NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F100807

Metagenome / Metatranscriptome Family F100807

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F100807
Family Type Metagenome / Metatranscriptome
Number of Sequences 102
Average Sequence Length 41 residues
Representative Sequence RDKLRYEVVVNFVDKDRIRGYLSAPKDKVLSAERPQFRPE
Number of Associated Samples 86
Number of Associated Scaffolds 102

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 3.96 %
% of genes near scaffold ends (potentially truncated) 93.14 %
% of genes from short scaffolds (< 2000 bps) 85.29 %
Associated GOLD sequencing projects 84
AlphaFold2 3D model prediction Yes
3D model pTM-score0.19

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (96.078 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil
(19.608 % of family members)
Environment Ontology (ENVO) Unclassified
(42.157 % of family members)
Earth Microbiome Project Ontology (EMPO) Free-living → Non-saline → Soil (non-saline)
(63.725 % of family members)


 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      

 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 0.00%    β-sheet: 22.06%    Coil/Unstructured: 77.94%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  		pTM-score: 0.19
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.

 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 102 Family Scaffolds
PF00265TK 5.88
PF02965Met_synt_B12 4.90
PF00582Usp 2.94
PF04551GcpE 1.96
PF13709DUF4159 1.96
PF01425Amidase 1.96
PF13240zinc_ribbon_2 0.98
PF01878EVE 0.98
PF07883Cupin_2 0.98
PF02518HATPase_c 0.98
PF07676PD40 0.98
PF02274ADI 0.98
PF13463HTH_27 0.98
PF00580UvrD-helicase 0.98
PF01497Peripla_BP_2 0.98
PF03372Exo_endo_phos 0.98
PF00211Guanylate_cyc 0.98
PF07786HGSNAT_cat 0.98
PF00578AhpC-TSA 0.98
PF00034Cytochrom_C 0.98
PF01979Amidohydro_1 0.98
PF02812ELFV_dehydrog_N 0.98

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 102 Family Scaffolds
COG1435Thymidine kinaseNucleotide transport and metabolism [F] 5.88
COG1410Methionine synthase I, cobalamin-binding domainAmino acid transport and metabolism [E] 4.90
COG08214-hydroxy-3-methylbut-2-enyl diphosphate synthase IspG/GcpELipid transport and metabolism [I] 1.96
COG0154Asp-tRNAAsn/Glu-tRNAGln amidotransferase A subunit or related amidaseTranslation, ribosomal structure and biogenesis [J] 1.96
COG2114Adenylate cyclase, class 3Signal transduction mechanisms [T] 0.98
COG4874Uncharacterized conserved proteinFunction unknown [S] 0.98
COG4607ABC-type enterochelin transport system, periplasmic componentInorganic ion transport and metabolism [P] 0.98
COG4594ABC-type Fe3+-citrate transport system, periplasmic componentInorganic ion transport and metabolism [P] 0.98
COG4592ABC-type Fe2+-enterobactin transport system, periplasmic componentInorganic ion transport and metabolism [P] 0.98
COG4558ABC-type hemin transport system, periplasmic componentInorganic ion transport and metabolism [P] 0.98
COG3973DNA helicase IVReplication, recombination and repair [L] 0.98
COG3503Uncharacterized membrane protein, DUF1624 familyFunction unknown [S] 0.98
COG2947Predicted RNA-binding protein, contains EVE domainGeneral function prediction only [R] 0.98
COG2235Arginine deiminaseAmino acid transport and metabolism [E] 0.98
COG1834N-Dimethylarginine dimethylaminohydrolaseAmino acid transport and metabolism [E] 0.98
COG1673Predicted RNA-binding protein, contains PUA-like EVE domainGeneral function prediction only [R] 0.98
COG10743’-5’ helicase subunit RecB of the DNA repair enzyme RecBCD (exonuclease V)Replication, recombination and repair [L] 0.98
COG0614ABC-type Fe3+-hydroxamate transport system, periplasmic componentInorganic ion transport and metabolism [P] 0.98
COG0334Glutamate dehydrogenase/leucine dehydrogenaseAmino acid transport and metabolism [E] 0.98
COG0210Superfamily I DNA or RNA helicaseReplication, recombination and repair [L] 0.98

 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms96.08 %
UnclassifiedrootN/A3.92 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
2170459013|GO6OHWN02G8RHDAll Organisms → cellular organisms → Bacteria → Acidobacteria534Open in IMG/M
3300000559|F14TC_101820559All Organisms → cellular organisms → Bacteria1686Open in IMG/M
3300000955|JGI1027J12803_109338004All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia864Open in IMG/M
3300005166|Ga0066674_10134610All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1161Open in IMG/M
3300005172|Ga0066683_10107106All Organisms → cellular organisms → Bacteria → Acidobacteria1699Open in IMG/M
3300005186|Ga0066676_10542796All Organisms → cellular organisms → Bacteria788Open in IMG/M
3300005293|Ga0065715_10874835All Organisms → cellular organisms → Bacteria583Open in IMG/M
3300005332|Ga0066388_104499786All Organisms → cellular organisms → Bacteria → Acidobacteria710Open in IMG/M
3300005332|Ga0066388_107784996Not Available536Open in IMG/M
3300005354|Ga0070675_102114461All Organisms → cellular organisms → Bacteria519Open in IMG/M
3300005434|Ga0070709_10785201All Organisms → cellular organisms → Bacteria746Open in IMG/M
3300005446|Ga0066686_11007010All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter541Open in IMG/M
3300005447|Ga0066689_10129703All Organisms → cellular organisms → Bacteria → Acidobacteria1480Open in IMG/M
3300005456|Ga0070678_100761893All Organisms → cellular organisms → Bacteria876Open in IMG/M
3300005529|Ga0070741_11212265All Organisms → cellular organisms → Bacteria → Acidobacteria636Open in IMG/M
3300005555|Ga0066692_10138821All Organisms → cellular organisms → Bacteria → Acidobacteria1483Open in IMG/M
3300005555|Ga0066692_10907574All Organisms → cellular organisms → Bacteria540Open in IMG/M
3300005568|Ga0066703_10196819All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1222Open in IMG/M
3300005598|Ga0066706_10476566All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium994Open in IMG/M
3300005764|Ga0066903_101504518All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiaceae → unclassified Burkholderiaceae → Burkholderiaceae bacterium1271Open in IMG/M
3300005842|Ga0068858_102433515All Organisms → cellular organisms → Bacteria517Open in IMG/M
3300006031|Ga0066651_10174331All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1134Open in IMG/M
3300006031|Ga0066651_10185647All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1098Open in IMG/M
3300006796|Ga0066665_10102604All Organisms → cellular organisms → Bacteria2100Open in IMG/M
3300006844|Ga0075428_100518031All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1276Open in IMG/M
3300006845|Ga0075421_100395593All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1660Open in IMG/M
3300006845|Ga0075421_102732843All Organisms → cellular organisms → Bacteria → Acidobacteria509Open in IMG/M
3300006854|Ga0075425_101050869All Organisms → cellular organisms → Bacteria928Open in IMG/M
3300006880|Ga0075429_100538197All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae1023Open in IMG/M
3300006880|Ga0075429_101498199All Organisms → cellular organisms → Bacteria → Acidobacteria587Open in IMG/M
3300007076|Ga0075435_101400109All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium613Open in IMG/M
3300009012|Ga0066710_100252183All Organisms → cellular organisms → Bacteria → Acidobacteria2554Open in IMG/M
3300009012|Ga0066710_100274656All Organisms → cellular organisms → Bacteria2453Open in IMG/M
3300009012|Ga0066710_104822784All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium 13_1_40CM_56_16504Open in IMG/M
3300009147|Ga0114129_12234404All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium658Open in IMG/M
3300009147|Ga0114129_12489922All Organisms → cellular organisms → Bacteria → Acidobacteria619Open in IMG/M
3300010048|Ga0126373_11302508All Organisms → cellular organisms → Bacteria → Acidobacteria792Open in IMG/M
3300010085|Ga0127445_1091713All Organisms → cellular organisms → Bacteria903Open in IMG/M
3300010098|Ga0127463_1066275All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium509Open in IMG/M
3300010102|Ga0127453_1036459All Organisms → cellular organisms → Bacteria → Acidobacteria514Open in IMG/M
3300010112|Ga0127458_1045294All Organisms → cellular organisms → Bacteria → Acidobacteria855Open in IMG/M
3300010126|Ga0127482_1084628All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium511Open in IMG/M
3300010132|Ga0127455_1021158All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia593Open in IMG/M
3300010304|Ga0134088_10024050All Organisms → cellular organisms → Bacteria → Acidobacteria2719Open in IMG/M
3300010329|Ga0134111_10171475All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium867Open in IMG/M
3300010329|Ga0134111_10522890All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium 13_1_40CM_56_16523Open in IMG/M
3300010336|Ga0134071_10295455All Organisms → cellular organisms → Bacteria → Acidobacteria813Open in IMG/M
3300010366|Ga0126379_11322168All Organisms → cellular organisms → Bacteria827Open in IMG/M
3300010366|Ga0126379_13631580All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium517Open in IMG/M
3300010366|Ga0126379_13656334Not Available515Open in IMG/M
3300010397|Ga0134124_11687672All Organisms → cellular organisms → Bacteria → Acidobacteria665Open in IMG/M
3300010398|Ga0126383_11064289All Organisms → cellular organisms → Bacteria → Acidobacteria898Open in IMG/M
3300010399|Ga0134127_10913675All Organisms → cellular organisms → Bacteria → Acidobacteria934Open in IMG/M
3300010401|Ga0134121_10590250All Organisms → cellular organisms → Bacteria → Acidobacteria1038Open in IMG/M
3300011416|Ga0137422_1052872All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium973Open in IMG/M
3300012038|Ga0137431_1014725All Organisms → cellular organisms → Bacteria → Acidobacteria2137Open in IMG/M
3300012173|Ga0137327_1046829All Organisms → cellular organisms → Bacteria → Acidobacteria944Open in IMG/M
3300012206|Ga0137380_10117431All Organisms → cellular organisms → Bacteria2430Open in IMG/M
3300012207|Ga0137381_11722179All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium517Open in IMG/M
3300012349|Ga0137387_10040820All Organisms → cellular organisms → Bacteria → Acidobacteria3049Open in IMG/M
3300012373|Ga0134042_1183549All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium849Open in IMG/M
3300012395|Ga0134044_1088905All Organisms → cellular organisms → Bacteria866Open in IMG/M
3300012402|Ga0134059_1117925All Organisms → cellular organisms → Bacteria → Acidobacteria819Open in IMG/M
3300012410|Ga0134060_1286031All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium 13_1_40CM_56_16552Open in IMG/M
3300012916|Ga0157310_10006751All Organisms → cellular organisms → Bacteria2660Open in IMG/M
3300012948|Ga0126375_10290809All Organisms → cellular organisms → Bacteria1129Open in IMG/M
3300012948|Ga0126375_11374390All Organisms → cellular organisms → Bacteria → Acidobacteria597Open in IMG/M
3300013296|Ga0157374_10082652All Organisms → cellular organisms → Bacteria3050Open in IMG/M
3300013306|Ga0163162_12348214All Organisms → cellular organisms → Bacteria → Acidobacteria613Open in IMG/M
3300014150|Ga0134081_10301571All Organisms → cellular organisms → Bacteria575Open in IMG/M
3300014325|Ga0163163_10615428All Organisms → cellular organisms → Bacteria1149Open in IMG/M
3300014326|Ga0157380_11482276All Organisms → cellular organisms → Bacteria → Acidobacteria731Open in IMG/M
3300015371|Ga0132258_11045906All Organisms → cellular organisms → Bacteria → Acidobacteria2063Open in IMG/M
3300015371|Ga0132258_13744090All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1037Open in IMG/M
3300016445|Ga0182038_11349328All Organisms → cellular organisms → Bacteria → Acidobacteria638Open in IMG/M
3300017654|Ga0134069_1158895All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium758Open in IMG/M
3300017656|Ga0134112_10040405All Organisms → cellular organisms → Bacteria1666Open in IMG/M
3300018431|Ga0066655_10909058Not Available602Open in IMG/M
3300018433|Ga0066667_10246380All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1351Open in IMG/M
3300018482|Ga0066669_11332643All Organisms → cellular organisms → Bacteria → Acidobacteria650Open in IMG/M
3300019361|Ga0173482_10567816All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium564Open in IMG/M
3300019458|Ga0187892_10347404All Organisms → cellular organisms → Bacteria → Acidobacteria722Open in IMG/M
3300020170|Ga0179594_10265633All Organisms → cellular organisms → Bacteria → Acidobacteria648Open in IMG/M
3300021405|Ga0210387_11857688All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium506Open in IMG/M
3300025928|Ga0207700_11004925All Organisms → cellular organisms → Bacteria746Open in IMG/M
3300025930|Ga0207701_10215324All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1684Open in IMG/M
3300025941|Ga0207711_10550552All Organisms → cellular organisms → Bacteria → Acidobacteria1076Open in IMG/M
3300026089|Ga0207648_11937931All Organisms → cellular organisms → Bacteria → Acidobacteria551Open in IMG/M
3300026142|Ga0207698_11091106All Organisms → cellular organisms → Bacteria → Acidobacteria811Open in IMG/M
3300026329|Ga0209375_1044456All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium2265Open in IMG/M
3300026343|Ga0209159_1212120All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia606Open in IMG/M
3300026528|Ga0209378_1176834All Organisms → cellular organisms → Bacteria → Acidobacteria780Open in IMG/M
3300026528|Ga0209378_1288557All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium524Open in IMG/M
3300026536|Ga0209058_1060252All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Sumerlaeota → unclassified Candidatus Sumerlaeota → candidate division BRC1 bacterium ADurb.BinA2922097Open in IMG/M
3300026540|Ga0209376_1379799All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium 13_1_40CM_56_16529Open in IMG/M
3300026548|Ga0209161_10557260All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium511Open in IMG/M
3300027654|Ga0209799_1050639All Organisms → cellular organisms → Bacteria → Acidobacteria929Open in IMG/M
3300027873|Ga0209814_10039527All Organisms → cellular organisms → Bacteria1960Open in IMG/M
3300027909|Ga0209382_11753806All Organisms → cellular organisms → Bacteria → Acidobacteria607Open in IMG/M
3300032157|Ga0315912_10022049All Organisms → cellular organisms → Bacteria5207Open in IMG/M
3300032157|Ga0315912_10090845All Organisms → cellular organisms → Bacteria2392Open in IMG/M


 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Soil19.61%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil16.67%
Populus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere10.78%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil6.86%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil5.88%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil4.90%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil3.92%
Vadose Zone SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil3.92%
SoilEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Soil2.94%
Terrestrial SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil2.94%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere1.96%
Arabidopsis RhizosphereHost-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere1.96%
Surface SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil0.98%
Grass SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Grass Soil0.98%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Corn, Switchgrass And Miscanthus Rhizosphere0.98%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil0.98%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil0.98%
SoilEnvironmental → Terrestrial → Soil → Loam → Grasslands → Soil0.98%
Bio-OozeEnvironmental → Terrestrial → Cave → Unclassified → Unclassified → Bio-Ooze0.98%
Miscanthus RhizosphereHost-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Miscanthus Rhizosphere0.98%
Corn RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere0.98%
Switchgrass RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere0.98%
Miscanthus RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere0.98%
Switchgrass RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere0.98%
Miscanthus RhizosphereHost-Associated → Plants → Rhizoplane → Soil → Unclassified → Miscanthus Rhizosphere0.98%
Switchgrass RhizosphereHost-Associated → Plants → Roots → Rhizosphere → Soil → Switchgrass Rhizosphere0.98%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere0.98%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere0.98%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere0.98%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere0.98%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
2170459013Grass soil microbial communities from Rothamsted Park, UK - July 2010 direct MP BIO 1O1 lysis soil at the rocks surface 0-21cmEnvironmentalOpen in IMG/M
3300000559Amended soil microbial communities from Kansas Great Prairies, USA - control no BrdU total DNA F1.4 TC clc assemlyEnvironmentalOpen in IMG/M
3300000955Soil microbial communities from Great Prairies - Iowa, Native Prairie soilEnvironmentalOpen in IMG/M
3300005166Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_123EnvironmentalOpen in IMG/M
3300005172Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_132EnvironmentalOpen in IMG/M
3300005186Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_125EnvironmentalOpen in IMG/M
3300005293Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1Host-AssociatedOpen in IMG/M
3300005332Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly)EnvironmentalOpen in IMG/M
3300005354Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaGHost-AssociatedOpen in IMG/M
3300005434Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaGEnvironmentalOpen in IMG/M
3300005446Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_135EnvironmentalOpen in IMG/M
3300005447Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_138EnvironmentalOpen in IMG/M
3300005456Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaGHost-AssociatedOpen in IMG/M
3300005529Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen16_06102014_R1EnvironmentalOpen in IMG/M
3300005555Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_141EnvironmentalOpen in IMG/M
3300005568Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_152EnvironmentalOpen in IMG/M
3300005598Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_155EnvironmentalOpen in IMG/M
3300005764Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2)EnvironmentalOpen in IMG/M
3300005842Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2Host-AssociatedOpen in IMG/M
3300006031Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Angelo_100EnvironmentalOpen in IMG/M
3300006796Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_114EnvironmentalOpen in IMG/M
3300006844Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2Host-AssociatedOpen in IMG/M
3300006845Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD5Host-AssociatedOpen in IMG/M
3300006854Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD4Host-AssociatedOpen in IMG/M
3300006880Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3Host-AssociatedOpen in IMG/M
3300007076Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4Host-AssociatedOpen in IMG/M
3300009012Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_159EnvironmentalOpen in IMG/M
3300009147Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2)Host-AssociatedOpen in IMG/M
3300010048Tropical forest soil microbial communities from Panama - MetaG Plot_11EnvironmentalOpen in IMG/M
3300010085Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Wat_40_2_0_1 metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300010098Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Met_20_2_4_1 metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300010102Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Wat_40_5_4_1 metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300010112Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Wat_40_5_4_2 metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300010126Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Met_40_2_0_1 metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300010132Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Wat_40_5_16_1 metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300010304Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_5_09182015EnvironmentalOpen in IMG/M
3300010329Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_2_11112015EnvironmentalOpen in IMG/M
3300010336Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_5_09082015EnvironmentalOpen in IMG/M
3300010366Tropical forest soil microbial communities from Panama - MetaG Plot_24EnvironmentalOpen in IMG/M
3300010397Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-4EnvironmentalOpen in IMG/M
3300010398Tropical forest soil microbial communities from Panama - MetaG Plot_35EnvironmentalOpen in IMG/M
3300010399Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-3EnvironmentalOpen in IMG/M
3300010401Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-1EnvironmentalOpen in IMG/M
3300011416Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMZT551_2EnvironmentalOpen in IMG/M
3300012038Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMZT800_2EnvironmentalOpen in IMG/M
3300012173Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMZT517_2EnvironmentalOpen in IMG/M
3300012206Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_100_16 metaGEnvironmentalOpen in IMG/M
3300012207Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_115_16 metaGEnvironmentalOpen in IMG/M
3300012349Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Sage2_R_115_16 metaGEnvironmentalOpen in IMG/M
3300012373Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Glu_40cm_2_0_1 metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300012395Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Glu_40cm_2_8_1 metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300012402Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Glu_40cm_5_8_2 metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300012410Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Glu_40cm_5_16_2 metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300012916Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S213-509R-2EnvironmentalOpen in IMG/M
3300012948Tropical forest soil microbial communities from Panama - MetaG Plot_14EnvironmentalOpen in IMG/M
3300013296Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaGHost-AssociatedOpen in IMG/M
3300013306Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaGHost-AssociatedOpen in IMG/M
3300014150Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Met_20cm_5_24_1 metaGEnvironmentalOpen in IMG/M
3300014325Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaGHost-AssociatedOpen in IMG/M
3300014326Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaGHost-AssociatedOpen in IMG/M
3300015371Combined assembly of cpr5 and col0 rhizosphere and soilHost-AssociatedOpen in IMG/M
3300016445Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108EnvironmentalOpen in IMG/M
3300017654Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_40cm_2_24_1 metaGEnvironmentalOpen in IMG/M
3300017656Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_5_11112015EnvironmentalOpen in IMG/M
3300018431Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_104EnvironmentalOpen in IMG/M
3300018433Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_116EnvironmentalOpen in IMG/M
3300018482Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_118EnvironmentalOpen in IMG/M
3300019361Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S133-311R-2 (version 2)EnvironmentalOpen in IMG/M
3300019458Bio-ooze microbial communities from a basaltic lava cave in the Kipuka Kanohina Cave System on the Island of Hawaii, USA - MA170107-3 metaGEnvironmentalOpen in IMG/M
3300020170Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad1_1_08_16fungal (Illumina Assembly)EnvironmentalOpen in IMG/M
3300021405Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-OEnvironmentalOpen in IMG/M
3300025928Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025930Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes)EnvironmentalOpen in IMG/M
3300025941Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300026089Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026142Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026329Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_131 (SPAdes)EnvironmentalOpen in IMG/M
3300026343Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_144 (SPAdes)EnvironmentalOpen in IMG/M
3300026528Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_156 (SPAdes)EnvironmentalOpen in IMG/M
3300026536Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_147 (SPAdes)EnvironmentalOpen in IMG/M
3300026540Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_134 (SPAdes)EnvironmentalOpen in IMG/M
3300026548Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_155 (SPAdes)EnvironmentalOpen in IMG/M
3300027654Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 36 MoBio (SPAdes)EnvironmentalOpen in IMG/M
3300027873Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD1 (SPAdes)Host-AssociatedOpen in IMG/M
3300027909Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD5 (SPAdes)Host-AssociatedOpen in IMG/M
3300032157Garden soil microbial communities collected in Santa Monica, California, United States - V. faba soilEnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap


 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
N57_051068002170459013Grass SoilFLVGRDRLRYEFVVNYVDKDRIRGYLSTPKDKVLAAEAGRRF
F14TC_10182055913300000559SoilEFVVYSVDKDRVRGYISTPKDKLVAAENPLQRRLQ*
JGI1027J12803_10933800413300000955SoilPVTFLVGKDRLRYEFVVNSVDKDRIRGYVSTPKDKVLAVEGPSTVQHPD*
Ga0066674_1013461023300005166SoilMFLVGPDRLRYELVVNYVDKDRIRAYLSTPKAPKDKTLAAEGPSFRRLQ*
Ga0066683_1010710633300005172SoilPVQFMVGHDQLRYEMVINAVNKDRIQGYLSTPKDKVLSAERTTQVKR*
Ga0066676_1054279613300005186SoilEQLRYEVVVNSVEKDRIRGYVSAPKDKVLSAEVPRFRLQ*
Ga0065715_1087483513300005293Miscanthus RhizosphereLVGREKLRYEIVVNVVDKDRIRGYLSAPKDKVLSAERPAFK*
Ga0066388_10449978623300005332Tropical Forest SoilLVGKDRLRYELVVYSVDKDRIRGYLSTPKDKTLSAEGPSFRH*
Ga0066388_10777700023300005332Tropical Forest SoilANEPVTFLVGHDRVRYEFVVFSVDKDRIRGYISTPKDKLVAAENPLQRRLQ*
Ga0066388_10778499613300005332Tropical Forest SoilHDRVRYEFVVFTVDKDRIHGYISTPKDKLVAAESPLQRRLQ*
Ga0070675_10211446113300005354Miscanthus RhizosphereLVGQSHVRYELVVNAVEKDRIRGYVSTPKDVVLSAEGPNARQ*
Ga0070709_1078520133300005434Corn, Switchgrass And Miscanthus RhizosphereFLVGREQLRYEVVVNSVEKDRIRGYMSAPKDKSLSAEIPQFRQQ*
Ga0066686_1100701013300005446SoilLVGRDKLRYEIVVNYVDKDRIRGYLSAPKDKVLAAERPAFRPE*
Ga0066689_1012970313300005447SoilGHDQLRYEMVINAVNKDRIQGYLSTPKDKVLSAEGPTQLKR*
Ga0070678_10076189313300005456Miscanthus RhizosphereLLIGQNHVRYELVVNSVEKDRIRGYISAPKDVVLSAEGPTSR*
Ga0070741_1121226523300005529Surface SoilVGRDQLRYEVVVNSVEKDRIRGYVSAPKDKTLAAEIPRFRE*
Ga0066692_1013882133300005555SoilVGHDQLRYEMVINAVNKDRIQGYLSTPKDKVLSAERTTQVKR*
Ga0066692_1090757413300005555SoilYEFVVNYVDKDRIRGYLSTPKDKTLAAEGPSRQRF*
Ga0066703_1019681933300005568SoilFVVNYVDKDRIRGYLSTPKDKTLSAEGPNFRRLQ*
Ga0066706_1047656623300005598SoilMFLVGPDRLRYELVVNYVDKDRIRGYLSTPKAPKDKTLAAEGPSFRRLQ*
Ga0066903_10150451823300005764Tropical Forest SoilYEFVVNSVDKDRIRGYLSTPKDRLTVAETPASLRVR*
Ga0068858_10243351513300005842Switchgrass RhizosphereQFLVGRDKLRYEIVVNIVDKDRIRGYLSAPKDKSLAAERPAAR*
Ga0066651_1017433123300006031SoilNYVDKDRIRGYLSTPKAPKDKTLAAEGPSFRRLQ*
Ga0066651_1018564713300006031SoilELVVNFVDKDRVRGYLSTPKDKTFSAEGPSTRRLQ*
Ga0066665_1010260433300006796SoilQLRYEVVVNSVEKDRIRGYVSAPKDKVLSAEVPRFRLQ*
Ga0075428_10051803113300006844Populus RhizosphereVRYEFVVYSVDKDRIRGYISTPKDKLVAAENPVQRRLQ*
Ga0075421_10039559333300006845Populus RhizosphereRYEFVVYSVDKDRIRGYISTPKDKLVAAENPLQRRLQ*
Ga0075421_10273284313300006845Populus RhizosphereEPVTFLVGRDRLRYEIVVNYVDKDRIRGYMSTPKDKMLSAEGPTLRRER*
Ga0075425_10105086913300006854Populus RhizosphereFLVGRDRARYEFVVNFVDKDRIRGYISTPKDKLVASETPTLRVR*
Ga0075429_10053819733300006880Populus RhizosphereLRYEVVVNSVEKDRIRGYVSAPKDKVLSAEGPKFRAQ*
Ga0075429_10149819923300006880Populus RhizosphereEFVVYSVDKDRIRGYISTPKDKLVAAENPLQRRLQ*
Ga0075435_10140010923300007076Populus RhizosphereELVVNYVDKDRIRGYLSTPKDKVLSAEAPALRRAQ*
Ga0066710_10025218333300009012Grasslands SoilYEFVVNYVDKDRIRGYMSTPKDRLVAAETPTLRVQ
Ga0066710_10027465613300009012Grasslands SoilLRYEVVVNAVDKDRIRGYVSTPKDKVLAAEAPQFRLQ
Ga0066710_10482278413300009012Grasslands SoilEPVQFMVGHDQLRYEMVINAVNKDRIQGYLSTPKDKVLSAEGPTQLKR
Ga0114129_1223440413300009147Populus RhizosphereVGRDRLRYEIVVNYVDKDRIRGYMSTPKDKLLSAEGPTLRRER*
Ga0114129_1248992223300009147Populus RhizosphereQFLVGRDELRYEVVVNSVEKDRIRGYVSAPKDKVLSAEGPKFRAQ*
Ga0126373_1130250813300010048Tropical Forest SoilGSDHLRYEFVVNSVDRDHIKGYLSTPKDKILSAEAPRAKLQ*
Ga0127445_109171323300010085Grasslands SoilLRYELVVNSVDKDRIRGYLSVPKDKVLASEVPVLRQ*
Ga0127463_106627513300010098Grasslands SoilGHDQLRYEMVINAVNKDRIQGYLSTPKDKVLSAEGPTKQTKR*
Ga0127453_103645913300010102Grasslands SoilRDQLRYELVVNSVDKDRIRGYLSVPKDKVLASEVPILRQ*
Ga0127458_104529423300010112Grasslands SoilVGHDQLRYEMVINAVNKDRIQGYLSTPKDKVLSAEGPTKQTKR*
Ga0127482_108462823300010126Grasslands SoilLVGHDQLRYEMVINAVNKDRIQGYLSTPKDKVLSAEGPTKQTKR*
Ga0127455_102115813300010132Grasslands SoilDQLRYELVVNSVDKDRIRGYLSVPKDKVLASEVPVLRQ*
Ga0134088_1002405013300010304Grasslands SoilEPVQFMVGHDQLRYEMVINAVNKDRIQGYLSTPKDKVLSAEGPTKQTKR*
Ga0134111_1017147513300010329Grasslands SoilYEFVVNYIDKDRIRGYVSTPKDKVLSAEGPSFRRPQ*
Ga0134111_1052289023300010329Grasslands SoilYEMVINAVNKDRIQGYLSTPKDKVLSAERTSQLKR*
Ga0134071_1029545513300010336Grasslands SoilKLRYEIVVNFVDKDRVRGYLSAPKDKALAAERPQFRP*
Ga0126379_1132216813300010366Tropical Forest SoilQNRVRYELVVNAVEKDRIRGYISTPKDAALNSEGPAAR*
Ga0126379_1363158013300010366Tropical Forest SoilDRLRYEIVVNYVDKDRIRGYMSTPKDKVLSAEAPRR*
Ga0126379_1365633413300010366Tropical Forest SoilEFVVNSVDKDRIRGYLSTPKDRLTVAETPASLRVR*
Ga0134124_1168767213300010397Terrestrial SoilKLRYELVVNFVDKDRIRGYLSAPKDKVLAAERPQFRPD*
Ga0126383_1106428933300010398Tropical Forest SoilDKLRYEVVVNYVDKDRVRGYLSAPKDKALAAERPQIRPE*
Ga0134127_1091367513300010399Terrestrial SoilEVVVNFVDKDRIRGYLSTPKDKALSAERPQFRPE*
Ga0134121_1059025013300010401Terrestrial SoilRDKLRYEVVVNFVDKDRIRGYLSAPKDKVLSAERPQFRPE*
Ga0137422_105287243300011416SoilGRDRLRYEFVVNYVDKDRIRGYLSTPKDKVLAAEAPPVRRLQ*
Ga0137431_101472533300012038SoilVGRDELRYEIVVNAVDKDRIRGYVSAPKDKVLSAEAPRLRTQ*
Ga0137327_104682933300012173SoilRDKLRYEVVVNFVDKDRVRGYVSAPKDKVLSAERPQFRPE*
Ga0137380_1011743113300012206Vadose Zone SoilQFLVGRDKLRYEIVVNYVDKDRIRGYLSTPKDKVLAAERPTFRPE*
Ga0137381_1172217923300012207Vadose Zone SoilQFLVGRDQLRYEVVVNSVEKDHIRGYVSAPKDKVLSAEVPRFRLQ*
Ga0137387_1004082053300012349Vadose Zone SoilEPVQFMVGHDQLRYEMVINAVNKDRIQGYLSTPKDKVLSAEGPTQLKR*
Ga0134042_118354913300012373Grasslands SoilDQLRYELVVNSVDKDRIRGYVSVPKDKVLASEVPILRQ*
Ga0134044_108890523300012395Grasslands SoilDQLRYELVVNSVDKDRIRGYLSVPKDKILASEVPILRQ*
Ga0134059_111792513300012402Grasslands SoilDQLRYELVVNSVDKDRIRGYLSVPKDKVLASEVPILRQ*
Ga0134060_128603113300012410Grasslands SoilQFMVGHDQLRYEMVINAVNKDRIQGYLSTPKDKVLSAEGPTQLKR*
Ga0157310_1000675133300012916SoilGREKLRYEIVVNVVDKDRIRGYLSSPKDKALSAERPAFK*
Ga0126375_1029080923300012948Tropical Forest SoilFLVGKDELRYEIVVNSVDKDRIRGYVSAPKDKVLSAESPKFRTPSQ*
Ga0126375_1137439023300012948Tropical Forest SoilEVVVNYVDKDRIRGYLSAPKDKVLAAERPQFRPE*
Ga0157374_1008265213300013296Miscanthus RhizosphereVNQPIAFLVGREKLRYEIVVNVVDKDRIRGYLSAPKDKVLSAERPAFK*
Ga0163162_1234821423300013306Switchgrass RhizosphereHLRYELVVNSVEKDRIRGYVSAPKDSSLNSEGPTVN*
Ga0134081_1030157113300014150Grasslands SoilQFLVGRDQLRYEVVVNSVDKDRIRGYLSAPKDKVMSAEIPRFRLQ*
Ga0163163_1061542833300014325Switchgrass RhizosphereTANEPVTFLVGRDRVRYEFVVNYVEKNRIRGYLSAPKDKLTAAETPSLRVR*
Ga0157380_1148227623300014326Switchgrass RhizosphereLVGRDKLRYEVVVNFVDKDRVRGYLSAPKDKVLSAERPQFRPE*
Ga0132258_1104590653300015371Arabidopsis RhizosphereTFLVGRDRVRYELVVNYVDKDRVRGYLSTPKDKLIAGDTPTLRRLQ*
Ga0132258_1374409013300015371Arabidopsis RhizosphereTFLVGRDRLRYEIVVNYVDKDRIRGYMSTPKDKVLSAEAPRR*
Ga0182038_1134932813300016445SoilEPVTFMVGSDKLRYEFVVNYVDRDRIRGYMSTPKDKVLAAETPVRQRLQ
Ga0134069_115889513300017654Grasslands SoilGRDRLRYEFVVNYVDKDRIRGYVSTPKDKILSAEGPSFRRSQ
Ga0134112_1004040523300017656Grasslands SoilRDQLRYELVVNSVDKDRIRGYLSVPKDKVLASEVPILRQ
Ga0066655_1090905833300018431Grasslands SoilFVVNFVDKDRIRGYMSTPKDKVLAAEGPSTVQHPD
Ga0066667_1024638033300018433Grasslands SoilRYEFVVNYVDKDRIRGYLSTPKDKTLSAEGPNFRRLQ
Ga0066669_1133264323300018482Grasslands SoilDKLRYEIVVNFVDKDRVRGYLSAPKDKALAAERPQFRP
Ga0173482_1056781613300019361SoilRDELRYEVVVNSVDKDRIRGYISTPKDKVLSAEAPRLKGQ
Ga0187892_1034740413300019458Bio-OozeDKLRYEVVVNFVDKDRVRGYVSAPKDKVLSAERPAFRPQ
Ga0179594_1026563313300020170Vadose Zone SoilFLVGRDKLRYEIVVNYVDKDRIRGYLSAPKDKVLAAERPAFRPE
Ga0210387_1185768813300021405SoilDRVLYEFVVNSVDKDRIRGYLSTPKDKVLAAETPASAQRLQ
Ga0207700_1100492513300025928Corn, Switchgrass And Miscanthus RhizosphereMVGSDRVRYEFVVNSVDKDRIRGYLSTPKDKVLAAEKAPAAQRLQ
Ga0207701_1021532413300025930Corn, Switchgrass And Miscanthus RhizosphereGRDRLRYELVVNYVDKDRIRGYMSTPKDKMLSAEGPTLRRER
Ga0207711_1055055213300025941Switchgrass RhizosphereQPIAFLVGREKLRYEIVVNVVDKDRIRGYLSAPKDKALSAERPAFK
Ga0207648_1193793113300026089Miscanthus RhizospherePLLVGKNHLRYELVVNSVEKDRIRGYVSAPKDSSLNSEGPTVN
Ga0207698_1109110613300026142Corn RhizosphereTVNQPIAFLVGREKLRYEIVVNVVDKDRIRGYLSAPKDKVLSAERPAFK
Ga0209375_104445633300026329SoilMFLVGPDRLRYELVVNYVDKDRIRAYLSTPKAPKDKTLAAEGPSFRRLQ
Ga0209159_121212023300026343SoilDQLRYELVVNSVDKDRIRGYLSVPKDKILASEVPILRQ
Ga0209378_117683413300026528SoilRYELVVNSVDKDRIRGYVSVPKDKVLASEVPILRQ
Ga0209378_128855713300026528SoilFLVGRDRLRYEFVVNYIDKDRIRGYVSTPKDKVLSAEGPSFRRPQ
Ga0209058_106025213300026536SoilGRDQLRYELVVNSVDKDRIRGYLSVPKDKVLASEVPILRQ
Ga0209376_137979923300026540SoilRYEMVINAVNKDRIQGYLSTPKDKVLSAERTTQVKR
Ga0209161_1055726023300026548SoilMFLVGPDRLRYELVVNYVDKDRIRGYLSTPKAPKDKTLAAEGPSFRRLQ
Ga0209799_105063923300027654Tropical Forest SoilLRYEVVVNFVDKDRIRGYLSAPKDKALAAERPQFRPE
Ga0209814_1003952713300027873Populus RhizosphereVVNFVDKDHVQGYLSTPKDKALAAERPQFRPESKP
Ga0209382_1175380613300027909Populus RhizosphereGRNELRYEVVVNSVEKDRIRGYVSAPKDKVLSAEGPKFRAQ
Ga0315912_1002204913300032157SoilVPLLVGQNHVRYELVVNAVEKDRIRGYVSTPKDVVLSAEGPAPKQ
Ga0315912_1009084553300032157SoilYELVVNYVDKNRIRGYVSTPGGKAIAAEERALRPQ

 ⦗Top⦘


Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.