Basic Information | |
---|---|
Family ID | F100843 |
Family Type | Metagenome / Metatranscriptome |
Number of Sequences | 102 |
Average Sequence Length | 42 residues |
Representative Sequence | GMEILVKSVQSQGRHVDRKVSFTDIADDRLATEVAKELGYKIP |
Number of Associated Samples | 94 |
Number of Associated Scaffolds | 102 |
Quality Assessment | |
---|---|
Transcriptomic Evidence | Yes |
Most common taxonomic group | Bacteria |
% of genes with valid RBS motifs | 1.96 % |
% of genes near scaffold ends (potentially truncated) | 97.06 % |
% of genes from short scaffolds (< 2000 bps) | 89.22 % |
Associated GOLD sequencing projects | 92 |
AlphaFold2 3D model prediction | Yes |
3D model pTM-score | 0.36 |
Hidden Markov Model |
---|
Powered by Skylign |
Most Common Taxonomy | |
---|---|
Group | Bacteria (99.020 % of family members) |
NCBI Taxonomy ID | 2 |
Taxonomy | All Organisms → cellular organisms → Bacteria |
Most Common Ecosystem | |
---|---|
GOLD Ecosystem | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere (10.784 % of family members) |
Environment Ontology (ENVO) | Unclassified (22.549 % of family members) |
Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (38.235 % of family members) |
⦗Top⦘ |
⦗Top⦘ |
Predicted Topology & Secondary Structure | |||||
---|---|---|---|---|---|
Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 38.03% β-sheet: 0.00% Coil/Unstructured: 61.97% | Feature Viewer |
|
|||||
Powered by Feature Viewer |
Structure Viewer | |
---|---|
| |
Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.36 |
Powered by PDBe Molstar |
⦗Top⦘ |
Pfam ID | Name | % Frequency in 102 Family Scaffolds |
---|---|---|
PF09084 | NMT1 | 36.27 |
PF00890 | FAD_binding_2 | 14.71 |
PF04392 | ABC_sub_bind | 6.86 |
PF01061 | ABC2_membrane | 3.92 |
PF07883 | Cupin_2 | 1.96 |
PF13458 | Peripla_BP_6 | 1.96 |
PF12698 | ABC2_membrane_3 | 1.96 |
PF00011 | HSP20 | 0.98 |
PF13379 | NMT1_2 | 0.98 |
PF10047 | DUF2281 | 0.98 |
PF00440 | TetR_N | 0.98 |
COG ID | Name | Functional Category | % Frequency in 102 Family Scaffolds |
---|---|---|---|
COG0715 | ABC-type nitrate/sulfonate/bicarbonate transport system, periplasmic component | Inorganic ion transport and metabolism [P] | 36.27 |
COG4521 | ABC-type taurine transport system, periplasmic component | Inorganic ion transport and metabolism [P] | 36.27 |
COG2984 | ABC-type uncharacterized transport system, periplasmic component | General function prediction only [R] | 6.86 |
COG0071 | Small heat shock protein IbpA, HSP20 family | Posttranslational modification, protein turnover, chaperones [O] | 0.98 |
⦗Top⦘ |
Name | Rank | Taxonomy | Distribution |
All Organisms | root | All Organisms | 99.02 % |
Unclassified | root | N/A | 0.98 % |
Visualization |
---|
Powered by ApexCharts |
Scaffold | Taxonomy | Length | IMG/M Link |
---|---|---|---|
2162886011|MRS1b_contig_7727975 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 882 | Open in IMG/M |
2162886012|MBSR1b_contig_11090568 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 883 | Open in IMG/M |
3300000033|ICChiseqgaiiDRAFT_c0856396 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 5269 | Open in IMG/M |
3300000652|ARCol0yngRDRAFT_1007345 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 793 | Open in IMG/M |
3300000793|AF_2010_repII_A001DRAFT_10118466 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 554 | Open in IMG/M |
3300000891|JGI10214J12806_11590349 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 1323 | Open in IMG/M |
3300000956|JGI10216J12902_100773946 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 1758 | Open in IMG/M |
3300000956|JGI10216J12902_103536795 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 833 | Open in IMG/M |
3300002124|C687J26631_10277466 | All Organisms → cellular organisms → Bacteria | 554 | Open in IMG/M |
3300003987|Ga0055471_10123461 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 774 | Open in IMG/M |
3300004067|Ga0055485_10216968 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 550 | Open in IMG/M |
3300004070|Ga0055488_10081309 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 761 | Open in IMG/M |
3300004156|Ga0062589_102359080 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 548 | Open in IMG/M |
3300005354|Ga0070675_100974718 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 778 | Open in IMG/M |
3300005450|Ga0066682_10227478 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 1198 | Open in IMG/M |
3300005518|Ga0070699_100990372 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 771 | Open in IMG/M |
3300005535|Ga0070684_101335396 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 675 | Open in IMG/M |
3300005536|Ga0070697_100860142 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 803 | Open in IMG/M |
3300005874|Ga0075288_1037483 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 728 | Open in IMG/M |
3300005904|Ga0075280_10136514 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 522 | Open in IMG/M |
3300006794|Ga0066658_10008623 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 3719 | Open in IMG/M |
3300006845|Ga0075421_100010454 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 11475 | Open in IMG/M |
3300006847|Ga0075431_100066479 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 3722 | Open in IMG/M |
3300006853|Ga0075420_100823328 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 799 | Open in IMG/M |
3300006880|Ga0075429_100444980 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 1135 | Open in IMG/M |
3300006914|Ga0075436_100238204 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 1294 | Open in IMG/M |
3300009012|Ga0066710_104770492 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 507 | Open in IMG/M |
3300009100|Ga0075418_10063203 | All Organisms → cellular organisms → Bacteria | 3951 | Open in IMG/M |
3300009100|Ga0075418_11026099 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 893 | Open in IMG/M |
3300009100|Ga0075418_11818696 | All Organisms → cellular organisms → Bacteria | 663 | Open in IMG/M |
3300009147|Ga0114129_10593610 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 1436 | Open in IMG/M |
3300009157|Ga0105092_10936038 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 513 | Open in IMG/M |
3300009162|Ga0075423_10173119 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 2266 | Open in IMG/M |
3300009610|Ga0105340_1228459 | All Organisms → cellular organisms → Bacteria | 791 | Open in IMG/M |
3300009610|Ga0105340_1286732 | All Organisms → cellular organisms → Bacteria | 714 | Open in IMG/M |
3300009810|Ga0105088_1006040 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 1700 | Open in IMG/M |
3300010047|Ga0126382_11559364 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 610 | Open in IMG/M |
3300010301|Ga0134070_10401163 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 541 | Open in IMG/M |
3300010360|Ga0126372_11754198 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 663 | Open in IMG/M |
3300010362|Ga0126377_10562476 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 1180 | Open in IMG/M |
3300010397|Ga0134124_10643846 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 1043 | Open in IMG/M |
3300010868|Ga0124844_1188258 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 761 | Open in IMG/M |
3300011412|Ga0137424_1115542 | All Organisms → cellular organisms → Bacteria | 558 | Open in IMG/M |
3300012198|Ga0137364_10828791 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 699 | Open in IMG/M |
3300012202|Ga0137363_11121014 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 669 | Open in IMG/M |
3300012409|Ga0134045_1339584 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 535 | Open in IMG/M |
3300012904|Ga0157282_10163173 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 690 | Open in IMG/M |
3300012922|Ga0137394_11140511 | All Organisms → cellular organisms → Bacteria | 644 | Open in IMG/M |
3300012971|Ga0126369_10907448 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 967 | Open in IMG/M |
3300012975|Ga0134110_10031302 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 2080 | Open in IMG/M |
3300012976|Ga0134076_10537727 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 538 | Open in IMG/M |
3300012987|Ga0164307_10009268 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 4717 | Open in IMG/M |
3300015357|Ga0134072_10015407 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 1836 | Open in IMG/M |
3300015374|Ga0132255_101383795 | All Organisms → cellular organisms → Bacteria | 1063 | Open in IMG/M |
3300015374|Ga0132255_101394496 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 1059 | Open in IMG/M |
3300016341|Ga0182035_11383575 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 631 | Open in IMG/M |
3300017656|Ga0134112_10471708 | All Organisms → cellular organisms → Bacteria | 528 | Open in IMG/M |
3300017947|Ga0187785_10467587 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 621 | Open in IMG/M |
3300018422|Ga0190265_11511946 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 784 | Open in IMG/M |
3300018422|Ga0190265_12598660 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 604 | Open in IMG/M |
3300018431|Ga0066655_10365828 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 949 | Open in IMG/M |
3300018432|Ga0190275_10712082 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 1062 | Open in IMG/M |
3300018482|Ga0066669_10515244 | All Organisms → cellular organisms → Bacteria | 1037 | Open in IMG/M |
3300018482|Ga0066669_12274769 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 516 | Open in IMG/M |
3300019881|Ga0193707_1193766 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 525 | Open in IMG/M |
3300020003|Ga0193739_1051258 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 1062 | Open in IMG/M |
3300020060|Ga0193717_1061358 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 1289 | Open in IMG/M |
3300020061|Ga0193716_1232879 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 676 | Open in IMG/M |
3300025165|Ga0209108_10612484 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 507 | Open in IMG/M |
3300025324|Ga0209640_11146100 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 589 | Open in IMG/M |
3300025326|Ga0209342_11232298 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 549 | Open in IMG/M |
3300025537|Ga0210061_1048578 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 718 | Open in IMG/M |
3300025791|Ga0210115_1125240 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 504 | Open in IMG/M |
3300025795|Ga0210114_1099370 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 590 | Open in IMG/M |
3300025903|Ga0207680_10881429 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 641 | Open in IMG/M |
3300025912|Ga0207707_11446752 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 546 | Open in IMG/M |
3300025920|Ga0207649_10431749 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 991 | Open in IMG/M |
3300025993|Ga0208415_1023697 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 597 | Open in IMG/M |
3300026116|Ga0207674_10480502 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 1201 | Open in IMG/M |
3300026317|Ga0209154_1004069 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 7796 | Open in IMG/M |
3300026333|Ga0209158_1166007 | Not Available | 801 | Open in IMG/M |
3300026334|Ga0209377_1004910 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 8348 | Open in IMG/M |
3300027818|Ga0209706_10451798 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 592 | Open in IMG/M |
3300027843|Ga0209798_10347408 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 702 | Open in IMG/M |
3300027873|Ga0209814_10032529 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 2152 | Open in IMG/M |
3300027874|Ga0209465_10096459 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 1448 | Open in IMG/M |
3300027886|Ga0209486_10464962 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 780 | Open in IMG/M |
3300027890|Ga0209496_10673942 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 564 | Open in IMG/M |
3300028809|Ga0247824_10361066 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 831 | Open in IMG/M |
3300030619|Ga0268386_10231476 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 1369 | Open in IMG/M |
3300031229|Ga0299913_11388007 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 658 | Open in IMG/M |
3300031573|Ga0310915_11087963 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 556 | Open in IMG/M |
3300031744|Ga0306918_10836523 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 718 | Open in IMG/M |
3300031854|Ga0310904_10510318 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 808 | Open in IMG/M |
3300031879|Ga0306919_10485450 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 952 | Open in IMG/M |
3300031942|Ga0310916_11692038 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 512 | Open in IMG/M |
3300032002|Ga0307416_101889994 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 700 | Open in IMG/M |
3300032004|Ga0307414_11933322 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 551 | Open in IMG/M |
3300032076|Ga0306924_10475341 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 1426 | Open in IMG/M |
3300032180|Ga0307471_100355135 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 1577 | Open in IMG/M |
3300032180|Ga0307471_102824003 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 616 | Open in IMG/M |
3300034115|Ga0364945_0069119 | All Organisms → cellular organisms → Bacteria | 1007 | Open in IMG/M |
⦗Top⦘ |
Habitat | Taxonomy | Distribution |
Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 10.78% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 9.80% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 8.82% |
Natural And Restored Wetlands | Environmental → Aquatic → Marine → Wetlands → Unclassified → Natural And Restored Wetlands | 5.88% |
Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 5.88% |
Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 3.92% |
Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 3.92% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 3.92% |
Soil | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Soil | 2.94% |
Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 2.94% |
Rice Paddy Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Rice Paddy Soil | 2.94% |
Soil | Environmental → Terrestrial → Soil → Loam → Unclassified → Soil | 2.94% |
Freshwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Freshwater Sediment | 1.96% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 1.96% |
Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 1.96% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 1.96% |
Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 1.96% |
Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 1.96% |
Corn Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere | 1.96% |
Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 1.96% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Miscanthus Rhizosphere | 1.96% |
Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere | 1.96% |
Wetland | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Wetland | 0.98% |
Wetland Sediment | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Wetland Sediment | 0.98% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 0.98% |
Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 0.98% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 0.98% |
Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 0.98% |
Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil | 0.98% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Uranium Contaminated → Soil | 0.98% |
Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 0.98% |
Groundwater Sand | Environmental → Terrestrial → Soil → Sand → Unclassified → Groundwater Sand | 0.98% |
Sediment | Environmental → Terrestrial → Floodplain → Sediment → Unclassified → Sediment | 0.98% |
Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 0.98% |
Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Rhizosphere | 0.98% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 0.98% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere | 0.98% |
Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere | 0.98% |
Visualization |
---|
Powered by ApexCharts |
Taxon OID | Sample Name | Habitat Type | IMG/M Link |
---|---|---|---|
2162886011 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 | Host-Associated | Open in IMG/M |
2162886012 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 | Host-Associated | Open in IMG/M |
3300000033 | Soil microbial communities from Great Prairies - Iowa, Continuous Corn soil | Environmental | Open in IMG/M |
3300000652 | Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Col-0 young rhizosphere DNA | Host-Associated | Open in IMG/M |
3300000793 | Forest soil microbial communities from Amazon forest - 2010 replicate II A001 | Environmental | Open in IMG/M |
3300000891 | Soil microbial communities from Great Prairies - Wisconsin, Continuous corn soil | Environmental | Open in IMG/M |
3300000956 | Soil microbial communities from Great Prairies - Kansas, Native Prairie soil | Environmental | Open in IMG/M |
3300002124 | Soil microbial communities from Rifle, Colorado - Rifle CSP2_sed 10_3 | Environmental | Open in IMG/M |
3300003987 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberryNW_TuleB_D2 | Environmental | Open in IMG/M |
3300004067 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - RushMan_ThreeSqA_D2 | Environmental | Open in IMG/M |
3300004070 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - RushOxbow_ThreeSqA_D2 | Environmental | Open in IMG/M |
3300004156 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Combined assembly of AARS Block 1 | Environmental | Open in IMG/M |
3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Host-Associated | Open in IMG/M |
3300005450 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_131 | Environmental | Open in IMG/M |
3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Environmental | Open in IMG/M |
3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Environmental | Open in IMG/M |
3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Environmental | Open in IMG/M |
3300005874 | Rice paddy soil microbial communities from Twitchell Island, California, USA - SF_Rice_20C_0N_404 | Environmental | Open in IMG/M |
3300005904 | Rice paddy soil microbial communities from Twitchell Island, California, USA - SF_Rice_10C_0N_404 | Environmental | Open in IMG/M |
3300006794 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_107 | Environmental | Open in IMG/M |
3300006845 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD5 | Host-Associated | Open in IMG/M |
3300006847 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Host-Associated | Open in IMG/M |
3300006853 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD4 | Host-Associated | Open in IMG/M |
3300006880 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Host-Associated | Open in IMG/M |
3300006914 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Host-Associated | Open in IMG/M |
3300009012 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_159 | Environmental | Open in IMG/M |
3300009100 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD2 | Host-Associated | Open in IMG/M |
3300009147 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) | Host-Associated | Open in IMG/M |
3300009157 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (1) Depth 19-21cm March2015 | Environmental | Open in IMG/M |
3300009162 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD2 | Host-Associated | Open in IMG/M |
3300009610 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMLT700 | Environmental | Open in IMG/M |
3300009810 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW S3_20_30 | Environmental | Open in IMG/M |
3300010047 | Tropical forest soil microbial communities from Panama - MetaG Plot_30 | Environmental | Open in IMG/M |
3300010301 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_2_09082015 | Environmental | Open in IMG/M |
3300010360 | Tropical forest soil microbial communities from Panama - MetaG Plot_6 | Environmental | Open in IMG/M |
3300010362 | Tropical forest soil microbial communities from Panama - MetaG Plot_22 | Environmental | Open in IMG/M |
3300010397 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-4 | Environmental | Open in IMG/M |
3300010868 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (PacBio error correction) | Environmental | Open in IMG/M |
3300011412 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMZT620_2 | Environmental | Open in IMG/M |
3300012198 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_20_16 metaG | Environmental | Open in IMG/M |
3300012202 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_115_16 metaG | Environmental | Open in IMG/M |
3300012409 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Glu_40cm_2_16_1 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300012904 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S029-104C-1 | Environmental | Open in IMG/M |
3300012922 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czobulk1.16 metaG | Environmental | Open in IMG/M |
3300012971 | Tropical forest soil microbial communities from Panama - MetaG Plot_1 | Environmental | Open in IMG/M |
3300012975 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_5_11112015 | Environmental | Open in IMG/M |
3300012976 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_40cm_5_0_1 metaG | Environmental | Open in IMG/M |
3300012987 | Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_243_MG | Environmental | Open in IMG/M |
3300015357 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_20cm_5_0_1 metaG | Environmental | Open in IMG/M |
3300015374 | Col-0 rhizosphere combined assembly | Host-Associated | Open in IMG/M |
3300016341 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 | Environmental | Open in IMG/M |
3300017656 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_5_11112015 | Environmental | Open in IMG/M |
3300017947 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0815_BV2_4_20_MG | Environmental | Open in IMG/M |
3300018422 | Populus adjacent soil microbial communities from riparian zone of Indian Creek, Utah, USA - 124 T | Environmental | Open in IMG/M |
3300018431 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_104 | Environmental | Open in IMG/M |
3300018432 | Populus adjacent soil microbial communities from riparian zone of Yellowstone River, Montana, USA - 550 T | Environmental | Open in IMG/M |
3300018482 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_118 | Environmental | Open in IMG/M |
3300019881 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U3c2 | Environmental | Open in IMG/M |
3300020003 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L2a2 | Environmental | Open in IMG/M |
3300020060 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U2c2 | Environmental | Open in IMG/M |
3300020061 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U2c1 | Environmental | Open in IMG/M |
3300025165 | Soil microbial communities from Rifle, Colorado, USA - sediment 10ft 1 | Environmental | Open in IMG/M |
3300025324 | Soil microbial communities from Rifle, Colorado - Rifle CSP2_sed 10_1 (SPAdes) | Environmental | Open in IMG/M |
3300025326 | Soil microbial communities from Rifle, Colorado - Rifle CSP2_sed 16_2 (SPAdes) | Environmental | Open in IMG/M |
3300025537 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberryNW_CattailC_D1 (SPAdes) | Environmental | Open in IMG/M |
3300025791 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberryNW_TuleB_D2 (SPAdes) | Environmental | Open in IMG/M |
3300025795 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberryNW_TuleA_D2 (SPAdes) | Environmental | Open in IMG/M |
3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) | Environmental | Open in IMG/M |
3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025993 | Rice paddy soil microbial communities from Twitchell Island, California, USA - SF_Rice_20C_0N_404 (SPAdes) | Environmental | Open in IMG/M |
3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300026317 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_121 (SPAdes) | Environmental | Open in IMG/M |
3300026333 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_140 (SPAdes) | Environmental | Open in IMG/M |
3300026334 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_141 (SPAdes) | Environmental | Open in IMG/M |
3300027818 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P8 Core (1) Depth 19-21cm September2015 (SPAdes) | Environmental | Open in IMG/M |
3300027843 | Wetland sediment microbial communities from St. Louis River estuary, USA, under dissolved organic matter induced mercury methylation - T4Bare3Fresh (SPAdes) | Environmental | Open in IMG/M |
3300027873 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD1 (SPAdes) | Host-Associated | Open in IMG/M |
3300027874 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 1 MoBio (SPAdes) | Environmental | Open in IMG/M |
3300027886 | Agricultural soil microbial communities from Utah to study Nitrogen management - NC Compost (SPAdes) | Environmental | Open in IMG/M |
3300027890 | Wetland microbial communities from Old Woman Creek Reserve in Ohio, USA - Plant_0915_D1 (SPAdes) | Environmental | Open in IMG/M |
3300028809 | Soil microbial communities from agricultural site in Penn Yan, New York, United States - 13C_PalmiticAcid_Day48 | Environmental | Open in IMG/M |
3300030619 | Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT150D86 (Novaseq) | Environmental | Open in IMG/M |
3300031229 | Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT155D38 | Environmental | Open in IMG/M |
3300031573 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.AN111 | Environmental | Open in IMG/M |
3300031744 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.00H (v2) | Environmental | Open in IMG/M |
3300031854 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C48D1 | Environmental | Open in IMG/M |
3300031879 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.172 (v2) | Environmental | Open in IMG/M |
3300031942 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.LF176 | Environmental | Open in IMG/M |
3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Host-Associated | Open in IMG/M |
3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Host-Associated | Open in IMG/M |
3300032076 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111 (v2) | Environmental | Open in IMG/M |
3300032180 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515 | Environmental | Open in IMG/M |
3300034115 | Sediment microbial communities from East River floodplain, Colorado, United States - 29_s17 | Environmental | Open in IMG/M |
Geographical Distribution | |
---|---|
Zoom: | Powered by OpenStreetMap |
⦗Top⦘ |
Protein ID | Sample Taxon ID | Habitat | Sequence |
MRS1b_0971.00000380 | 2162886011 | Miscanthus Rhizosphere | LVKSVQAQGRHVGRKVNFEDIADDRLATEVAKEMGYKIP |
MBSR1b_0612.00001500 | 2162886012 | Miscanthus Rhizosphere | ILVKSVQAQGRHVGRKVNFEDIADDRLATEVAKEMGYKIP |
ICChiseqgaiiDRAFT_08563966 | 3300000033 | Soil | VKAIQAQGRHADRKVTFNEITDDRLATEVAKELGYKIP* |
ARCol0yngRDRAFT_10073452 | 3300000652 | Arabidopsis Rhizosphere | QSQGRHVDRKVAFNEIADDRLATEVAKELGYKIP* |
AF_2010_repII_A001DRAFT_101184662 | 3300000793 | Forest Soil | IQSQGRHVDRRVSFNDIADDRLATEVARELGYKIP* |
JGI10214J12806_115903492 | 3300000891 | Soil | LVKSVQAQGRHVGRKVSFEEIADDRLATEVAKEMGYKVP* |
JGI10216J12902_1007739461 | 3300000956 | Soil | TGMEILVKAIQSQGRFVDRKVSFNDIADDRLATEVAKELGYKMP* |
JGI10216J12902_1035367951 | 3300000956 | Soil | RTGMEILVKAIQSQGRFVDRKVSFNDIADDRLATEVAKELGYKIP* |
C687J26631_102774662 | 3300002124 | Soil | SRIGMEILVKAVQSQGRHLDKKVAFSDIADDRLATEVAKEMGYKIP* |
Ga0055471_101234612 | 3300003987 | Natural And Restored Wetlands | PSRTGMDILVKAIQSQGRHVDRKVSFTDIADDRLATEVAKELGYKIP* |
Ga0055485_102169681 | 3300004067 | Natural And Restored Wetlands | GMDILVKAIQSQGRHVDKKVTFTDIADDRLAIEVAKEMGYKIP* |
Ga0055488_100813092 | 3300004070 | Natural And Restored Wetlands | METLVKAIQSQGRHVDRKVSFTDIADDRLATEVAKELGYKIP* |
Ga0062589_1023590802 | 3300004156 | Soil | PTRGGMDILVKSVQAQGRHVGRKVSFEEIADDRLATEVAKEMGYKVP* |
Ga0070675_1009747181 | 3300005354 | Miscanthus Rhizosphere | GMDILVKSVQSQGRFVDRKVAFNDIADDRLATEVAREMGYKIP* |
Ga0066682_102274782 | 3300005450 | Soil | MEILVKAIQSQGRFVDRKVSFSDIADDRLATEVAREMGYKIQ* |
Ga0070699_1009903721 | 3300005518 | Corn, Switchgrass And Miscanthus Rhizosphere | GMDILVKSVQAQGRHVGRKVSFEEIADDRLATEVAKEMGYKVP* |
Ga0070684_1013353961 | 3300005535 | Corn Rhizosphere | RVGMDILVKSVQAQGRHVGRKVNFEDIADDRLATEVAKEMGYKIP* |
Ga0070697_1008601422 | 3300005536 | Corn, Switchgrass And Miscanthus Rhizosphere | LVRSLQAQGRFTDRKISFTEIADDRLATEVAKELGYKIP* |
Ga0075288_10374831 | 3300005874 | Rice Paddy Soil | TGIPTHIGMETLVKAIQAQGRHADRKVTFNEIADDRLATEVAKELGYKIP* |
Ga0075280_101365141 | 3300005904 | Rice Paddy Soil | METLVKAVQAQGRHVDRKVAFNEIADDRLAIEVAKELGYKIP* |
Ga0066658_100086235 | 3300006794 | Soil | RTGMEILVKAIQSQGRFVDRKVSFSDIADDRLATEVAREMGYKIQ* |
Ga0075421_1000104541 | 3300006845 | Populus Rhizosphere | SPTGIPTRVGMDILVKSVQSQGRHIDRKVAFNEIADDRLATEVAKELGYKIP* |
Ga0075431_1000664794 | 3300006847 | Populus Rhizosphere | IPSRTGMEILVKAIQSQGRFVDRKVSFNDIADDRLATEVAKELGYKMQ* |
Ga0075420_1008233282 | 3300006853 | Populus Rhizosphere | GMETLVKAVQSQGRHGERKVAFNEIADDRLATEVAKELGYKIP* |
Ga0075429_1004449801 | 3300006880 | Populus Rhizosphere | PTGIPSRTGMEILVKAIQSQGRFVDRKVSFNDIADDRLATEVAKELGYKMQ* |
Ga0075436_1002382041 | 3300006914 | Populus Rhizosphere | VQAQGRHVGRKVSFEEIADDRLATEVAKEMGYKVP* |
Ga0066710_1047704921 | 3300009012 | Grasslands Soil | ILVKAIQSQGRFVDRKVSFNEIADDRLATEVAKEMGYKIQ |
Ga0075418_100632031 | 3300009100 | Populus Rhizosphere | TGIPSRTGMEILVKAIQSQGRFVDRKVSFNDIADDRLATEVAKELGYKIP* |
Ga0075418_110260991 | 3300009100 | Populus Rhizosphere | SVQAQGRHVERKVAFNEIADDRLATEVAKELGYKIP* |
Ga0075418_118186961 | 3300009100 | Populus Rhizosphere | QSQGRHVDRKVSFTDIADDRLATEVAKELGYKIP* |
Ga0114129_105936101 | 3300009147 | Populus Rhizosphere | RQIMVKSVQSQVRHIDRKVSFTDIADDRLATEVAKELGYKIP* |
Ga0105092_109360382 | 3300009157 | Freshwater Sediment | STGIPSRTGMEILVQSVQAQGRHVDRKVAFSDIAADRLATEVEKELGYKLP* |
Ga0075423_101731191 | 3300009162 | Populus Rhizosphere | GMEILVKSVQSQGRHVDRKVSFTDIADDRLATEVAKELGYKIP* |
Ga0105340_12284591 | 3300009610 | Soil | IPSRTGMEILVKAVQSQGRHVDRKVSFTDIADDRLATEVAKELGYKIP* |
Ga0105340_12867321 | 3300009610 | Soil | IGMDILVKSVQSQGRFVDRKVAFYEIADDRLATEVAREMGYKIP* |
Ga0105088_10060401 | 3300009810 | Groundwater Sand | GIDNLVRSLQAQGRFTDRKISFTEIADDRLATEVAKELGYKTP* |
Ga0126382_115593642 | 3300010047 | Tropical Forest Soil | QSQGRHVDRRVSFNDIADDRLATEVARELGYKIP* |
Ga0134070_104011632 | 3300010301 | Grasslands Soil | MDNLVRSLQSQGRFTDRKISFTDLADDRLATEVAKEMGYKIP* |
Ga0126372_117541981 | 3300010360 | Tropical Forest Soil | SHTGMEILVKAIQSQGRFVDRKVAFTDIADDRLATEVAKEMGYKIP* |
Ga0126377_105624762 | 3300010362 | Tropical Forest Soil | SGMEILVKAIQSQGRHVDRKVSFNDIADDRLATEVAKELGYKIP* |
Ga0134124_106438461 | 3300010397 | Terrestrial Soil | NLVRSLQVQGRFTDRKVAFNDIADDRLATEVAKELGYKLP* |
Ga0124844_11882582 | 3300010868 | Tropical Forest Soil | KAIQSQGRHVDRRVSFNDIADDRLATEVARELGYKIP* |
Ga0137424_11155421 | 3300011412 | Soil | VQSQGRFVDRKVAFNEIADDRLATEVAREMGYKIP* |
Ga0137364_108287912 | 3300012198 | Vadose Zone Soil | GMYILVKSVHSHGRHLDRKVTFNEIADDRLATEVAKELGYKIP* |
Ga0137363_111210142 | 3300012202 | Vadose Zone Soil | GIENLVRSLQAQGRFTDRKISFTEIADDRLATEVAKELGYKIP* |
Ga0134045_13395842 | 3300012409 | Grasslands Soil | SLQSQGRFTDRKISFTDLADDRLATEVAKEMGYKIP* |
Ga0157282_101631732 | 3300012904 | Soil | QSQGRHLDKKVAFTDIADDRLATEVAKEMGYKIP* |
Ga0137394_111405112 | 3300012922 | Vadose Zone Soil | VKSVQSQGRHVDRKVSFNEIADDRLATEVAKEMGYKIP* |
Ga0126369_109074481 | 3300012971 | Tropical Forest Soil | GMEILVKAIQSQGRFVDRKVAFTDIADDRLATEVAKEMGYKIP* |
Ga0134110_100313023 | 3300012975 | Grasslands Soil | ILVKAIQSQGRFVDRKVSFNEIADDRLATEVAKEMG* |
Ga0134076_105377271 | 3300012976 | Grasslands Soil | TGMDILVKSVQSQGRHVDRKVAFNEIADDRLATEVAKEMGYKIP* |
Ga0164307_100092681 | 3300012987 | Soil | MDILVKSVQAQGRHVGRKVNFEDIADDRLATEVAKEMGYKIP* |
Ga0134072_100154071 | 3300015357 | Grasslands Soil | AIQSQGRFVDRKVSFSDIADDRLATEVAREMGYKIQ* |
Ga0132255_1013837952 | 3300015374 | Arabidopsis Rhizosphere | VKSVQSQGRHVDRTVAFNDIADDRLATEVAKELGYKIP* |
Ga0132255_1013944961 | 3300015374 | Arabidopsis Rhizosphere | LGMDILVKSVQSQGRHVDRKVAFNDIADDRLATEVAKELGYKIP* |
Ga0182035_113835752 | 3300016341 | Soil | RIGMEILVKSVQAQGRFVDRKVAFNEIADDRLATEVAKEMGYKMP |
Ga0134112_104717082 | 3300017656 | Grasslands Soil | SRTGMETLVKAIQSQGRFVGRNVSFADVADDRLATEVARELGYKIQ |
Ga0187785_104675871 | 3300017947 | Tropical Peatland | PTRVGMEILVKSVQSQGRFVDRKVNFNEIADDRLATEVAKEMGYKIP |
Ga0190265_115119462 | 3300018422 | Soil | TGIPTRVGMDILVKSVQAQGRHVDRKVAFNEIADDRLATEVAKELGYKIP |
Ga0190265_125986601 | 3300018422 | Soil | DILVKSVQAQGRHVGRKVAFEELADDRLATEVAKELGYKIP |
Ga0066655_103658281 | 3300018431 | Grasslands Soil | AIQSQGRFVDRKVSFNEIADDRLATEVAKEMGYKIQ |
Ga0190275_107120821 | 3300018432 | Soil | SRIGMETLVKAVQSQGRHGDRKVGFNEIADDRLATEVAKELGYKIP |
Ga0066669_105152441 | 3300018482 | Grasslands Soil | PTRVGMDILVKSVQSQGRHVDCKVAFNEIADDRLATEVAKEMGYKIP |
Ga0066669_122747691 | 3300018482 | Grasslands Soil | MEILVKAIQSQGRFVDRKVSFSDIADDRLATEVAREMGYKIQ |
Ga0193707_11937661 | 3300019881 | Soil | PTGIPTRIGMDILVTSVQSQGRHVDRKVAFNEIADDRLATEVAREMGYKIP |
Ga0193739_10512581 | 3300020003 | Soil | KSVQSQGRHVDRKVAFNEIADDRLATEVAREMGYKIP |
Ga0193717_10613582 | 3300020060 | Soil | DILVKSVQAQGRHVDRKVAFNEIADDRLATEVARELGYKIP |
Ga0193716_12328792 | 3300020061 | Soil | TRVGMDILVKSVQAQGRHVGRKVAFEEIADDRLATEVAKELGYKIP |
Ga0209108_106124841 | 3300025165 | Soil | IQSQGRHVDKKVAFTDVADDRLAIEVAKEMGYKIP |
Ga0209640_111461002 | 3300025324 | Soil | SRTGMEILVRSIQSQGRHVDKKVAFSDVADDRLAIEVAREMGYKIP |
Ga0209342_112322982 | 3300025326 | Soil | VQSQGRHLDKKVAFSDIADDRLATEVAKEMGYKIP |
Ga0210061_10485782 | 3300025537 | Natural And Restored Wetlands | TGIPSRVGMETLVKAVQAQGRHVDRKVAFNEIADDRLAIEVAKELGYKIP |
Ga0210115_11252402 | 3300025791 | Natural And Restored Wetlands | GMDILVKAIQSQGRHVDRKVSFTDIADDRLATEVAKELGYKIP |
Ga0210114_10993702 | 3300025795 | Natural And Restored Wetlands | VQAQGRHVDRKVAFTDIADDRLATEVAKELGYRLP |
Ga0207680_108814292 | 3300025903 | Switchgrass Rhizosphere | VPTRVGMDILVKSIQSQGRHTDKKVAFTDIADDRLATEVAREMGYKVQ |
Ga0207707_114467521 | 3300025912 | Corn Rhizosphere | VQAQGRHVGRKVAFEEIADDRLATEVAKELGYKIP |
Ga0207649_104317491 | 3300025920 | Corn Rhizosphere | RVGMDILVKSVQAQGRHVGRKVNFEDIADDRLATEVAKEMGYKIP |
Ga0208415_10236972 | 3300025993 | Rice Paddy Soil | TLVKAIQAQGRHADRKVTFNEIADDRLATEVAKELGYKIP |
Ga0207674_104805021 | 3300026116 | Corn Rhizosphere | SVQAQGRHVGRKVSFEEIADDRLATEVAKEMGYKVP |
Ga0209154_10040699 | 3300026317 | Soil | SPSGIPSRTGMEILVKAIQSQGRFVDRKVSFSDIADDRLATEVAREMGYKIQ |
Ga0209158_11660071 | 3300026333 | Soil | LVRSLQSQGRFTDRKISFTDLADDRLASEVAKEMGYKIP |
Ga0209377_10049101 | 3300026334 | Soil | LVRSLQSQGRFTDRKISFTDLADDRLATEVAKEMGYKIP |
Ga0209706_104517982 | 3300027818 | Freshwater Sediment | VQSQGRHVDKKVAFTDIADDRLATEVAREMGYKIP |
Ga0209798_103474081 | 3300027843 | Wetland Sediment | TTGVPTRAGMEILVKSVQSQGRHLDKKPAFTDIADDRLALEVAKEMGYKIP |
Ga0209814_100325291 | 3300027873 | Populus Rhizosphere | RTGMEILVKAIQSQGRFVDRKVSFNDIADDRLATEVAKELGYKIP |
Ga0209465_100964593 | 3300027874 | Tropical Forest Soil | VKAIQSQGRHVDRKVSFNDIADDRLATEVARELGYKIP |
Ga0209486_104649622 | 3300027886 | Agricultural Soil | TGMETLVKAVQSQGRHGDRKVAFNEIADDRLATEVAKELGYKIP |
Ga0209496_106739421 | 3300027890 | Wetland | RIGMDILVKSVQSQGRHVDKKVAFTDIADDRLATEVAREMGYKIP |
Ga0247824_103610662 | 3300028809 | Soil | ETLVKAVQSQGRHGERKVAFNEIADDRLATEVAKELGYKIP |
Ga0268386_102314762 | 3300030619 | Soil | TGIPSRIGMEILVKSVQAQGRHVDRKVAFTDIADDRLATEVAKELGYKLP |
Ga0299913_113880071 | 3300031229 | Soil | RIGMETLVKAVQSQGRFVDRNVAFNEIADDRLATEVAKEMGYKIP |
Ga0310915_110879632 | 3300031573 | Soil | SVQAQGRFVDRKVAFNEIADDRLATEVAKEMGYKMP |
Ga0306918_108365231 | 3300031744 | Soil | GIPSRSGMEILVKAIQSQGRFVDRKVSFSDIADDRLATEVAKELGYKIP |
Ga0310904_105103182 | 3300031854 | Soil | ILVKSVLSLVRHIDRIVAFNEIAYYRLATEVAKELGYKIP |
Ga0306919_104854502 | 3300031879 | Soil | PSRSGMEILVKAIQSQGRFVDRKVFFSDIADDRLATEVAKELGYKIP |
Ga0310916_116920382 | 3300031942 | Soil | KSVQAQGRFVDRKVAFNEIADDRLATEVAKEMGYKMP |
Ga0307416_1018899942 | 3300032002 | Rhizosphere | METLVKAVQSQGRHGDRKVAFNEIADDRLATEVAKELGY |
Ga0307414_119333222 | 3300032004 | Rhizosphere | PTRVGMDILVKSVQAQGRHVGRKVAFEEIADERLATEVAKELGYKVP |
Ga0306924_104753413 | 3300032076 | Soil | SPTGIPSRSGMEILVKAIQSQGRFVDRKVSFSDIADDRLATEVAKELGYKIP |
Ga0307471_1003551353 | 3300032180 | Hardwood Forest Soil | TGMEILVKAIQSQGRFVDRKVAFTDVADDRLATEVAKEMGYKIPQ |
Ga0307471_1028240032 | 3300032180 | Hardwood Forest Soil | KAIQSQGRFVDRKVSFNDIADDRLATEVAKELGYKIP |
Ga0364945_0069119_36_164 | 3300034115 | Sediment | MDILVKSVQSQGRHVDRKVAFTDIADDRLATEVAKEMGYKIP |
⦗Top⦘ |