| Basic Information | |
|---|---|
| Family ID | F100807 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 102 |
| Average Sequence Length | 41 residues |
| Representative Sequence | RDKLRYEVVVNFVDKDRIRGYLSAPKDKVLSAERPQFRPE |
| Number of Associated Samples | 86 |
| Number of Associated Scaffolds | 102 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 3.96 % |
| % of genes near scaffold ends (potentially truncated) | 93.14 % |
| % of genes from short scaffolds (< 2000 bps) | 85.29 % |
| Associated GOLD sequencing projects | 84 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.19 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (96.078 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil (19.608 % of family members) |
| Environment Ontology (ENVO) | Unclassified (42.157 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (63.725 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 0.00% β-sheet: 22.06% Coil/Unstructured: 77.94% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.19 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 102 Family Scaffolds |
|---|---|---|
| PF00265 | TK | 5.88 |
| PF02965 | Met_synt_B12 | 4.90 |
| PF00582 | Usp | 2.94 |
| PF04551 | GcpE | 1.96 |
| PF13709 | DUF4159 | 1.96 |
| PF01425 | Amidase | 1.96 |
| PF13240 | zinc_ribbon_2 | 0.98 |
| PF01878 | EVE | 0.98 |
| PF07883 | Cupin_2 | 0.98 |
| PF02518 | HATPase_c | 0.98 |
| PF07676 | PD40 | 0.98 |
| PF02274 | ADI | 0.98 |
| PF13463 | HTH_27 | 0.98 |
| PF00580 | UvrD-helicase | 0.98 |
| PF01497 | Peripla_BP_2 | 0.98 |
| PF03372 | Exo_endo_phos | 0.98 |
| PF00211 | Guanylate_cyc | 0.98 |
| PF07786 | HGSNAT_cat | 0.98 |
| PF00578 | AhpC-TSA | 0.98 |
| PF00034 | Cytochrom_C | 0.98 |
| PF01979 | Amidohydro_1 | 0.98 |
| PF02812 | ELFV_dehydrog_N | 0.98 |
| COG ID | Name | Functional Category | % Frequency in 102 Family Scaffolds |
|---|---|---|---|
| COG1435 | Thymidine kinase | Nucleotide transport and metabolism [F] | 5.88 |
| COG1410 | Methionine synthase I, cobalamin-binding domain | Amino acid transport and metabolism [E] | 4.90 |
| COG0821 | 4-hydroxy-3-methylbut-2-enyl diphosphate synthase IspG/GcpE | Lipid transport and metabolism [I] | 1.96 |
| COG0154 | Asp-tRNAAsn/Glu-tRNAGln amidotransferase A subunit or related amidase | Translation, ribosomal structure and biogenesis [J] | 1.96 |
| COG2114 | Adenylate cyclase, class 3 | Signal transduction mechanisms [T] | 0.98 |
| COG4874 | Uncharacterized conserved protein | Function unknown [S] | 0.98 |
| COG4607 | ABC-type enterochelin transport system, periplasmic component | Inorganic ion transport and metabolism [P] | 0.98 |
| COG4594 | ABC-type Fe3+-citrate transport system, periplasmic component | Inorganic ion transport and metabolism [P] | 0.98 |
| COG4592 | ABC-type Fe2+-enterobactin transport system, periplasmic component | Inorganic ion transport and metabolism [P] | 0.98 |
| COG4558 | ABC-type hemin transport system, periplasmic component | Inorganic ion transport and metabolism [P] | 0.98 |
| COG3973 | DNA helicase IV | Replication, recombination and repair [L] | 0.98 |
| COG3503 | Uncharacterized membrane protein, DUF1624 family | Function unknown [S] | 0.98 |
| COG2947 | Predicted RNA-binding protein, contains EVE domain | General function prediction only [R] | 0.98 |
| COG2235 | Arginine deiminase | Amino acid transport and metabolism [E] | 0.98 |
| COG1834 | N-Dimethylarginine dimethylaminohydrolase | Amino acid transport and metabolism [E] | 0.98 |
| COG1673 | Predicted RNA-binding protein, contains PUA-like EVE domain | General function prediction only [R] | 0.98 |
| COG1074 | 3’-5’ helicase subunit RecB of the DNA repair enzyme RecBCD (exonuclease V) | Replication, recombination and repair [L] | 0.98 |
| COG0614 | ABC-type Fe3+-hydroxamate transport system, periplasmic component | Inorganic ion transport and metabolism [P] | 0.98 |
| COG0334 | Glutamate dehydrogenase/leucine dehydrogenase | Amino acid transport and metabolism [E] | 0.98 |
| COG0210 | Superfamily I DNA or RNA helicase | Replication, recombination and repair [L] | 0.98 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 96.08 % |
| Unclassified | root | N/A | 3.92 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 2170459013|GO6OHWN02G8RHD | All Organisms → cellular organisms → Bacteria → Acidobacteria | 534 | Open in IMG/M |
| 3300000559|F14TC_101820559 | All Organisms → cellular organisms → Bacteria | 1686 | Open in IMG/M |
| 3300000955|JGI1027J12803_109338004 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia | 864 | Open in IMG/M |
| 3300005166|Ga0066674_10134610 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1161 | Open in IMG/M |
| 3300005172|Ga0066683_10107106 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1699 | Open in IMG/M |
| 3300005186|Ga0066676_10542796 | All Organisms → cellular organisms → Bacteria | 788 | Open in IMG/M |
| 3300005293|Ga0065715_10874835 | All Organisms → cellular organisms → Bacteria | 583 | Open in IMG/M |
| 3300005332|Ga0066388_104499786 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 710 | Open in IMG/M |
| 3300005332|Ga0066388_107784996 | Not Available | 536 | Open in IMG/M |
| 3300005354|Ga0070675_102114461 | All Organisms → cellular organisms → Bacteria | 519 | Open in IMG/M |
| 3300005434|Ga0070709_10785201 | All Organisms → cellular organisms → Bacteria | 746 | Open in IMG/M |
| 3300005446|Ga0066686_11007010 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter | 541 | Open in IMG/M |
| 3300005447|Ga0066689_10129703 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1480 | Open in IMG/M |
| 3300005456|Ga0070678_100761893 | All Organisms → cellular organisms → Bacteria | 876 | Open in IMG/M |
| 3300005529|Ga0070741_11212265 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 636 | Open in IMG/M |
| 3300005555|Ga0066692_10138821 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1483 | Open in IMG/M |
| 3300005555|Ga0066692_10907574 | All Organisms → cellular organisms → Bacteria | 540 | Open in IMG/M |
| 3300005568|Ga0066703_10196819 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1222 | Open in IMG/M |
| 3300005598|Ga0066706_10476566 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 994 | Open in IMG/M |
| 3300005764|Ga0066903_101504518 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiaceae → unclassified Burkholderiaceae → Burkholderiaceae bacterium | 1271 | Open in IMG/M |
| 3300005842|Ga0068858_102433515 | All Organisms → cellular organisms → Bacteria | 517 | Open in IMG/M |
| 3300006031|Ga0066651_10174331 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1134 | Open in IMG/M |
| 3300006031|Ga0066651_10185647 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1098 | Open in IMG/M |
| 3300006796|Ga0066665_10102604 | All Organisms → cellular organisms → Bacteria | 2100 | Open in IMG/M |
| 3300006844|Ga0075428_100518031 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1276 | Open in IMG/M |
| 3300006845|Ga0075421_100395593 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1660 | Open in IMG/M |
| 3300006845|Ga0075421_102732843 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 509 | Open in IMG/M |
| 3300006854|Ga0075425_101050869 | All Organisms → cellular organisms → Bacteria | 928 | Open in IMG/M |
| 3300006880|Ga0075429_100538197 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1023 | Open in IMG/M |
| 3300006880|Ga0075429_101498199 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 587 | Open in IMG/M |
| 3300007076|Ga0075435_101400109 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 613 | Open in IMG/M |
| 3300009012|Ga0066710_100252183 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2554 | Open in IMG/M |
| 3300009012|Ga0066710_100274656 | All Organisms → cellular organisms → Bacteria | 2453 | Open in IMG/M |
| 3300009012|Ga0066710_104822784 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium 13_1_40CM_56_16 | 504 | Open in IMG/M |
| 3300009147|Ga0114129_12234404 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 658 | Open in IMG/M |
| 3300009147|Ga0114129_12489922 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 619 | Open in IMG/M |
| 3300010048|Ga0126373_11302508 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 792 | Open in IMG/M |
| 3300010085|Ga0127445_1091713 | All Organisms → cellular organisms → Bacteria | 903 | Open in IMG/M |
| 3300010098|Ga0127463_1066275 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 509 | Open in IMG/M |
| 3300010102|Ga0127453_1036459 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 514 | Open in IMG/M |
| 3300010112|Ga0127458_1045294 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 855 | Open in IMG/M |
| 3300010126|Ga0127482_1084628 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 511 | Open in IMG/M |
| 3300010132|Ga0127455_1021158 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 593 | Open in IMG/M |
| 3300010304|Ga0134088_10024050 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2719 | Open in IMG/M |
| 3300010329|Ga0134111_10171475 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 867 | Open in IMG/M |
| 3300010329|Ga0134111_10522890 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium 13_1_40CM_56_16 | 523 | Open in IMG/M |
| 3300010336|Ga0134071_10295455 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 813 | Open in IMG/M |
| 3300010366|Ga0126379_11322168 | All Organisms → cellular organisms → Bacteria | 827 | Open in IMG/M |
| 3300010366|Ga0126379_13631580 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 517 | Open in IMG/M |
| 3300010366|Ga0126379_13656334 | Not Available | 515 | Open in IMG/M |
| 3300010397|Ga0134124_11687672 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 665 | Open in IMG/M |
| 3300010398|Ga0126383_11064289 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 898 | Open in IMG/M |
| 3300010399|Ga0134127_10913675 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 934 | Open in IMG/M |
| 3300010401|Ga0134121_10590250 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1038 | Open in IMG/M |
| 3300011416|Ga0137422_1052872 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 973 | Open in IMG/M |
| 3300012038|Ga0137431_1014725 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2137 | Open in IMG/M |
| 3300012173|Ga0137327_1046829 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 944 | Open in IMG/M |
| 3300012206|Ga0137380_10117431 | All Organisms → cellular organisms → Bacteria | 2430 | Open in IMG/M |
| 3300012207|Ga0137381_11722179 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 517 | Open in IMG/M |
| 3300012349|Ga0137387_10040820 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 3049 | Open in IMG/M |
| 3300012373|Ga0134042_1183549 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 849 | Open in IMG/M |
| 3300012395|Ga0134044_1088905 | All Organisms → cellular organisms → Bacteria | 866 | Open in IMG/M |
| 3300012402|Ga0134059_1117925 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 819 | Open in IMG/M |
| 3300012410|Ga0134060_1286031 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium 13_1_40CM_56_16 | 552 | Open in IMG/M |
| 3300012916|Ga0157310_10006751 | All Organisms → cellular organisms → Bacteria | 2660 | Open in IMG/M |
| 3300012948|Ga0126375_10290809 | All Organisms → cellular organisms → Bacteria | 1129 | Open in IMG/M |
| 3300012948|Ga0126375_11374390 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 597 | Open in IMG/M |
| 3300013296|Ga0157374_10082652 | All Organisms → cellular organisms → Bacteria | 3050 | Open in IMG/M |
| 3300013306|Ga0163162_12348214 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 613 | Open in IMG/M |
| 3300014150|Ga0134081_10301571 | All Organisms → cellular organisms → Bacteria | 575 | Open in IMG/M |
| 3300014325|Ga0163163_10615428 | All Organisms → cellular organisms → Bacteria | 1149 | Open in IMG/M |
| 3300014326|Ga0157380_11482276 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 731 | Open in IMG/M |
| 3300015371|Ga0132258_11045906 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2063 | Open in IMG/M |
| 3300015371|Ga0132258_13744090 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1037 | Open in IMG/M |
| 3300016445|Ga0182038_11349328 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 638 | Open in IMG/M |
| 3300017654|Ga0134069_1158895 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 758 | Open in IMG/M |
| 3300017656|Ga0134112_10040405 | All Organisms → cellular organisms → Bacteria | 1666 | Open in IMG/M |
| 3300018431|Ga0066655_10909058 | Not Available | 602 | Open in IMG/M |
| 3300018433|Ga0066667_10246380 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1351 | Open in IMG/M |
| 3300018482|Ga0066669_11332643 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 650 | Open in IMG/M |
| 3300019361|Ga0173482_10567816 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 564 | Open in IMG/M |
| 3300019458|Ga0187892_10347404 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 722 | Open in IMG/M |
| 3300020170|Ga0179594_10265633 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 648 | Open in IMG/M |
| 3300021405|Ga0210387_11857688 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 506 | Open in IMG/M |
| 3300025928|Ga0207700_11004925 | All Organisms → cellular organisms → Bacteria | 746 | Open in IMG/M |
| 3300025930|Ga0207701_10215324 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1684 | Open in IMG/M |
| 3300025941|Ga0207711_10550552 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1076 | Open in IMG/M |
| 3300026089|Ga0207648_11937931 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 551 | Open in IMG/M |
| 3300026142|Ga0207698_11091106 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 811 | Open in IMG/M |
| 3300026329|Ga0209375_1044456 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 2265 | Open in IMG/M |
| 3300026343|Ga0209159_1212120 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 606 | Open in IMG/M |
| 3300026528|Ga0209378_1176834 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 780 | Open in IMG/M |
| 3300026528|Ga0209378_1288557 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 524 | Open in IMG/M |
| 3300026536|Ga0209058_1060252 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Sumerlaeota → unclassified Candidatus Sumerlaeota → candidate division BRC1 bacterium ADurb.BinA292 | 2097 | Open in IMG/M |
| 3300026540|Ga0209376_1379799 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium 13_1_40CM_56_16 | 529 | Open in IMG/M |
| 3300026548|Ga0209161_10557260 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 511 | Open in IMG/M |
| 3300027654|Ga0209799_1050639 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 929 | Open in IMG/M |
| 3300027873|Ga0209814_10039527 | All Organisms → cellular organisms → Bacteria | 1960 | Open in IMG/M |
| 3300027909|Ga0209382_11753806 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 607 | Open in IMG/M |
| 3300032157|Ga0315912_10022049 | All Organisms → cellular organisms → Bacteria | 5207 | Open in IMG/M |
| 3300032157|Ga0315912_10090845 | All Organisms → cellular organisms → Bacteria | 2392 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 19.61% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 16.67% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 10.78% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 6.86% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 5.88% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 4.90% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 3.92% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 3.92% |
| Soil | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Soil | 2.94% |
| Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 2.94% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 1.96% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 1.96% |
| Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 0.98% |
| Grass Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grass Soil | 0.98% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Corn, Switchgrass And Miscanthus Rhizosphere | 0.98% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 0.98% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 0.98% |
| Soil | Environmental → Terrestrial → Soil → Loam → Grasslands → Soil | 0.98% |
| Bio-Ooze | Environmental → Terrestrial → Cave → Unclassified → Unclassified → Bio-Ooze | 0.98% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.98% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 0.98% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 0.98% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 0.98% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 0.98% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Soil → Unclassified → Miscanthus Rhizosphere | 0.98% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Roots → Rhizosphere → Soil → Switchgrass Rhizosphere | 0.98% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.98% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.98% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.98% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere | 0.98% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 2170459013 | Grass soil microbial communities from Rothamsted Park, UK - July 2010 direct MP BIO 1O1 lysis soil at the rocks surface 0-21cm | Environmental | Open in IMG/M |
| 3300000559 | Amended soil microbial communities from Kansas Great Prairies, USA - control no BrdU total DNA F1.4 TC clc assemly | Environmental | Open in IMG/M |
| 3300000955 | Soil microbial communities from Great Prairies - Iowa, Native Prairie soil | Environmental | Open in IMG/M |
| 3300005166 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_123 | Environmental | Open in IMG/M |
| 3300005172 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_132 | Environmental | Open in IMG/M |
| 3300005186 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_125 | Environmental | Open in IMG/M |
| 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 | Host-Associated | Open in IMG/M |
| 3300005332 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Host-Associated | Open in IMG/M |
| 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Environmental | Open in IMG/M |
| 3300005446 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_135 | Environmental | Open in IMG/M |
| 3300005447 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_138 | Environmental | Open in IMG/M |
| 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Host-Associated | Open in IMG/M |
| 3300005529 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen16_06102014_R1 | Environmental | Open in IMG/M |
| 3300005555 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_141 | Environmental | Open in IMG/M |
| 3300005568 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_152 | Environmental | Open in IMG/M |
| 3300005598 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_155 | Environmental | Open in IMG/M |
| 3300005764 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2) | Environmental | Open in IMG/M |
| 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Host-Associated | Open in IMG/M |
| 3300006031 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Angelo_100 | Environmental | Open in IMG/M |
| 3300006796 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_114 | Environmental | Open in IMG/M |
| 3300006844 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Host-Associated | Open in IMG/M |
| 3300006845 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD5 | Host-Associated | Open in IMG/M |
| 3300006854 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD4 | Host-Associated | Open in IMG/M |
| 3300006880 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Host-Associated | Open in IMG/M |
| 3300007076 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Host-Associated | Open in IMG/M |
| 3300009012 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_159 | Environmental | Open in IMG/M |
| 3300009147 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) | Host-Associated | Open in IMG/M |
| 3300010048 | Tropical forest soil microbial communities from Panama - MetaG Plot_11 | Environmental | Open in IMG/M |
| 3300010085 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Wat_40_2_0_1 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300010098 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Met_20_2_4_1 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300010102 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Wat_40_5_4_1 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300010112 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Wat_40_5_4_2 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300010126 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Met_40_2_0_1 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300010132 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Wat_40_5_16_1 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300010304 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_5_09182015 | Environmental | Open in IMG/M |
| 3300010329 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_2_11112015 | Environmental | Open in IMG/M |
| 3300010336 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_5_09082015 | Environmental | Open in IMG/M |
| 3300010366 | Tropical forest soil microbial communities from Panama - MetaG Plot_24 | Environmental | Open in IMG/M |
| 3300010397 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-4 | Environmental | Open in IMG/M |
| 3300010398 | Tropical forest soil microbial communities from Panama - MetaG Plot_35 | Environmental | Open in IMG/M |
| 3300010399 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-3 | Environmental | Open in IMG/M |
| 3300010401 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-1 | Environmental | Open in IMG/M |
| 3300011416 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMZT551_2 | Environmental | Open in IMG/M |
| 3300012038 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMZT800_2 | Environmental | Open in IMG/M |
| 3300012173 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMZT517_2 | Environmental | Open in IMG/M |
| 3300012206 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_100_16 metaG | Environmental | Open in IMG/M |
| 3300012207 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_115_16 metaG | Environmental | Open in IMG/M |
| 3300012349 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Sage2_R_115_16 metaG | Environmental | Open in IMG/M |
| 3300012373 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Glu_40cm_2_0_1 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300012395 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Glu_40cm_2_8_1 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300012402 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Glu_40cm_5_8_2 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300012410 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Glu_40cm_5_16_2 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300012916 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S213-509R-2 | Environmental | Open in IMG/M |
| 3300012948 | Tropical forest soil microbial communities from Panama - MetaG Plot_14 | Environmental | Open in IMG/M |
| 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Host-Associated | Open in IMG/M |
| 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Host-Associated | Open in IMG/M |
| 3300014150 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Met_20cm_5_24_1 metaG | Environmental | Open in IMG/M |
| 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Host-Associated | Open in IMG/M |
| 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Host-Associated | Open in IMG/M |
| 3300015371 | Combined assembly of cpr5 and col0 rhizosphere and soil | Host-Associated | Open in IMG/M |
| 3300016445 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108 | Environmental | Open in IMG/M |
| 3300017654 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_40cm_2_24_1 metaG | Environmental | Open in IMG/M |
| 3300017656 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_5_11112015 | Environmental | Open in IMG/M |
| 3300018431 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_104 | Environmental | Open in IMG/M |
| 3300018433 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_116 | Environmental | Open in IMG/M |
| 3300018482 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_118 | Environmental | Open in IMG/M |
| 3300019361 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S133-311R-2 (version 2) | Environmental | Open in IMG/M |
| 3300019458 | Bio-ooze microbial communities from a basaltic lava cave in the Kipuka Kanohina Cave System on the Island of Hawaii, USA - MA170107-3 metaG | Environmental | Open in IMG/M |
| 3300020170 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad1_1_08_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300021405 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-O | Environmental | Open in IMG/M |
| 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025930 | Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) | Environmental | Open in IMG/M |
| 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026329 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_131 (SPAdes) | Environmental | Open in IMG/M |
| 3300026343 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_144 (SPAdes) | Environmental | Open in IMG/M |
| 3300026528 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_156 (SPAdes) | Environmental | Open in IMG/M |
| 3300026536 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_147 (SPAdes) | Environmental | Open in IMG/M |
| 3300026540 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_134 (SPAdes) | Environmental | Open in IMG/M |
| 3300026548 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_155 (SPAdes) | Environmental | Open in IMG/M |
| 3300027654 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 36 MoBio (SPAdes) | Environmental | Open in IMG/M |
| 3300027873 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD1 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300027909 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD5 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300032157 | Garden soil microbial communities collected in Santa Monica, California, United States - V. faba soil | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| N57_05106800 | 2170459013 | Grass Soil | FLVGRDRLRYEFVVNYVDKDRIRGYLSTPKDKVLAAEAGRRF |
| F14TC_1018205591 | 3300000559 | Soil | EFVVYSVDKDRVRGYISTPKDKLVAAENPLQRRLQ* |
| JGI1027J12803_1093380041 | 3300000955 | Soil | PVTFLVGKDRLRYEFVVNSVDKDRIRGYVSTPKDKVLAVEGPSTVQHPD* |
| Ga0066674_101346102 | 3300005166 | Soil | MFLVGPDRLRYELVVNYVDKDRIRAYLSTPKAPKDKTLAAEGPSFRRLQ* |
| Ga0066683_101071063 | 3300005172 | Soil | PVQFMVGHDQLRYEMVINAVNKDRIQGYLSTPKDKVLSAERTTQVKR* |
| Ga0066676_105427961 | 3300005186 | Soil | EQLRYEVVVNSVEKDRIRGYVSAPKDKVLSAEVPRFRLQ* |
| Ga0065715_108748351 | 3300005293 | Miscanthus Rhizosphere | LVGREKLRYEIVVNVVDKDRIRGYLSAPKDKVLSAERPAFK* |
| Ga0066388_1044997862 | 3300005332 | Tropical Forest Soil | LVGKDRLRYELVVYSVDKDRIRGYLSTPKDKTLSAEGPSFRH* |
| Ga0066388_1077770002 | 3300005332 | Tropical Forest Soil | ANEPVTFLVGHDRVRYEFVVFSVDKDRIRGYISTPKDKLVAAENPLQRRLQ* |
| Ga0066388_1077849961 | 3300005332 | Tropical Forest Soil | HDRVRYEFVVFTVDKDRIHGYISTPKDKLVAAESPLQRRLQ* |
| Ga0070675_1021144611 | 3300005354 | Miscanthus Rhizosphere | LVGQSHVRYELVVNAVEKDRIRGYVSTPKDVVLSAEGPNARQ* |
| Ga0070709_107852013 | 3300005434 | Corn, Switchgrass And Miscanthus Rhizosphere | FLVGREQLRYEVVVNSVEKDRIRGYMSAPKDKSLSAEIPQFRQQ* |
| Ga0066686_110070101 | 3300005446 | Soil | LVGRDKLRYEIVVNYVDKDRIRGYLSAPKDKVLAAERPAFRPE* |
| Ga0066689_101297031 | 3300005447 | Soil | GHDQLRYEMVINAVNKDRIQGYLSTPKDKVLSAEGPTQLKR* |
| Ga0070678_1007618931 | 3300005456 | Miscanthus Rhizosphere | LLIGQNHVRYELVVNSVEKDRIRGYISAPKDVVLSAEGPTSR* |
| Ga0070741_112122652 | 3300005529 | Surface Soil | VGRDQLRYEVVVNSVEKDRIRGYVSAPKDKTLAAEIPRFRE* |
| Ga0066692_101388213 | 3300005555 | Soil | VGHDQLRYEMVINAVNKDRIQGYLSTPKDKVLSAERTTQVKR* |
| Ga0066692_109075741 | 3300005555 | Soil | YEFVVNYVDKDRIRGYLSTPKDKTLAAEGPSRQRF* |
| Ga0066703_101968193 | 3300005568 | Soil | FVVNYVDKDRIRGYLSTPKDKTLSAEGPNFRRLQ* |
| Ga0066706_104765662 | 3300005598 | Soil | MFLVGPDRLRYELVVNYVDKDRIRGYLSTPKAPKDKTLAAEGPSFRRLQ* |
| Ga0066903_1015045182 | 3300005764 | Tropical Forest Soil | YEFVVNSVDKDRIRGYLSTPKDRLTVAETPASLRVR* |
| Ga0068858_1024335151 | 3300005842 | Switchgrass Rhizosphere | QFLVGRDKLRYEIVVNIVDKDRIRGYLSAPKDKSLAAERPAAR* |
| Ga0066651_101743312 | 3300006031 | Soil | NYVDKDRIRGYLSTPKAPKDKTLAAEGPSFRRLQ* |
| Ga0066651_101856471 | 3300006031 | Soil | ELVVNFVDKDRVRGYLSTPKDKTFSAEGPSTRRLQ* |
| Ga0066665_101026043 | 3300006796 | Soil | QLRYEVVVNSVEKDRIRGYVSAPKDKVLSAEVPRFRLQ* |
| Ga0075428_1005180311 | 3300006844 | Populus Rhizosphere | VRYEFVVYSVDKDRIRGYISTPKDKLVAAENPVQRRLQ* |
| Ga0075421_1003955933 | 3300006845 | Populus Rhizosphere | RYEFVVYSVDKDRIRGYISTPKDKLVAAENPLQRRLQ* |
| Ga0075421_1027328431 | 3300006845 | Populus Rhizosphere | EPVTFLVGRDRLRYEIVVNYVDKDRIRGYMSTPKDKMLSAEGPTLRRER* |
| Ga0075425_1010508691 | 3300006854 | Populus Rhizosphere | FLVGRDRARYEFVVNFVDKDRIRGYISTPKDKLVASETPTLRVR* |
| Ga0075429_1005381973 | 3300006880 | Populus Rhizosphere | LRYEVVVNSVEKDRIRGYVSAPKDKVLSAEGPKFRAQ* |
| Ga0075429_1014981992 | 3300006880 | Populus Rhizosphere | EFVVYSVDKDRIRGYISTPKDKLVAAENPLQRRLQ* |
| Ga0075435_1014001092 | 3300007076 | Populus Rhizosphere | ELVVNYVDKDRIRGYLSTPKDKVLSAEAPALRRAQ* |
| Ga0066710_1002521833 | 3300009012 | Grasslands Soil | YEFVVNYVDKDRIRGYMSTPKDRLVAAETPTLRVQ |
| Ga0066710_1002746561 | 3300009012 | Grasslands Soil | LRYEVVVNAVDKDRIRGYVSTPKDKVLAAEAPQFRLQ |
| Ga0066710_1048227841 | 3300009012 | Grasslands Soil | EPVQFMVGHDQLRYEMVINAVNKDRIQGYLSTPKDKVLSAEGPTQLKR |
| Ga0114129_122344041 | 3300009147 | Populus Rhizosphere | VGRDRLRYEIVVNYVDKDRIRGYMSTPKDKLLSAEGPTLRRER* |
| Ga0114129_124899222 | 3300009147 | Populus Rhizosphere | QFLVGRDELRYEVVVNSVEKDRIRGYVSAPKDKVLSAEGPKFRAQ* |
| Ga0126373_113025081 | 3300010048 | Tropical Forest Soil | GSDHLRYEFVVNSVDRDHIKGYLSTPKDKILSAEAPRAKLQ* |
| Ga0127445_10917132 | 3300010085 | Grasslands Soil | LRYELVVNSVDKDRIRGYLSVPKDKVLASEVPVLRQ* |
| Ga0127463_10662751 | 3300010098 | Grasslands Soil | GHDQLRYEMVINAVNKDRIQGYLSTPKDKVLSAEGPTKQTKR* |
| Ga0127453_10364591 | 3300010102 | Grasslands Soil | RDQLRYELVVNSVDKDRIRGYLSVPKDKVLASEVPILRQ* |
| Ga0127458_10452942 | 3300010112 | Grasslands Soil | VGHDQLRYEMVINAVNKDRIQGYLSTPKDKVLSAEGPTKQTKR* |
| Ga0127482_10846282 | 3300010126 | Grasslands Soil | LVGHDQLRYEMVINAVNKDRIQGYLSTPKDKVLSAEGPTKQTKR* |
| Ga0127455_10211581 | 3300010132 | Grasslands Soil | DQLRYELVVNSVDKDRIRGYLSVPKDKVLASEVPVLRQ* |
| Ga0134088_100240501 | 3300010304 | Grasslands Soil | EPVQFMVGHDQLRYEMVINAVNKDRIQGYLSTPKDKVLSAEGPTKQTKR* |
| Ga0134111_101714751 | 3300010329 | Grasslands Soil | YEFVVNYIDKDRIRGYVSTPKDKVLSAEGPSFRRPQ* |
| Ga0134111_105228902 | 3300010329 | Grasslands Soil | YEMVINAVNKDRIQGYLSTPKDKVLSAERTSQLKR* |
| Ga0134071_102954551 | 3300010336 | Grasslands Soil | KLRYEIVVNFVDKDRVRGYLSAPKDKALAAERPQFRP* |
| Ga0126379_113221681 | 3300010366 | Tropical Forest Soil | QNRVRYELVVNAVEKDRIRGYISTPKDAALNSEGPAAR* |
| Ga0126379_136315801 | 3300010366 | Tropical Forest Soil | DRLRYEIVVNYVDKDRIRGYMSTPKDKVLSAEAPRR* |
| Ga0126379_136563341 | 3300010366 | Tropical Forest Soil | EFVVNSVDKDRIRGYLSTPKDRLTVAETPASLRVR* |
| Ga0134124_116876721 | 3300010397 | Terrestrial Soil | KLRYELVVNFVDKDRIRGYLSAPKDKVLAAERPQFRPD* |
| Ga0126383_110642893 | 3300010398 | Tropical Forest Soil | DKLRYEVVVNYVDKDRVRGYLSAPKDKALAAERPQIRPE* |
| Ga0134127_109136751 | 3300010399 | Terrestrial Soil | EVVVNFVDKDRIRGYLSTPKDKALSAERPQFRPE* |
| Ga0134121_105902501 | 3300010401 | Terrestrial Soil | RDKLRYEVVVNFVDKDRIRGYLSAPKDKVLSAERPQFRPE* |
| Ga0137422_10528724 | 3300011416 | Soil | GRDRLRYEFVVNYVDKDRIRGYLSTPKDKVLAAEAPPVRRLQ* |
| Ga0137431_10147253 | 3300012038 | Soil | VGRDELRYEIVVNAVDKDRIRGYVSAPKDKVLSAEAPRLRTQ* |
| Ga0137327_10468293 | 3300012173 | Soil | RDKLRYEVVVNFVDKDRVRGYVSAPKDKVLSAERPQFRPE* |
| Ga0137380_101174311 | 3300012206 | Vadose Zone Soil | QFLVGRDKLRYEIVVNYVDKDRIRGYLSTPKDKVLAAERPTFRPE* |
| Ga0137381_117221792 | 3300012207 | Vadose Zone Soil | QFLVGRDQLRYEVVVNSVEKDHIRGYVSAPKDKVLSAEVPRFRLQ* |
| Ga0137387_100408205 | 3300012349 | Vadose Zone Soil | EPVQFMVGHDQLRYEMVINAVNKDRIQGYLSTPKDKVLSAEGPTQLKR* |
| Ga0134042_11835491 | 3300012373 | Grasslands Soil | DQLRYELVVNSVDKDRIRGYVSVPKDKVLASEVPILRQ* |
| Ga0134044_10889052 | 3300012395 | Grasslands Soil | DQLRYELVVNSVDKDRIRGYLSVPKDKILASEVPILRQ* |
| Ga0134059_11179251 | 3300012402 | Grasslands Soil | DQLRYELVVNSVDKDRIRGYLSVPKDKVLASEVPILRQ* |
| Ga0134060_12860311 | 3300012410 | Grasslands Soil | QFMVGHDQLRYEMVINAVNKDRIQGYLSTPKDKVLSAEGPTQLKR* |
| Ga0157310_100067513 | 3300012916 | Soil | GREKLRYEIVVNVVDKDRIRGYLSSPKDKALSAERPAFK* |
| Ga0126375_102908092 | 3300012948 | Tropical Forest Soil | FLVGKDELRYEIVVNSVDKDRIRGYVSAPKDKVLSAESPKFRTPSQ* |
| Ga0126375_113743902 | 3300012948 | Tropical Forest Soil | EVVVNYVDKDRIRGYLSAPKDKVLAAERPQFRPE* |
| Ga0157374_100826521 | 3300013296 | Miscanthus Rhizosphere | VNQPIAFLVGREKLRYEIVVNVVDKDRIRGYLSAPKDKVLSAERPAFK* |
| Ga0163162_123482142 | 3300013306 | Switchgrass Rhizosphere | HLRYELVVNSVEKDRIRGYVSAPKDSSLNSEGPTVN* |
| Ga0134081_103015711 | 3300014150 | Grasslands Soil | QFLVGRDQLRYEVVVNSVDKDRIRGYLSAPKDKVMSAEIPRFRLQ* |
| Ga0163163_106154283 | 3300014325 | Switchgrass Rhizosphere | TANEPVTFLVGRDRVRYEFVVNYVEKNRIRGYLSAPKDKLTAAETPSLRVR* |
| Ga0157380_114822762 | 3300014326 | Switchgrass Rhizosphere | LVGRDKLRYEVVVNFVDKDRVRGYLSAPKDKVLSAERPQFRPE* |
| Ga0132258_110459065 | 3300015371 | Arabidopsis Rhizosphere | TFLVGRDRVRYELVVNYVDKDRVRGYLSTPKDKLIAGDTPTLRRLQ* |
| Ga0132258_137440901 | 3300015371 | Arabidopsis Rhizosphere | TFLVGRDRLRYEIVVNYVDKDRIRGYMSTPKDKVLSAEAPRR* |
| Ga0182038_113493281 | 3300016445 | Soil | EPVTFMVGSDKLRYEFVVNYVDRDRIRGYMSTPKDKVLAAETPVRQRLQ |
| Ga0134069_11588951 | 3300017654 | Grasslands Soil | GRDRLRYEFVVNYVDKDRIRGYVSTPKDKILSAEGPSFRRSQ |
| Ga0134112_100404052 | 3300017656 | Grasslands Soil | RDQLRYELVVNSVDKDRIRGYLSVPKDKVLASEVPILRQ |
| Ga0066655_109090583 | 3300018431 | Grasslands Soil | FVVNFVDKDRIRGYMSTPKDKVLAAEGPSTVQHPD |
| Ga0066667_102463803 | 3300018433 | Grasslands Soil | RYEFVVNYVDKDRIRGYLSTPKDKTLSAEGPNFRRLQ |
| Ga0066669_113326432 | 3300018482 | Grasslands Soil | DKLRYEIVVNFVDKDRVRGYLSAPKDKALAAERPQFRP |
| Ga0173482_105678161 | 3300019361 | Soil | RDELRYEVVVNSVDKDRIRGYISTPKDKVLSAEAPRLKGQ |
| Ga0187892_103474041 | 3300019458 | Bio-Ooze | DKLRYEVVVNFVDKDRVRGYVSAPKDKVLSAERPAFRPQ |
| Ga0179594_102656331 | 3300020170 | Vadose Zone Soil | FLVGRDKLRYEIVVNYVDKDRIRGYLSAPKDKVLAAERPAFRPE |
| Ga0210387_118576881 | 3300021405 | Soil | DRVLYEFVVNSVDKDRIRGYLSTPKDKVLAAETPASAQRLQ |
| Ga0207700_110049251 | 3300025928 | Corn, Switchgrass And Miscanthus Rhizosphere | MVGSDRVRYEFVVNSVDKDRIRGYLSTPKDKVLAAEKAPAAQRLQ |
| Ga0207701_102153241 | 3300025930 | Corn, Switchgrass And Miscanthus Rhizosphere | GRDRLRYELVVNYVDKDRIRGYMSTPKDKMLSAEGPTLRRER |
| Ga0207711_105505521 | 3300025941 | Switchgrass Rhizosphere | QPIAFLVGREKLRYEIVVNVVDKDRIRGYLSAPKDKALSAERPAFK |
| Ga0207648_119379311 | 3300026089 | Miscanthus Rhizosphere | PLLVGKNHLRYELVVNSVEKDRIRGYVSAPKDSSLNSEGPTVN |
| Ga0207698_110911061 | 3300026142 | Corn Rhizosphere | TVNQPIAFLVGREKLRYEIVVNVVDKDRIRGYLSAPKDKVLSAERPAFK |
| Ga0209375_10444563 | 3300026329 | Soil | MFLVGPDRLRYELVVNYVDKDRIRAYLSTPKAPKDKTLAAEGPSFRRLQ |
| Ga0209159_12121202 | 3300026343 | Soil | DQLRYELVVNSVDKDRIRGYLSVPKDKILASEVPILRQ |
| Ga0209378_11768341 | 3300026528 | Soil | RYELVVNSVDKDRIRGYVSVPKDKVLASEVPILRQ |
| Ga0209378_12885571 | 3300026528 | Soil | FLVGRDRLRYEFVVNYIDKDRIRGYVSTPKDKVLSAEGPSFRRPQ |
| Ga0209058_10602521 | 3300026536 | Soil | GRDQLRYELVVNSVDKDRIRGYLSVPKDKVLASEVPILRQ |
| Ga0209376_13797992 | 3300026540 | Soil | RYEMVINAVNKDRIQGYLSTPKDKVLSAERTTQVKR |
| Ga0209161_105572602 | 3300026548 | Soil | MFLVGPDRLRYELVVNYVDKDRIRGYLSTPKAPKDKTLAAEGPSFRRLQ |
| Ga0209799_10506392 | 3300027654 | Tropical Forest Soil | LRYEVVVNFVDKDRIRGYLSAPKDKALAAERPQFRPE |
| Ga0209814_100395271 | 3300027873 | Populus Rhizosphere | VVNFVDKDHVQGYLSTPKDKALAAERPQFRPESKP |
| Ga0209382_117538061 | 3300027909 | Populus Rhizosphere | GRNELRYEVVVNSVEKDRIRGYVSAPKDKVLSAEGPKFRAQ |
| Ga0315912_100220491 | 3300032157 | Soil | VPLLVGQNHVRYELVVNAVEKDRIRGYVSTPKDVVLSAEGPAPKQ |
| Ga0315912_100908455 | 3300032157 | Soil | YELVVNYVDKNRIRGYVSTPGGKAIAAEERALRPQ |
| ⦗Top⦘ |