilMDILVKSVQAQGRHVGRKVNFEDIADDRLATEVAKEMGYKIP*
Ga0134072_1001540713300015357Grasslands SoilAIQSQGRFVDRKVSFSDIADDRLATEVAREMGYKIQ*
Ga0132255_10138379523300015374Arabidopsis RhizosphereVKSVQSQGRHVDRTVAFNDIADDRLATEVAKELGYKIP*
Ga0132255_10139449613300015374Arabidopsis RhizosphereLGMDILVKSVQSQGRHVDRKVAFNDIADDRLATEVAKELGYKIP*
Ga0182035_1138357523300016341SoilRIGMEILVKSVQAQGRFVDRKVAFNEIADDRLATEVAKEMGYKMP
Ga0134112_1047170823300017656Grasslands SoilSRTGMETLVKAIQSQGRFVGRNVSFADVADDRLATEVARELGYKIQ
Ga0187785_1046758713300017947Tropical PeatlandPTRVGMEILVKSVQSQGRFVDRKVNFNEIADDRLATEVAKEMGYKIP
Ga0190265_1151194623300018422SoilTGIPTRVGMDILVKSVQAQGRHVDRKVAFNEIADDRLATEVAKELGYKIP
Ga0190265_1259866013300018422SoilDILVKSVQAQGRHVGRKVAFEELADDRLATEVAKELGYKIP
Ga0066655_1036582813300018431Grasslands SoilAIQSQGRFVDRKVSFNEIADDRLATEVAKEMGYKIQ
Ga0190275_1071208213300018432SoilSRIGMETLVKAVQSQGRHGDRKVGFNEIADDRLATEVAKELGYKIP
Ga0066669_1051524413300018482Grasslands SoilPTRVGMDILVKSVQSQGRHVDCKVAFNEIADDRLATEVAKEMGYKIP
Ga0066669_1227476913300018482Grasslands SoilMEILVKAIQSQGRFVDRKVSFSDIADDRLATEVAREMGYKIQ
Ga0193707_119376613300019881SoilPTGIPTRIGMDILVTSVQSQGRHVDRKVAFNEIADDRLATEVAREMGYKIP
Ga0193739_105125813300020003SoilKSVQSQGRHVDRKVAFNEIADDRLATEVAREMGYKIP
Ga0193717_106135823300020060SoilDILVKSVQAQGRHVDRKVAFNEIADDRLATEVARELGYKIP
Ga0193716_123287923300020061SoilTRVGMDILVKSVQAQGRHVGRKVAFEEIADDRLATEVAKELGYKIP
Ga0209108_1061248413300025165SoilIQSQGRHVDKKVAFTDVADDRLAIEVAKEMGYKIP
Ga0209640_1114610023300025324SoilSRTGMEILVRSIQSQGRHVDKKVAFSDVADDRLAIEVAREMGYKIP
Ga0209342_1123229823300025326SoilVQSQGRHLDKKVAFSDIADDRLATEVAKEMGYKIP
Ga0210061_104857823300025537Natural And Restored WetlandsTGIPSRVGMETLVKAVQAQGRHVDRKVAFNEIADDRLAIEVAKELGYKIP
Ga0210115_112524023300025791Natural And Restored WetlandsGMDILVKAIQSQGRHVDRKVSFTDIADDRLATEVAKELGYKIP
Ga0210114_109937023300025795Natural And Restored WetlandsVQAQGRHVDRKVAFTDIADDRLATEVAKELGYRLP
Ga0207680_1088142923300025903Switchgrass RhizosphereVPTRVGMDILVKSIQSQGRHTDKKVAFTDIADDRLATEVAREMGYKVQ
Ga0207707_1144675213300025912Corn RhizosphereVQAQGRHVGRKVAFEEIADDRLATEVAKELGYKIP
Ga0207649_1043174913300025920Corn RhizosphereRVGMDILVKSVQAQGRHVGRKVNFEDIADDRLATEVAKEMGYKIP
Ga0208415_102369723300025993Rice Paddy SoilTLVKAIQAQGRHADRKVTFNEIADDRLATEVAKELGYKIP
Ga0207674_1048050213300026116Corn RhizosphereSVQAQGRHVGRKVSFEEIADDRLATEVAKEMGYKVP
Ga0209154_100406993300026317SoilSPSGIPSRTGMEILVKAIQSQGRFVDRKVSFSDIADDRLATEVAREMGYKIQ
Ga0209158_116600713300026333SoilLVRSLQSQGRFTDRKISFTDLADDRLASEVAKEMGYKIP
Ga0209377_100491013300026334SoilLVRSLQSQGRFTDRKISFTDLADDRLATEVAKEMGYKIP
Ga0209706_1045179823300027818Freshwater SedimentVQSQGRHVDKKVAFTDIADDRLATEVAREMGYKIP
Ga0209798_1034740813300027843Wetland SedimentTTGVPTRAGMEILVKSVQSQGRHLDKKPAFTDIADDRLALEVAKEMGYKIP
Ga0209814_1003252913300027873Populus RhizosphereRTGMEILVKAIQSQGRFVDRKVSFNDIADDRLATEVAKELGYKIP
Ga0209465_1009645933300027874Tropical Forest SoilVKAIQSQGRHVDRKVSFNDIADDRLATEVARELGYKIP
Ga0209486_1046496223300027886Agricultural SoilTGMETLVKAVQSQGRHGDRKVAFNEIADDRLATEVAKELGYKIP
Ga0209496_1067394213300027890WetlandRIGMDILVKSVQSQGRHVDKKVAFTDIADDRLATEVAREMGYKIP
Ga0247824_1036106623300028809SoilETLVKAVQSQGRHGERKVAFNEIADDRLATEVAKELGYKIP
Ga0268386_1023147623300030619SoilTGIPSRIGMEILVKSVQAQGRHVDRKVAFTDIADDRLATEVAKELGYKLP
Ga0299913_1138800713300031229SoilRIGMETLVKAVQSQGRFVDRNVAFNEIADDRLATEVAKEMGYKIP
Ga0310915_1108796323300031573SoilSVQAQGRFVDRKVAFNEIADDRLATEVAKEMGYKMP
Ga0306918_1083652313300031744SoilGIPSRSGMEILVKAIQSQGRFVDRKVSFSDIADDRLATEVAKELGYKIP
Ga0310904_1051031823300031854SoilILVKSVLSLVRHIDRIVAFNEIAYYRLATEVAKELGYKIP
Ga0306919_1048545023300031879SoilPSRSGMEILVKAIQSQGRFVDRKVFFSDIADDRLATEVAKELGYKIP
Ga0310916_1169203823300031942SoilKSVQAQGRFVDRKVAFNEIADDRLATEVAKEMGYKMP
Ga0307416_10188999423300032002RhizosphereMETLVKAVQSQGRHGDRKVAFNEIADDRLATEVAKELGY
Ga0307414_1193332223300032004RhizospherePTRVGMDILVKSVQAQGRHVGRKVAFEEIADERLATEVAKELGYKVP
Ga0306924_1047534133300032076SoilSPTGIPSRSGMEILVKAIQSQGRFVDRKVSFSDIADDRLATEVAKELGYKIP
Ga0307471_10035513533300032180Hardwood Forest SoilTGMEILVKAIQSQGRFVDRKVAFTDVADDRLATEVAKEMGYKIPQ
Ga0307471_10282400323300032180Hardwood Forest SoilKAIQSQGRFVDRKVSFNDIADDRLATEVAKELGYKIP
Ga0364945_0069119_36_1643300034115SedimentMDILVKSVQSQGRHVDRKVAFTDIADDRLATEVAKEMGYKIP


 ⦗Top⦘


© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.