NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F100801

Metagenome / Metatranscriptome Family F100801

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F100801
Family Type Metagenome / Metatranscriptome
Number of Sequences 102
Average Sequence Length 163 residues
Representative Sequence MRKVAVVALCCALLGSSLLAAQKQSPASGKKIEALFKAAEIPFTSSEEGSYVAVITVEEGESDRFHVYLSTIGNDPNDEKLQVVQLYFLLGALPKDAPVPIALTKQIAEWNANLTVGKVVVIGSAILYTSSSWLSRTDADGLAQDAVLGHYLSKSLRKEVAPYLKP
Number of Associated Samples 84
Number of Associated Scaffolds 102

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 68.63 %
% of genes near scaffold ends (potentially truncated) 38.24 %
% of genes from short scaffolds (< 2000 bps) 76.47 %
Associated GOLD sequencing projects 79
AlphaFold2 3D model prediction No

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (100.000 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Environmental → Aquatic → Freshwater → Wetlands → Bog → Peatland
(19.608 % of family members)
Environment Ontology (ENVO) Unclassified
(35.294 % of family members)
Earth Microbiome Project Ontology (EMPO) Free-living → Non-saline → Soil (non-saline)
(54.902 % of family members)



 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      


 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: Yes Secondary Structure distribution: α-helix: 36.14%    β-sheet: 25.90%    Coil/Unstructured: 37.95%
Feature Viewer
Powered by Feature Viewer


 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 102 Family Scaffolds
PF01435Peptidase_M48 10.78
PF10722YbjN 3.92
PF13424TPR_12 1.96
PF01925TauE 0.98
PF00730HhH-GPD 0.98
PF14026DUF4242 0.98
PF04471Mrr_cat 0.98
PF01609DDE_Tnp_1 0.98
PF13432TPR_16 0.98
PF11074DUF2779 0.98
PF12770CHAT 0.98
PF00903Glyoxalase 0.98
PF01844HNH 0.98
PF00069Pkinase 0.98

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 102 Family Scaffolds
COG0515Serine/threonine protein kinaseSignal transduction mechanisms [T] 3.92
COG01223-methyladenine DNA glycosylase/8-oxoguanine DNA glycosylaseReplication, recombination and repair [L] 0.98
COG0177Endonuclease IIIReplication, recombination and repair [L] 0.98
COG0730Sulfite exporter TauE/SafE/YfcA and related permeases, UPF0721 familyInorganic ion transport and metabolism [P] 0.98
COG1059Thermostable 8-oxoguanine DNA glycosylaseReplication, recombination and repair [L] 0.98
COG1194Adenine-specific DNA glycosylase, acts on AG and A-oxoG pairsReplication, recombination and repair [L] 0.98
COG22313-Methyladenine DNA glycosylase, HhH-GPD/Endo3 superfamilyReplication, recombination and repair [L] 0.98
COG3039Transposase and inactivated derivatives, IS5 familyMobilome: prophages, transposons [X] 0.98
COG3293TransposaseMobilome: prophages, transposons [X] 0.98
COG3385IS4 transposase InsGMobilome: prophages, transposons [X] 0.98
COG5421TransposaseMobilome: prophages, transposons [X] 0.98
COG5433Predicted transposase YbfD/YdcC associated with H repeatsMobilome: prophages, transposons [X] 0.98
COG5659SRSO17 transposaseMobilome: prophages, transposons [X] 0.98


 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms100.00 %
UnclassifiedrootN/A0.00 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
3300001180|JGI12695J13573_1002250All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Candidatus Angelobacter → unclassified Candidatus Angelobacter → Candidatus Angelobacter sp. Gp1-AA1171340Open in IMG/M
3300002245|JGIcombinedJ26739_100987644All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Candidatus Angelobacter → unclassified Candidatus Angelobacter → Candidatus Angelobacter sp. Gp1-AA117726Open in IMG/M
3300004080|Ga0062385_10104790All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Candidatus Angelobacter → unclassified Candidatus Angelobacter → Candidatus Angelobacter sp. Gp1-AA1171377Open in IMG/M
3300004080|Ga0062385_11288455All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Candidatus Angelobacter → unclassified Candidatus Angelobacter → Candidatus Angelobacter sp. Gp1-AA117503Open in IMG/M
3300004082|Ga0062384_100331771All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Candidatus Angelobacter → unclassified Candidatus Angelobacter → Candidatus Angelobacter sp. Gp1-AA117956Open in IMG/M
3300004082|Ga0062384_100417595All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Candidatus Angelobacter → unclassified Candidatus Angelobacter → Candidatus Angelobacter sp. Gp1-AA117868Open in IMG/M
3300004082|Ga0062384_100437773All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Candidatus Angelobacter → unclassified Candidatus Angelobacter → Candidatus Angelobacter sp. Gp1-AA117851Open in IMG/M
3300004092|Ga0062389_102700818All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Candidatus Angelobacter → unclassified Candidatus Angelobacter → Candidatus Angelobacter sp. Gp1-AA117662Open in IMG/M
3300004092|Ga0062389_104904798All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Candidatus Angelobacter → unclassified Candidatus Angelobacter → Candidatus Angelobacter sp. Gp1-AA117504Open in IMG/M
3300004152|Ga0062386_100081098All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Candidatus Angelobacter → unclassified Candidatus Angelobacter → Candidatus Angelobacter sp. Gp1-AA1172477Open in IMG/M
3300004635|Ga0062388_100029677All Organisms → cellular organisms → Bacteria3328Open in IMG/M
3300004635|Ga0062388_101152997All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Candidatus Angelobacter → unclassified Candidatus Angelobacter → Candidatus Angelobacter sp. Gp1-AA117764Open in IMG/M
3300004635|Ga0062388_101599594All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Candidatus Angelobacter → unclassified Candidatus Angelobacter → Candidatus Angelobacter sp. Gp1-AA117662Open in IMG/M
3300005174|Ga0066680_10044203All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Candidatus Angelobacter → unclassified Candidatus Angelobacter → Candidatus Angelobacter sp. Gp1-AA1172590Open in IMG/M
3300005575|Ga0066702_10326376All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Candidatus Angelobacter → unclassified Candidatus Angelobacter → Candidatus Angelobacter sp. Gp1-AA117935Open in IMG/M
3300006162|Ga0075030_100119194All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Candidatus Angelobacter → unclassified Candidatus Angelobacter → Candidatus Angelobacter sp. Gp1-AA1172145Open in IMG/M
3300006796|Ga0066665_10201098All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Candidatus Angelobacter → unclassified Candidatus Angelobacter → Candidatus Angelobacter sp. Gp1-AA1171546Open in IMG/M
3300006800|Ga0066660_10054590All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Candidatus Angelobacter → unclassified Candidatus Angelobacter → Candidatus Angelobacter sp. Gp1-AA1172629Open in IMG/M
3300009519|Ga0116108_1238640All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Candidatus Angelobacter → unclassified Candidatus Angelobacter → Candidatus Angelobacter sp. Gp1-AA117531Open in IMG/M
3300009549|Ga0116137_1093033All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Candidatus Angelobacter → unclassified Candidatus Angelobacter → Candidatus Angelobacter sp. Gp1-AA117894Open in IMG/M
3300009552|Ga0116138_1054713All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Candidatus Angelobacter → unclassified Candidatus Angelobacter → Candidatus Angelobacter sp. Gp1-AA1171138Open in IMG/M
3300009632|Ga0116102_1101036All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Candidatus Angelobacter → unclassified Candidatus Angelobacter → Candidatus Angelobacter sp. Gp1-AA117829Open in IMG/M
3300009632|Ga0116102_1173281All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Candidatus Angelobacter → unclassified Candidatus Angelobacter → Candidatus Angelobacter sp. Gp1-AA117586Open in IMG/M
3300009644|Ga0116121_1049091All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Candidatus Angelobacter → unclassified Candidatus Angelobacter → Candidatus Angelobacter sp. Gp1-AA1171328Open in IMG/M
3300010339|Ga0074046_10165128All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Candidatus Angelobacter → unclassified Candidatus Angelobacter → Candidatus Angelobacter sp. Gp1-AA1171406Open in IMG/M
3300010343|Ga0074044_10038662All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Candidatus Angelobacter → unclassified Candidatus Angelobacter → Candidatus Angelobacter sp. Gp1-AA1173321Open in IMG/M
3300010343|Ga0074044_10243616All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Candidatus Angelobacter → unclassified Candidatus Angelobacter → Candidatus Angelobacter sp. Gp1-AA1171188Open in IMG/M
3300010379|Ga0136449_101050647All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1303Open in IMG/M
3300010379|Ga0136449_101496907All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Candidatus Angelobacter → unclassified Candidatus Angelobacter → Candidatus Angelobacter sp. Gp1-AA1171034Open in IMG/M
3300010876|Ga0126361_10722562All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Candidatus Angelobacter → unclassified Candidatus Angelobacter → Candidatus Angelobacter sp. Gp1-AA117700Open in IMG/M
3300011120|Ga0150983_10515899All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Candidatus Angelobacter → unclassified Candidatus Angelobacter → Candidatus Angelobacter sp. Gp1-AA117719Open in IMG/M
3300011120|Ga0150983_11852118All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Candidatus Angelobacter → unclassified Candidatus Angelobacter → Candidatus Angelobacter sp. Gp1-AA1171151Open in IMG/M
3300012354|Ga0137366_11145278All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Candidatus Angelobacter → unclassified Candidatus Angelobacter → Candidatus Angelobacter sp. Gp1-AA117532Open in IMG/M
3300014155|Ga0181524_10009997All Organisms → cellular organisms → Bacteria7747Open in IMG/M
3300014167|Ga0181528_10638588All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Candidatus Angelobacter → unclassified Candidatus Angelobacter → Candidatus Angelobacter sp. Gp1-AA117592Open in IMG/M
3300014199|Ga0181535_10459905All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Candidatus Angelobacter → unclassified Candidatus Angelobacter → Candidatus Angelobacter sp. Gp1-AA117739Open in IMG/M
3300014489|Ga0182018_10003975All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Candidatus Angelobacter → unclassified Candidatus Angelobacter → Candidatus Angelobacter sp. Gp1-AA11712805Open in IMG/M
3300014501|Ga0182024_10008969All Organisms → cellular organisms → Bacteria20865Open in IMG/M
3300017925|Ga0187856_1115808All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Candidatus Angelobacter → unclassified Candidatus Angelobacter → Candidatus Angelobacter sp. Gp1-AA1171046Open in IMG/M
3300017940|Ga0187853_10074580All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Candidatus Angelobacter → unclassified Candidatus Angelobacter → Candidatus Angelobacter sp. Gp1-AA1171699Open in IMG/M
3300017946|Ga0187879_10007147All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Candidatus Angelobacter → unclassified Candidatus Angelobacter → Candidatus Angelobacter sp. Gp1-AA1177328Open in IMG/M
3300017946|Ga0187879_10461046All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Candidatus Angelobacter → unclassified Candidatus Angelobacter → Candidatus Angelobacter sp. Gp1-AA117705Open in IMG/M
3300017948|Ga0187847_10105217All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Candidatus Angelobacter → unclassified Candidatus Angelobacter → Candidatus Angelobacter sp. Gp1-AA1171554Open in IMG/M
3300017961|Ga0187778_10047035All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Candidatus Angelobacter → unclassified Candidatus Angelobacter → Candidatus Angelobacter sp. Gp1-AA1172634Open in IMG/M
3300017973|Ga0187780_10457769All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Candidatus Angelobacter → unclassified Candidatus Angelobacter → Candidatus Angelobacter sp. Gp1-AA117909Open in IMG/M
3300018013|Ga0187873_1200539All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Candidatus Angelobacter → unclassified Candidatus Angelobacter → Candidatus Angelobacter sp. Gp1-AA117747Open in IMG/M
3300018015|Ga0187866_1188922All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Candidatus Angelobacter → unclassified Candidatus Angelobacter → Candidatus Angelobacter sp. Gp1-AA117772Open in IMG/M
3300018017|Ga0187872_10010934All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Candidatus Angelobacter → unclassified Candidatus Angelobacter → Candidatus Angelobacter sp. Gp1-AA1175676Open in IMG/M
3300018018|Ga0187886_1323367All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Candidatus Angelobacter → unclassified Candidatus Angelobacter → Candidatus Angelobacter sp. Gp1-AA117572Open in IMG/M
3300018019|Ga0187874_10291444All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Candidatus Angelobacter → unclassified Candidatus Angelobacter → Candidatus Angelobacter sp. Gp1-AA117665Open in IMG/M
3300018033|Ga0187867_10098536All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Candidatus Angelobacter → unclassified Candidatus Angelobacter → Candidatus Angelobacter sp. Gp1-AA1171705Open in IMG/M
3300018034|Ga0187863_10134503All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Candidatus Angelobacter → unclassified Candidatus Angelobacter → Candidatus Angelobacter sp. Gp1-AA1171381Open in IMG/M
3300018035|Ga0187875_10206993All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Candidatus Angelobacter → unclassified Candidatus Angelobacter → Candidatus Angelobacter sp. Gp1-AA1171081Open in IMG/M
3300018038|Ga0187855_10576003All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Candidatus Angelobacter → unclassified Candidatus Angelobacter → Candidatus Angelobacter sp. Gp1-AA117656Open in IMG/M
3300018038|Ga0187855_10759707All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Candidatus Angelobacter → unclassified Candidatus Angelobacter → Candidatus Angelobacter sp. Gp1-AA117565Open in IMG/M
3300018042|Ga0187871_10369553All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Candidatus Angelobacter → unclassified Candidatus Angelobacter → Candidatus Angelobacter sp. Gp1-AA117792Open in IMG/M
3300018043|Ga0187887_10414307All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Candidatus Angelobacter → unclassified Candidatus Angelobacter → Candidatus Angelobacter sp. Gp1-AA117795Open in IMG/M
3300018046|Ga0187851_10028996All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Candidatus Angelobacter → unclassified Candidatus Angelobacter → Candidatus Angelobacter sp. Gp1-AA1173788Open in IMG/M
3300018047|Ga0187859_10206922All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Candidatus Angelobacter → unclassified Candidatus Angelobacter → Candidatus Angelobacter sp. Gp1-AA1171047Open in IMG/M
3300018057|Ga0187858_10907780All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Candidatus Angelobacter → unclassified Candidatus Angelobacter → Candidatus Angelobacter sp. Gp1-AA117518Open in IMG/M
3300018088|Ga0187771_10490898All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Candidatus Angelobacter → unclassified Candidatus Angelobacter → Candidatus Angelobacter sp. Gp1-AA1171039Open in IMG/M
3300018468|Ga0066662_10000086All Organisms → cellular organisms → Bacteria34630Open in IMG/M
3300020579|Ga0210407_10492818All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Candidatus Angelobacter → unclassified Candidatus Angelobacter → Candidatus Angelobacter sp. Gp1-AA117958Open in IMG/M
3300020581|Ga0210399_10632019All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Candidatus Angelobacter → unclassified Candidatus Angelobacter → Candidatus Angelobacter sp. Gp1-AA117884Open in IMG/M
3300020583|Ga0210401_11202222All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Candidatus Angelobacter → unclassified Candidatus Angelobacter → Candidatus Angelobacter sp. Gp1-AA117616Open in IMG/M
3300021171|Ga0210405_10275341All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Candidatus Angelobacter → unclassified Candidatus Angelobacter → Candidatus Angelobacter sp. Gp1-AA1171331Open in IMG/M
3300021171|Ga0210405_10643575All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Candidatus Angelobacter → unclassified Candidatus Angelobacter → Candidatus Angelobacter sp. Gp1-AA117823Open in IMG/M
3300021171|Ga0210405_10872871All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Candidatus Angelobacter → unclassified Candidatus Angelobacter → Candidatus Angelobacter sp. Gp1-AA117685Open in IMG/M
3300021406|Ga0210386_10708861All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Candidatus Angelobacter → unclassified Candidatus Angelobacter → Candidatus Angelobacter sp. Gp1-AA117867Open in IMG/M
3300021420|Ga0210394_10110059All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Candidatus Angelobacter → unclassified Candidatus Angelobacter → Candidatus Angelobacter sp. Gp1-AA1172384Open in IMG/M
3300021432|Ga0210384_10190269All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Candidatus Angelobacter → unclassified Candidatus Angelobacter → Candidatus Angelobacter sp. Gp1-AA1171844Open in IMG/M
3300021432|Ga0210384_10356191All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Candidatus Angelobacter → unclassified Candidatus Angelobacter → Candidatus Angelobacter sp. Gp1-AA1171318Open in IMG/M
3300021474|Ga0210390_11025594All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Candidatus Angelobacter → unclassified Candidatus Angelobacter → Candidatus Angelobacter sp. Gp1-AA117673Open in IMG/M
3300021479|Ga0210410_10576768All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Candidatus Angelobacter → unclassified Candidatus Angelobacter → Candidatus Angelobacter sp. Gp1-AA1171000Open in IMG/M
3300021559|Ga0210409_10060039All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Candidatus Angelobacter → unclassified Candidatus Angelobacter → Candidatus Angelobacter sp. Gp1-AA1173555Open in IMG/M
3300021559|Ga0210409_10408179All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Candidatus Angelobacter → unclassified Candidatus Angelobacter → Candidatus Angelobacter sp. Gp1-AA1171215Open in IMG/M
3300022532|Ga0242655_10122007All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Candidatus Angelobacter → unclassified Candidatus Angelobacter → Candidatus Angelobacter sp. Gp1-AA117738Open in IMG/M
3300025507|Ga0208188_1141557All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Candidatus Angelobacter → unclassified Candidatus Angelobacter → Candidatus Angelobacter sp. Gp1-AA117515Open in IMG/M
3300026552|Ga0209577_10051348All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Candidatus Angelobacter → unclassified Candidatus Angelobacter → Candidatus Angelobacter sp. Gp1-AA1173480Open in IMG/M
3300027629|Ga0209422_1000033All Organisms → cellular organisms → Bacteria32727Open in IMG/M
3300027905|Ga0209415_10338361All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1263Open in IMG/M
3300027908|Ga0209006_10372635All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Candidatus Angelobacter → unclassified Candidatus Angelobacter → Candidatus Angelobacter sp. Gp1-AA1171207Open in IMG/M
3300029636|Ga0222749_10230013All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Candidatus Angelobacter → unclassified Candidatus Angelobacter → Candidatus Angelobacter sp. Gp1-AA117937Open in IMG/M
3300029999|Ga0311339_10056672All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Candidatus Angelobacter → unclassified Candidatus Angelobacter → Candidatus Angelobacter sp. Gp1-AA1175190Open in IMG/M
3300030399|Ga0311353_10109933All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Candidatus Angelobacter → unclassified Candidatus Angelobacter → Candidatus Angelobacter sp. Gp1-AA1172672Open in IMG/M
3300030618|Ga0311354_10252233All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Candidatus Angelobacter → unclassified Candidatus Angelobacter → Candidatus Angelobacter sp. Gp1-AA1171852Open in IMG/M
3300031090|Ga0265760_10033530All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Candidatus Angelobacter → unclassified Candidatus Angelobacter → Candidatus Angelobacter sp. Gp1-AA1171517Open in IMG/M
3300031234|Ga0302325_10046313All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Candidatus Angelobacter → unclassified Candidatus Angelobacter → Candidatus Angelobacter sp. Gp1-AA1178716Open in IMG/M
3300031234|Ga0302325_10801220All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Candidatus Angelobacter → unclassified Candidatus Angelobacter → Candidatus Angelobacter sp. Gp1-AA1171330Open in IMG/M
3300031524|Ga0302320_10089480All Organisms → cellular organisms → Bacteria5046Open in IMG/M
3300031708|Ga0310686_105455927All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Candidatus Angelobacter → unclassified Candidatus Angelobacter → Candidatus Angelobacter sp. Gp1-AA1171703Open in IMG/M
3300031708|Ga0310686_105833156All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Candidatus Angelobacter → unclassified Candidatus Angelobacter → Candidatus Angelobacter sp. Gp1-AA117827Open in IMG/M
3300031715|Ga0307476_10266057All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Candidatus Angelobacter → unclassified Candidatus Angelobacter → Candidatus Angelobacter sp. Gp1-AA1171254Open in IMG/M
3300031753|Ga0307477_10001152All Organisms → cellular organisms → Bacteria23449Open in IMG/M
3300031754|Ga0307475_10617152All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Candidatus Angelobacter → unclassified Candidatus Angelobacter → Candidatus Angelobacter sp. Gp1-AA117868Open in IMG/M
3300031962|Ga0307479_10732460All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Candidatus Angelobacter → unclassified Candidatus Angelobacter → Candidatus Angelobacter sp. Gp1-AA117967Open in IMG/M
3300032160|Ga0311301_12542708All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Candidatus Angelobacter → unclassified Candidatus Angelobacter → Candidatus Angelobacter sp. Gp1-AA117571Open in IMG/M
3300032805|Ga0335078_10298302All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Candidatus Angelobacter → unclassified Candidatus Angelobacter → Candidatus Angelobacter sp. Gp1-AA1172169Open in IMG/M
3300032828|Ga0335080_11550787All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Candidatus Angelobacter → unclassified Candidatus Angelobacter → Candidatus Angelobacter sp. Gp1-AA117654Open in IMG/M
3300032892|Ga0335081_12016273All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Candidatus Angelobacter → unclassified Candidatus Angelobacter → Candidatus Angelobacter sp. Gp1-AA117615Open in IMG/M
3300033402|Ga0326728_10956883All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Candidatus Angelobacter → unclassified Candidatus Angelobacter → Candidatus Angelobacter sp. Gp1-AA117599Open in IMG/M
3300033405|Ga0326727_10472547All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Candidatus Angelobacter → unclassified Candidatus Angelobacter → Candidatus Angelobacter sp. Gp1-AA1171106Open in IMG/M



 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
PeatlandEnvironmental → Aquatic → Freshwater → Wetlands → Bog → Peatland19.61%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil15.69%
Bog Forest SoilEnvironmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil10.78%
PeatlandEnvironmental → Aquatic → Freshwater → Wetlands → Unclassified → Peatland6.86%
Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil5.88%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Soil4.90%
PalsaEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa4.90%
Peatlands SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil3.92%
Hardwood Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil3.92%
BogEnvironmental → Aquatic → Freshwater → Wetlands → Bog → Bog2.94%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil2.94%
SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Soil2.94%
Tropical PeatlandEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland2.94%
Bog Forest SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Bog Forest Soil2.94%
Peat SoilEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Peat Soil1.96%
WatershedsEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds0.98%
Vadose Zone SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil0.98%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil0.98%
PalsaEnvironmental → Terrestrial → Soil → Wetlands → Permafrost → Palsa0.98%
PermafrostEnvironmental → Terrestrial → Soil → Wetlands → Permafrost → Permafrost0.98%
BogEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Bog0.98%
Boreal Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Boreal Forest Soil0.98%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
3300001180Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM2_M3EnvironmentalOpen in IMG/M
3300002245Jack Pine, Ontario site 1_JW_OM2H0_M3 (Jack Pine, Ontario combined, ASSEMBLY_DATE=20131027)EnvironmentalOpen in IMG/M
3300004080Coassembly of ECP04_OM1, ECP04_OM2, ECP04_OM3EnvironmentalOpen in IMG/M
3300004082Coassembly of ECP03_0M1, ECP03_OM2, ECP03_OM3EnvironmentalOpen in IMG/M
3300004092Coassembly of ECP03_0M1, ECP03_OM2, ECP03_OM3, ECP04_OM1, ECP04_OM2, ECP04_OM3, ECP14_OM1, ECP14_OM2, ECP14_OM3EnvironmentalOpen in IMG/M
3300004152Coassembly of ECP12_OM1, ECP12_OM2, ECP12_OM3EnvironmentalOpen in IMG/M
3300004635Coassembly of ECP03_0M1, ECP03_OM2, ECP03_OM3, ECP04_OM1, ECP04_OM2, ECP04_OM3EnvironmentalOpen in IMG/M
3300005174Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_129EnvironmentalOpen in IMG/M
3300005575Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_151EnvironmentalOpen in IMG/M
3300006162Freshwater sediment microbial communities from Pennsylvania, USA - Little Laurel Run_MetaG_LLR_2012EnvironmentalOpen in IMG/M
3300006796Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_114EnvironmentalOpen in IMG/M
3300006800Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_109EnvironmentalOpen in IMG/M
3300009519Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_6_150EnvironmentalOpen in IMG/M
3300009549Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_20_100EnvironmentalOpen in IMG/M
3300009552Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_20_150EnvironmentalOpen in IMG/M
3300009632Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_4_40EnvironmentalOpen in IMG/M
3300009644Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_13_10EnvironmentalOpen in IMG/M
3300010339Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - Bog Forest MetaG ECP23OM3EnvironmentalOpen in IMG/M
3300010343Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - Bog Forest MetaG ECP23OM1EnvironmentalOpen in IMG/M
3300010379Sb_50d combined assemblyEnvironmentalOpen in IMG/M
3300010876Boreal forest soil eukaryotic communities from Alaska, USA - W5-5 Metatranscriptome (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300011120Combined assembly of Microbial Forest Soil metaTEnvironmentalOpen in IMG/M
3300012354Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_60_16 metaGEnvironmentalOpen in IMG/M
3300014155Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin05_60_metaGEnvironmentalOpen in IMG/M
3300014167Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin10_10_metaGEnvironmentalOpen in IMG/M
3300014199Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin17_30_metaGEnvironmentalOpen in IMG/M
3300014489Permafrost microbial communities from Stordalen Mire, Sweden - 812P2M metaGEnvironmentalOpen in IMG/M
3300014501Permafrost microbial communities from Stordalen Mire, Sweden - P3-2 metaG (Illumina Assembly)EnvironmentalOpen in IMG/M
3300017925Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_8_40EnvironmentalOpen in IMG/M
3300017940Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_6_100EnvironmentalOpen in IMG/M
3300017946Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_19_10EnvironmentalOpen in IMG/M
3300017948Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_4_10EnvironmentalOpen in IMG/M
3300017961Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP5_20_MGEnvironmentalOpen in IMG/M
3300017973Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP10_20_MGEnvironmentalOpen in IMG/M
3300018013Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_16_100EnvironmentalOpen in IMG/M
3300018015Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_11_150EnvironmentalOpen in IMG/M
3300018017Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_16_40EnvironmentalOpen in IMG/M
3300018018Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_20_150EnvironmentalOpen in IMG/M
3300018019Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_16_150EnvironmentalOpen in IMG/M
3300018033Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_13_10EnvironmentalOpen in IMG/M
3300018034Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_11_10EnvironmentalOpen in IMG/M
3300018035Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_17_10EnvironmentalOpen in IMG/M
3300018038Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_8_10EnvironmentalOpen in IMG/M
3300018042Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_16_10EnvironmentalOpen in IMG/M
3300018043Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_7_10EnvironmentalOpen in IMG/M
3300018046Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_6_10EnvironmentalOpen in IMG/M
3300018047Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_10_10EnvironmentalOpen in IMG/M
3300018057Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_8_150EnvironmentalOpen in IMG/M
3300018088Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP15_10_MGEnvironmentalOpen in IMG/M
3300018468Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_111EnvironmentalOpen in IMG/M
3300020579Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-MEnvironmentalOpen in IMG/M
3300020581Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-MEnvironmentalOpen in IMG/M
3300020583Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-MEnvironmentalOpen in IMG/M
3300021171Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-11-MEnvironmentalOpen in IMG/M
3300021406Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-OEnvironmentalOpen in IMG/M
3300021420Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-12-MEnvironmentalOpen in IMG/M
3300021432Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-MEnvironmentalOpen in IMG/M
3300021474Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-11-OEnvironmentalOpen in IMG/M
3300021479Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-4-MEnvironmentalOpen in IMG/M
3300021559Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-MEnvironmentalOpen in IMG/M
3300022532Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-C-4-M (Metagenome Metatranscriptome) (v2)EnvironmentalOpen in IMG/M
3300025507Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_8_40 (SPAdes)EnvironmentalOpen in IMG/M
3300026552Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_109 (SPAdes)EnvironmentalOpen in IMG/M
3300027629Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM2_M3 (SPAdes)EnvironmentalOpen in IMG/M
3300027905Peat soil microbial communities from Weissenstadt, Germany - SII-SIP-2007 (SPAdes)EnvironmentalOpen in IMG/M
3300027908Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_Ref_O2 (SPAdes)EnvironmentalOpen in IMG/M
3300029636Metatranscriptome of lab incubated forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-M (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300029999I_Palsa_E3 coassemblyEnvironmentalOpen in IMG/M
3300030399II_Palsa_E2 coassemblyEnvironmentalOpen in IMG/M
3300030618II_Palsa_E3 coassemblyEnvironmentalOpen in IMG/M
3300031090Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300031234Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Palsa_T0_2EnvironmentalOpen in IMG/M
3300031524Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Bog_T0_3EnvironmentalOpen in IMG/M
3300031708FICUS49499 Metagenome Czech Republic combined assemblyEnvironmentalOpen in IMG/M
3300031715Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM2C_05EnvironmentalOpen in IMG/M
3300031753Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM2C_515EnvironmentalOpen in IMG/M
3300031754Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_515EnvironmentalOpen in IMG/M
3300031962Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_515EnvironmentalOpen in IMG/M
3300032160Sb_50d combined assembly (MetaSPAdes)EnvironmentalOpen in IMG/M
3300032805Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.2EnvironmentalOpen in IMG/M
3300032828Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.4EnvironmentalOpen in IMG/M
3300032892Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.5EnvironmentalOpen in IMG/M
3300033402Lab enriched peat soil microbial communities from McLean, Ithaca, NY, United States - MB31MNEnvironmentalOpen in IMG/M
3300033405Lab enriched peat soil microbial communities from McLean, Ithaca, NY, United States - MB29MYEnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap



 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
JGI12695J13573_100225023300001180Forest SoilMRKVAVVALCCALLGSSLLAAQKQSPASGKKIEALFKAAEIPFTSSEEGSYVAVITVEEGESDRFHVYLSTIGNDPNDEKLQVVQLYFLLGALPKDAPVPIALTKQIAEWNANLTVGKVVAIGSAILYTSSSWLSRTDADGLAQDAVLGHYLSKSLRKEVAPYLKP*
JGIcombinedJ26739_10098764413300002245Forest SoilMRKVAVVALCCALLGSSLLAAQKQSPASGKKIETLFKAAEIPFTSSEEGSYVAVITVEEGESDRFHVYLSTIGNDPNDEKLQVVQLYFLLGALPKDAPVPIVLTKQIAEWNANLTVGKVVVIGSAILYTSSLWLSRTDADGLAQDAVLGHYLSKSLRKEVAPYLKP*
Ga0062385_1010479023300004080Bog Forest SoilMRKIVVAALGCALLGSTLLAAQTQSSASSKKIEALFKAAEIPFTSSEEGSYVAVITVEEGESDRFHVYSSSLGSDPNNEKLQIVQLYFLLGVLPKGSPVPIALTKQIAEWNANLTMGKIVVISNAVLYTSSEWLSRTDADTLAQDAVLAHYVSKDLRKEVAPYLKQ*
Ga0062385_1128845513300004080Bog Forest SoilMRKLAVVVLGCTLLGSTFLAAQKQPQASSKKIETLFKTAEIPFTSSEEGSYVAVITVEEGESDRFHVYVSTIGNNPNDEKLQVVQLYFLLGQLPKDTPAPIALTKQINEWNANLTVGKVVVIGSAILYTSSSWLSRTDADGLAQ
Ga0062384_10033177113300004082Bog Forest SoilMRKLPVVLLGCALLGSTFLAAQKQPQASSKKIETLFKTAEIPFTSSEEGSYVAVITVEEGESDRFHVYVSTIGNNPNDEKLQVVQLYFLLGQLPKDTPAPIALTKQINEWNANLTVGKVVVIGSAILYTSSSWLSRTDADGLAQDAVLGHYLSKDLRKEIAPYLKP*
Ga0062384_10041759523300004082Bog Forest SoilMRKIVVAALGCALLGSTLLAAQTQSSASSKKIEALFKAAEIPFTSSEEGSYVAVITVEEGQSDRFHVYSSSLGSDPNNEKLQIVQLYFLLGVLPNGSPVPIALTKQIAEWNANLTMGKIVVISNAVLYTSSEWLSRTDADTLAQDAVLAHYVSKDLRKEVAPYLKQ*
Ga0062384_10043777323300004082Bog Forest SoilLGSPLLAAQKQTQASSKKIESLFKTAEIPFTSSEEGSYVAVITVEEGESDRFHLYVSAIGNNSNDEKLQVVQLYFLLGQLPKDTPAPIALTKQISEWNANLTLGKVVVIGSAILYTSSSWLSRTDADGLAQDAVLGHYLSKDLRKEIAPYLKQ*
Ga0062389_10270081813300004092Bog Forest SoilMRKLAVVALGCALLGSTLLAAQKQPQASSKKIESLFKTAEIPFTSSEEGSYVAVITVEEGESDRFHLYVSAIGNNSNDEKLQVVQLYFLLGQLPKDTPAPIALTKQISEWNANLTLGKVVVIGSAILYTSSSWLSRTDADGLAQDAVLGHYLSKDLRKEIAPYLKQ*
Ga0062389_10490479813300004092Bog Forest SoilRKVAVVALCCALLGSTLLAAQKQSPASGKKIEALFKAAEIPFTSSEEGSYVAVITVEEGESDRFHVYLSTIGNDPNDEKLQVVQLYFLLGALPKDAPVPIALTKQIAEWNANLTVGKVVVIGSAILYTSSSWLSRTDADGLAQDAVLGHYLSKSLRKEVAPYLKP*
Ga0062386_10008109823300004152Bog Forest SoilMRKIAAAALGCALLGSTLLAAQTQSSASSKKIEALFKAAEIPFTSSEEGSYVAVITVEEGESDRFHVYSSSLGSDPNNEKLQIVQLYFLLGVLPKGSPVPIALTKQIAEWNANLTMGKIVVISNAVLYTSSEWLSRTDADTLAQDAVLAHYVSKDLRKEVAPYLKQ*
Ga0062388_10002967723300004635Bog Forest SoilMRKIVVAALGCALLGSTLLAAQTQSSASSKKIEALFKAAEIPFTSSEEGSYVAVITVEEGQSDRFHVYSSSLGSDPNNEKLQIVQLYFLLGVLPKGSPVPIALTKQIAEWNANLTMGKIVVISNAVLYTSSEWLSRTDADTLAQDAVLAHYVSKDLRKEVAPYLKQ*
Ga0062388_10115299713300004635Bog Forest SoilQASSKKIETLFKTAEIPFTSSEEGSYVAVITVEEGESDRFHVYVSTIGNNPNDEKLQVVQLYFLLGQLPKDTPAPIALTKQINEWNANLTVGKVVVIGSAILYTSSSWLSRTDADGLAQDAVLGHYLSKDLRKEIAPYLKP*
Ga0062388_10159959413300004635Bog Forest SoilMRKLAVLAFGCALLGSPLLAAQKQTQASSKKIESLFKTAEIPFTSSEEGSYVAVITVEEGESDRFHLYVSAIGNNSNDEKLQVVQLYFLLGQLPKDTPAPIALTKQISEWNANLTLGKVVVIGSAILYTSSSWLSRTDADGLAQDAVLGHYLSKDLRKEIAPYLKQ*
Ga0066680_1004420323300005174SoilMRKVAVVALVYALLGSILPAAVQEQRQQPGKKLEALFTTAEIPFTKPEEGRYVAVITVEEGESDRFHVYLSALGNDPDDEKLQVIRIYFLLGQLPKDTPVPTALTKQIAQWNANLTLGKVVVIGDAILYTSSSWLSRTDAETLALDAALGHYASKDLRKEVAPYLKQ*
Ga0066702_1032637623300005575SoilMMRRVAAMAFMFAVLGSSLPSGAQQSQGAEKQSQAQPSGKKLEALFTAAEMPFTKTEDGRYIAVITVENNESERFYVYLSALGDDVNNEKLQIITMDFLLGQLPKGTNPSTALIKQIAQWNANLTFGKVVVYGNAIVYTNSTWLARSDADTLALDAALGHYASQDLRKEVAPYLKQ*
Ga0075030_10011919423300006162WatershedsMRKVAVVALCCAFLGSPLLGAQKQAPAFGKKIEALFKAAEIPFTSSEEGSYVAVITVEEGESDRFHVYLSTIGNDPNDDKLQVVQLYFLLGALPKDAPVPIALTKQIVEWNANLTVGKVVVIGSAILYTNSSWLSRTDADGLAQDAVLGHYLSKSLRKEVAPYLKP*
Ga0066665_1020109813300006796SoilMRKVAVVALVYALLGSILPAAVQEQRQQPGKKLEALFTTAEIPFTKPEEGRYVAVITVEEGESDRFHVYLSALGNDPNDEKLQVIRIYFLLGQLPKDTPVPTALTKQIAQWNANLTLGKVVVIGDAILYTSSSWLSRTDAETLALDAALGHYASKDLRKEVAPYLKQ*
Ga0066660_1005459023300006800SoilMRRVAAMAFMFAVLGSSLPSGAQQSQGAEKQSQAQPSGKKLEALFTAAEMPFTKTEDGRYIAVITVENNESERFYVYLSALGDDVNNEKLQIITMDFLLGQLPKGTNPSTALIKQIAQWNANLTFGKVVVYGNAIVYTNSTWLARSDADTLALDAALGHYASQDLRKEVAPYLKQ*
Ga0116108_123864013300009519PeatlandMDKTMRTVAVVALSFVLLGSTLLAAQKQPQASGKKIEALFKTAEIPFTSSEEGSYVAVITVEEGESDSFHVYLSSIGNDPNDEKLQIVQYYFLLGRLPKDTPIPIALTKQIAEWNANLSVGKVIVIGSAILYTSSSWLSRTDADALAQDAVLGHYL
Ga0116137_109303313300009549PeatlandVKIGQTKKRKKDMRKLAIIALVCALLWPVLPAAAQQQAAQQQPSQSPGKKLEALFAAAEIPFTKAEEGRYIAVITVEEGESDRFQVFLTALGNDPNNEKLQVIQLYFLLGQLPKGAQVPAALIKQVAEWNANLTLGKVVIISNVILYTSS
Ga0116138_105471323300009552PeatlandMDKTMRTVAVVALSFVLLGSTLLAAQKQPQASGKKIEALFKTAEIPFTSSEEGSYVAVITVEEGESDSFHVYLSSIGNDPNDEKLQIVQYYFLLGRLPKDTPIPIALTKQIAEWNANLSVGKVIVIGSAILYTSSSWLSRTDADALAQDAVLGHYLSKSLRKEVAPYLKP*
Ga0116102_110103623300009632PeatlandMRKLAIVALVCALLWPVLPAAAQQQAAQQQPSQSPGKKLEALFAAAEIPFTKAEEGRYIAVITVEEGESDRFQVFLTALGNDPNNEKLQVIQLYFLLGQLPKGAQVPAALIKQVAEWNANLTLGKVVIISNVILYTSSSWLSRTD
Ga0116102_117328123300009632PeatlandMDKTMRTVAVVALSFVLLGSTLLAAQKQPQASGKKIEALFKTAEIPFTSSEEGSYVAVITVEEGESDSFHVYLSSIGNDPNDEKLQIVQYYFLLGRLPKDTPIPIALTKQIAEWNANLSVGKVIVIGSAILYTSSSWLSRTDADALA
Ga0116121_104909113300009644PeatlandMEKNMRKLAVVALSCALLGSTLLAAQKQPQASSKKIEALFKTAEIPFTSSEEGSYVAVITVEEGESDRFHVYVTAIGSDPNNEKLQVVQLYFLLGQLPKGTPVPVALTKQIAEWNANLTLGKVVVIGSAILYTSSSWLSRTDADGLAQDAVLGHYLSKDLRKEIAPY
Ga0074046_1016512823300010339Bog Forest SoilMRKLAIVALVCALLWPVLPAAAQQQAAQQQPSQSPGKKLEALFAAAEIPFTKAEEGRYIAVITVEEGESDRFQVFLTALGNDPNNEKLQVIQLYFLLGQLPKGAQVPAPLIKQVAEWNANLTLGKVVIISNVILYTSSSWLSRTDADTLAVDAVVGHYASKDLRKNVEPYLKQ*
Ga0074044_1003866223300010343Bog Forest SoilLGSTLLAAQKQSPASGKKIEALFKAAEIPFTSSEEGSYVAVITVEEGESDRFHVYLSTIGNDPNDEKLQVVQLYFLLGTLPKDAPVPIALTKQIAEWNANLTVGKVVVIGSAILYTSSSWLSRTDADGLAQDAVLGHYLSKSLRKEVAPYLKP*
Ga0074044_1024361613300010343Bog Forest SoilMRKIVVAALGCALLGSTLLAAQTQSSASSKKIEALFKAAEIPFTSSEGGSYVAVITVEEGESDRFHVYSSSLGSDPNNEKLQIVQLYFLLGVLPKGSPVPIALTKQIAEWNANLTMGKIVVISNAVLYTSSEWLSRTDADTLAQDAVLAHYVSKDLRKEVAPYLKQ*
Ga0136449_10105064713300010379Peatlands SoilIQDTRRNNMRKVVVVALCCALLGSTLLAAQKQSPASGKKIEALFKAAEIPFTSSEEGSYVAVITVEEGESDRFHVYLSTIGNDPNDEKLQVVQLYFLLGALPKDAPVPIALTKQIAEWNANLTVGKVVVSGSAILYTSSSWLSRTDADGLAQDAVLGHYLSKSLRKEVAPYLKP*
Ga0136449_10149690723300010379Peatlands SoilIIALVCAILWPVLPAAAQQQPSSQSSGKKLEALFTTAEIPFTKAEEGRYIAVITVEEGESDRFQVFLTALGNDPNNEKLQVIQLYFLLGQLPKGAQVPAALIKQVAEWNANLTLGKVVILGNAILYTSSSWLSRTDADTLAVDAVVGHYASRDLRKNVEPYLKQ*
Ga0126361_1072256213300010876Boreal Forest SoilMEKNMRKLAVAVLGCALLGSTFLAAQKQPQASSKKIETLFKTAEIPFTSSEEGSYVAVITVEEGESDRFHVYVSTIGNNPNDEKLQVVQLYFLLGQLPKDTPAPIALTKQINEWNANLTVGKVVVIGSAILYTSSSWLSRTDADGLAQDAVLGHYLSKDLR
Ga0150983_1051589913300011120Forest SoilHMRKVAVVALCCAFLGSPLLGAQKQAPAFGKKIEALFKAAEIPFTSSEEGSYVAVITVEEGESDRFHVYLSTIGNDPNDDKLQVVQLYFLLGALPKDAPVPIALTKQIAQWNANLTVGKVVVIGSAILYTSSSWLSRTDADGLAQDAVLGHYLSKSLRKEVAPYLKP*
Ga0150983_1185211823300011120Forest SoilMEKNMRKLAVIALSCALLGSTFLAAQKQPQASSKKIEALFKTAEIPFTSSEEGSYVAVITVEEGESDRFHVYVTAIGNDPNNEKLQVVQLYFLLGQLPKGTPVPVALTKQIAEWNANLTLGKVVVIETAILYTSSSWLSRTDADGLAQDAVLGHYLSKDLRKEIAPYLKP*
Ga0137366_1114527813300012354Vadose Zone SoilPASGKKIEALFKAAEIPFTSSEEGSYVAVITVEEGESDRFHVYLSTIGDDPNDDKLQVVQLYFLLGALPKDAPVPIALTKQIAEWNANLTVGKVVVIGSAILYTSSSWLSRTDADGLAQDAVLGHYLSKSLRKEVAPYLKP*
Ga0181524_1000999743300014155BogMDKTMRKVSLAALSCALLASTLLAAQQQPQVSGKKIEALFKAAEIPFTSSEEGSYVAVITVEEGESDRFHVYLTSIGNDPNDEKLQIVQLYFLLGLLPKDTQTPIALTKQIAEWNGNLSIGKVVVIGSAILYTSSSWLSRTDADALAQDAVLGHYVSKDLRKEVAPYLKP*
Ga0181528_1063858813300014167BogMRKIAVAALACALLGSTLLAAQTQSSASSKKIEALFKAAEIPFTSSEEGSYVAVITVEEGESDRFHVYSSSLGNDPNNEKLQIIQLYFLLGVLPKNSPVPIALTKQIAEWNANLTMGKIVVISNAILYTTSEWLSRTDADTLAQDAVLAHYVSKDLRKEVAPYLKQ*
Ga0181535_1045990513300014199BogNMKKLAIIALVCAILGPVLPAAAQQQQSQPSGKKLEALFAAADMPFTKRDEGRYIAVITVEEGESDRFQVILTALGDNPNNEKLQVIKMYFFLGQLPKGAQVPTALIKQVAEWNANLTLGKVVIIGDSILYTSSSWLSRTDADTLGLDAVVGHYASKNLRKEVAPYLKQ*
Ga0182018_1000397573300014489PalsaMEKNMRKLPVVLLGCALLGSTFLAGQKQPQASSKKIETLFKTAEIPFTSSEEGSYVAVITVEEGESDRFHVYVSTIGNNPNDEKLQVVQLYFLLGQLPKDTPAPIALTKQINEWNSNLTVGKVVVIGSAILYTSSSWLSRTDADGLAQDAVLGHYLSKDLRKEIAPYLKP*
Ga0182024_1000896973300014501PermafrostMEKNMRKLALVALSCALLGSTLLAAQKQPQASSKKIEALFKTAEIPFTSSEEGSYVAVITVEEGESDRFHVYVTAIGSDPNNEKLQVVQLYFLLGQLPKGTPVPVALTKQIAEWNANLTLGKVVVIGSAILYTSSSWLSRTDADGLAQDAVLGHYLSKDLRKEIAPYLKP*
Ga0187856_111580813300017925PeatlandMRSVRLLALFLAVLGAVLPAASQKQPAQQPAGKKLEVLFTTAEIPFTKPEEGSYVAVITVEDNESERFHVLLTTIGSDPNNEKLQVIQMYFLLGRVPKDTQVPIALIKQIAEWNASLTLGKVAVFNNAVMYMSSSWLARTDAETLAQDAVLGHYVSQDLRKEIAPYLKQ
Ga0187853_1007458023300017940PeatlandMRTVAVVALSFVLLGSTLLAAQKQPQASGKKIEALFKTAEIPFTSSEEGSYVAVITVEEGESDSFHVYLSSIGNDPNDEKLQIVQYYFLLGRLPKDTPIPIALTKQIAEWNANLSVGKVIVIGSAILYTSSSWLSRTDADALAQDAVLGHYLSKSLRKEVAPYLKP
Ga0187879_1000714713300017946PeatlandMDKTMRTVAVVALSFVLLGSTLLAAQKQPQASGKKIEALFKTAEIPFTSSEEGSYVAVITVEEGESDSFHVYLSSIGNDPNDEKLQIVQYYFLLGRLPKDTPIPIALTKQIAEWNANLSVGKVIVIGSAILYTSSSWLSRTDADALAQDAVLGHYLSKSLRKEVAPYLKP
Ga0187879_1046104613300017946PeatlandEKNMRKLPVVLLGCALLGSTFLGAQKQPQASSKKIETLFKTAEIPFTSSEEGSYVAVITVEEGESDRFHVYVSTIGNNPNDEKLQVVQLYFLLGALPKDAPVPIALTKQIAEWNANLTVGKVVVSGSAILYTSSSWLSRTDADGLAQDAVLGHYLSKSLRKEVAPYLKP
Ga0187847_1010521713300017948PeatlandMRKLPVVLLGCALLGSTFLGAQKQPQASSKKIETLFKTAEIPFTSSEEGSYVAVITVEEGESDRFHVYVSTIGNNPNDEKLQVVQLYFLLGQLPKDTPAPIALTKQINEWNANLTVGKVVVIGSAILYTSSSWLSRTDADGLAQDAVLGHYLSKDLRKEIAPYLKP
Ga0187778_1004703543300017961Tropical PeatlandMSKILAVALGCALLGSTLFAAQTQSSASSKKIEALFKAAEIPFTSSEEGSYVAVITVEEGESDRFHVYLSSLGNDPNNEKLQIVQLYFLLGALPKGSPVPIALTKQIAEWNANLTMGKIVVIGSTILYTSSEWLSRTDADTLAQDAVLAHYVSKDLRKEVAPYLKE
Ga0187780_1045776923300017973Tropical PeatlandMRKVAIVALCCALLGPSLLAEQKQSPASGRKIEALFKAAEIPFTSSEEGSYVAVITVEEGECDRFHVYLSAIGSDPNDEKLQVVQLYFLLGLLPKDTPAPIALTKQIAEWNANLTVGKVVVIGGAVLYTNSSWLSRTDADGLAQDAVLGHYLSKSLRKEVAPYLKP
Ga0187873_120053913300018013PeatlandMDKTMRTVAVVALSFVLLGSTLLAAQKQPQASGKKIEALFKTAEIPFTSSEEGSYVAVITVEEGESDSFHVYLSSIGNDPNDEKLQIVQYYFLLGRLPKDTPIPIALTKQIAEWNANLSVGKVIVIGSAILYTSSSWLSRTDADALAQDAV
Ga0187866_118892213300018015PeatlandMRKLAIIALVCALLWPVLPAAAQQQAAQQQPSQSPGKKLEALFAAAEIPFTKAEEGRYIAVITVEEGESDRFHVFLTALGNDPNNEKLQVIQLYFLLGQLPKGAQVPAALIKQVAEWNANLTLGKVVIISNVILYTSSSWLSRTDADTLAVDAVVGHYASKDLRKNVEPYLKQ
Ga0187872_1001093433300018017PeatlandMRKVSLAALSCALLASTLLAAQQQPQVSGKKIEALFKAAEIPFTSSEEGSYVAVITVEEGESDRFHVYLTSIGNDPNDEKLQIVQLYFLLGLLPKDTQTPIALTKQIAEWNGNLSIGKVVVIGSAILYTSSSWLSRTDADALAQDAVLGHYVSKDLRKEVAPYLKP
Ga0187886_132336713300018018PeatlandMRTVAVVALSFVLLGSTLLAAQKQPQASGKKIEALFKTAEIPFTSSEEGSYVAVITVEEGESDSFHVYLSSIGNDPNDEKLQIVQYYFLLGRLPKDTPIPIALTKQIAEWNANLSVGKVIVIGSAILYTSSSWLSRTDAD
Ga0187874_1029144413300018019PeatlandAQKQPQASGKKIEALFKTAEIPFTSSEEGSYVAVITVEEGESDSFHVYLSSIGNDPNDEKLQIVQYYFLLGRLPKDTPIPIALTKQIAEWNANLSVGKVIVIGSAILYTSSSWLSRTDADALAQDAVLGHYLSKSLRKEVAPYLKP
Ga0187867_1009853623300018033PeatlandMDKTMRTVAVVALSFVLLGSTLLAAQKQPQASGKKIEALFKTAEIPFTSSEEGSYVAVITVEEGESDSFHVYLSSIGNDPNDEKLQIVQYYFLLGRLPKDTPIPIALTKQIAEWNANLSVGKVIVIGSAILYTSSSWLSRTDADALAQDAVLGHYLSKSLRKEV
Ga0187863_1013450323300018034PeatlandMRKVAVVALCCALLGSTLLAAQKQSPASGKKIEALFKAAEIPFTSSEEGSYVAVITVEEGESDRFHVYLSTIGNDPNDEKLQVVQLYFLLGTLPKETPVPIALTKQIAEWNANLTVGKVVVIGSAILYTSSSWLSRTDADGLAQDAVLGHYLSKSLRKEVAPYLKP
Ga0187875_1020699323300018035PeatlandMRTVAVVALSFVLLGSTLLAAQKQPQASSKKIETLFKAAEIPFTSSEEGSYVAVITVEEGESDRFHAYVSTIGNNPNDEKLQVVQLYFLLGQLPKDTPAPIALTKQINEWNANLTVGKVVVIGSAILYTSSSWLSRTDADGLAQDAVLGHYLSKDLRKEIAPYLKP
Ga0187855_1057600313300018038PeatlandNPGKMEKNMRKLAVVVLGCALLGSTFLAAQKQPQASSKKIETLFKTAEIPFTSSEEGSYVAVITVEEGESDRFHVYVSTIGNNPNDEKLQVVQLYFLLGQLPKDTPAPIALTKQINEWNANLTVGKVVVIGSAILYTSSSWLSRTDADGLAQDAVLGHYLSKDLRKEIAPYLKP
Ga0187855_1075970713300018038PeatlandSGKKIEALFKAAEIPFTSSEEGSYVAVITVEEGESDRFHVYLSTIGNDPNDEKLQVVQLYFLLGALPKDAPVPIPLTKQIAEWNANLTVGKVVVIGSAILYTSSSWLSRTDADGLAQDAVLGHYLSKSLRKEVAPYLKP
Ga0187871_1036955313300018042PeatlandKSRREELAFRFFKLGQSKRMDKTMRTVAVVALSFVLLGSTLLAAQKQPQASSKKIETLFKTAEIPFTSSEEGSYVAVITVEEGESDRFHVYVSTIGNNPNDEKLQVVQLYFLLGQLPKDTPAPIALTKQINEWNANLTVGKVVVIGSAILYTSSSWLSRTDADGLAQDAVLGHYLSKSLRKEVAPYLKP
Ga0187887_1041430723300018043PeatlandMRKVAVVALCCALLGSSLLAAQKQSPASGKKIEALFKAAEIPFTSSEEGSYVAVITVEEGESDRFHVYLSTIGNDPNDEKLQVVQLYFLLGALPKDAPVPIPLTKQIAEWNANLTVGKVVVIGSAILYTNSSWLSRTDADGLAQDAVLGHYLSKSLRKEVAPYLKP
Ga0187851_1002899623300018046PeatlandMRKLAVVALSCALLGSTLLAAQKQPQASSKKIEALFKTAEIPFTSSEEGSYVAVITVEEGESDRFHVYVTAIGSDPNNEKLQVVQLYFLLGQLPKGTPVPVALTKQIAEWNSNLTLGKVVVIGSAILYTSSSWLSRTDADGLAQDAVLGHYLSRDLRKEIAPYLKP
Ga0187859_1020692213300018047PeatlandMRKLPVVLLGCALLGSTFLAAQKQPQASSKKIETLFKTAEIPFTSSEEGSYVAVITIEEGESDRFHVYVSTIGNNPNDEKLQVVQLYFLLGQLPKDTPAPIALTKQINEWNANLTVGKVVVIGSAILYTSSSWLSRTDADGLAQDAVLGHYLSKDLRKEIAPYLKP
Ga0187858_1090778013300018057PeatlandQPQVSGKKIEALFKAAEIPFTSSEEGSYVAVITVEEGESDRFHVYLTSIGNDPNDEKLQIVQLYFLLGLLPKDTQTPIALTKQIAEWNGNLSIGKVVVIGSAILYTSSSWLSRTDADALAQDAVLGHYVSKDLRKEVAPYLKP
Ga0187771_1049089813300018088Tropical PeatlandMRKIVAAALACALLGSTLLAAQTQSSASSKKIEALFKAAEIPFTSSEEGSYVAVITVEEGESDRFHVYLSSLGNDPNNEKLQIVQLYFLLGVLPKGSPVPVALTKQIAEWNANLTMGKIVVISNAVLYTSSEWLSRTDADTLAQDAVLAHYVSKDLRKEVAPYLK
Ga0066662_1000008643300018468Grasslands SoilMMRRVAAMAFMFAVLGSSLPSGAQQSQGAEKQSQAQPSGKKLEALFTAAEMPFTKTEDGRYIAVITVENNESERFYVYLSALGDDVNNEKLQIITMDFLLGQLPKGTNPSTALIKQIAQWNANLTFGKVVVYGNAIVYTNSTWLARSDADTLALDAALGHYASQDLRKEVAPYLKQ
Ga0210407_1049281813300020579SoilMVKNMRKLAVVALSCALLGSTLLAAQKQAQASSKKIEALFKTAEIPFTSSEEGSYVAVITVEEGESDRFHVYVTAIGSDPNNEKLQVVQLYFLLGQLPKGTPVPVALTKQIAEWNSNLTLGKVVVIGTAILYTSSSWLSRTDADGLAQDAVLGHYLSKDLRKEIAPYLKP
Ga0210399_1063201913300020581SoilMRKVAVVALCCAFLGSPLLGAQKQAPASGKKIEALFKAAEIPFTSSEEGSYVAVITVEEGESDRFHVYLSTIGNDPNDDKLQVVQLYFLLGALPKDAPVPIALTKQIAQWNANLTVGKVVVIGSAILYTSSSWLSRTDADGLAQDAVLGHYLSKSLRKEVAPYLKP
Ga0210401_1120222213300020583SoilKKIEALFKAAEIPFTNSEEGSYVAVITVEEGESDRFHVYLSTIGNDPNDDKLQVVQLYFLLGALPKDAPVPIALTKQIAQWNANLTVGKVVVIGSAILYTSSSWLSRTDADGLAQDAVLGHYLSKSLRKEVAPYLKP
Ga0210405_1027534123300021171SoilMENNMRKVAVVALCCVLMGSTLLTAQKQPQASGKKIEALFKAAQIPFTSSEEGSYVAVITVEEGESDRFHVYLTSIGNDPNDEKLQIIQLYFLLGLLPKGTQTPIALTKQIAEWNANLSVGKVVVISGAILYTSSSWLFRTDADALAQDAVLGHYLSKDLRKEITPYLKP
Ga0210405_1064357523300021171SoilMSKIVAVALGCALLGSTLFAAQTQSPASSKKIEALFKAAEIPFTSSEEGSYVAVITVEEGESDRFHVYLSSLGNDPNNEKLQIVQLYFLLGALPKGSPVPIALTKQIAEWNANLTMGKIVVIGSAILYTSSEWLSRTDADTLAQDAVLAHYVSKDLRKEVAPYLKQ
Ga0210405_1087287123300021171SoilMRKVAVVALCCAFLGSPLLGAQKQAPASGKKIEALFKAAEIPFTSSEEGSYVAVITVEEGESDRFHVYLSTIGNDPNDDKLQVIQLYFLLGALPKDAPVPIALTKQIAQWNANLTVGKVVVIGSAILYTSSSWLSRTD
Ga0210386_1070886123300021406SoilMRKVAVVALCCALLGSSLLAAQKQSPASGKKIEALFKAAEIPFTSSEEGSYVAVITVEEGESDRFHVYLSTIGNDPNDEKLQVVQLYFLLGALPKDAPVPIALTKQIAEWNANLTVGKVVVIGSAILYTSSSWLSRTDADGLAQDAVLGHYLSKSLRKEVAPYLKP
Ga0210394_1011005913300021420SoilMVKNMRKLAVLALSCALLGSTLLAAQKQPQASSKKIEALFKTAEIPFTSSEEGSYVAVITVEEGESDRFHVYVTAIGSDPNNEKLQVVQLYFLLGQLPKGTPVPVALTKQIAEWNSNLTLGKVVVIGSAILYTSSSWLSRTDADGLAQDAVLGHYLSKDLRKEIAPYLKP
Ga0210384_1019026933300021432SoilMRKVAASVTLVCAFLASNLSAAAQQHQEPGKKLEALFTAAEIPFTKPEDGRYVAVVTVEEGESDRFHVYLSALGNDPKDEKLQVLQMYFLLGQLPKDTPVPTALTKQIAEWNASLTFGKVIVIGTSILYTTSSWLSRTDADTLALDAALAHYVSKDLRKAITPYIKQ
Ga0210384_1035619123300021432SoilMRKVAVVALCCAFLGSPLLGAQKQAPASGKKIEALFKAAEIPFTSSEEGSYVAVITVEEGESDRFHVYLSTIGNDPNDDKLQVVQLYFLLGALPKDAPVPIALTKQIAEWNANLTVGKVVVIGSAILYTSSSWLSRTDADGLAQDAVLGHYLSKSLRKEVAPYLKP
Ga0210390_1102559413300021474SoilCALLSSTLLAAQKQPQASSKKIEALFKTAEIPFTSSEEGSYVAVITVEEGESDRFHVYVTAIGSDPNNEKLQVVQLYFLLGQLPKGTPVPVALTKQIAEWNANLTLGKVVVIGSAILYTSSSWLSRTDADGLAQDAVLGHYLSKDLRKEIAPYLKP
Ga0210410_1057676823300021479SoilMRKLAVVALSCALLGSTLLAAQKQPQASSKKIEALFKTAEIPFTSSEEGSYVAVITVEEGESDRFHVYVTAIGSDPNNEKLQVVQLYFLLGQLPKGTPVPVALTKQIAEWNSNLTLGKVVVIGTAILYTSSSWLSRTDADGLAQDAVLGHYLSKDLRKEIAPYLKP
Ga0210409_1006003923300021559SoilMRKVAVVALCCALLGSTLLAAQKQSPASGKKIEALFKAAEIPFTSSEEGSYVAVITVEEGESNRFHVYLSSIGNDPNDEKLQVVQLYFLLGALPKDAPVPIALTKQIAEWNANLTVGKVVVIGSAILYTSSSWLSRTDADGLAQDAVLGHYLSKSLRKEVAPYLKP
Ga0210409_1040817913300021559SoilMRKLAVIALSCALLGSTLLAAQKQPQASSKKIEALFKTAEIPFTSSEEGTYVAVITVEEGESDRFHVYVTAIGSDPNNEKLQVVQLYFLLGQLPKGTPVPVALTKQIAEWNSNLTLGKVVVIGSAILYTSSSWLSRTDADGLAQDAVLGHYLSKDLRKEIAPYLKP
Ga0242655_1012200723300022532SoilKVAVVALCCAFLGSPLLGAQKQAPAFGKKIEALFKAAEIPFTNSEEGSYVAVITVEEGESDRFHVYLSTIGNDPNDDKLQVVQLYFLLGALPKDAPVPIALTKQIAQWNANLTVGKVVVIGSAILYTSSSWLSRTDADGLAQDAVLGHYLSKSLRKEVAPYLKP
Ga0208188_114155713300025507PeatlandRMDKTMRTVAVVALSFVLLGSTLLAAQKQPQASGKKIEALFKTAEIPFTSSEEGSYVAVITVEEGESDSFHVYLSSIGNDPNDEKLQIVQYYFLLGRLPKDTPIPIALTKQIAEWNANLSVGKVIVIGSAILYTSSSWLSRTDADALAQDAVLGHYLSKSLRKEVAPYLKP
Ga0209577_1005134833300026552SoilMRRVAAMAFMFAVLGSSLPSGAQQSQGAEKQSQAQPSGKKLEALFTAAEMPFTKTEDGRYIAVITVENNESERFYVYLSALGDDVNNEKLQIITMDFLLGQLPKGTNPSTALIKQIAQWNANLTFGKVVVYGNAIVYTNSTWLARSDADTLALDAALGHYASQDLRKEVAPYLKQ
Ga0209422_1000033273300027629Forest SoilMRKVAVVALCCALLGSSLLAAQKQSPASGKKIEALFKAAEIPFTSSEEGSYVAVITVEEGESDRFHVYLSTIGNDPNDEKLQVVQLYFLLGALPKDAPVPIALTKQIAEWNANLTVGKVVAIGSAILYTSSSWLSRTDADGLAQDAVLGHYLSKSLRKEVAPYLKP
Ga0209415_1033836113300027905Peatlands SoilCCALLGSTLLAAQKQSPASGKKIEALFKAAEIPFTSSEEGSYVAVITVEEGESDRFHVYLSTIGNDPNDEKLQVVQLYFLLGALPKDAPVPIALTKQIAEWNANLTVGKVVVSGSAILYTSSSWLSRTDADGLAQDAVLGHYLSKSLRKEVAPYLKP
Ga0209006_1037263513300027908Forest SoilMRKVAVVALCCALLGSSLLAAQKQSPASGKKIETLFKAAEIPFTSSEEGSYVAVITVEEGESDRFHVYLSTIGNDPNDEKLQVVQLYFLLGALPKDAPVPIVLTKQIAEWNANLTVGKVVVIGSAILYTSSLWLSRTDADGLAQDAVLGHYLSKS
Ga0222749_1023001323300029636SoilMRKVAVVALCCAFLGSPLLGAQKQAPAFGKKIEALFKAAEIPFTSSEEGSYVAVITVEEGESDRFHVYLSTIGNDPNDDKLQVVQLYFLLGALPKDAPVPIALTKQIAEWNANLTVGKVVVIGSAILYTSSSWLSRTDADGLAQDAVLGHYLSKSLRKEVAPYLKP
Ga0311339_1005667233300029999PalsaMRKLAVAVLGCALLGSTFLAAQKQPQASSKKIETLFKTAEIPFTSSEEGSYVAVITVEEGESDRFHVYVSTIGNNPNDEKLQVVQLYFLLGQLPKDTPAPIALTKQINEWNSNLTVGKVVVIGSAILYTSSSWLSRPDADGLAQDAVLGHYLSKDLRKEIAPYLKP
Ga0311353_1010993333300030399PalsaMRKLAVAVLGCALLGSTFLAAQKQPQASSKKIETLFKTAEIPFTSSEEGSYVAVITVEEGESDRFHVYVSTIGNNPNDEKLQVVQLYFLLGQLPKDTPAPIALTKQINEWNANLTVGKVVVIGSAILYTSSSWLSRTDADGLAQDAVLGHYLSKDLRKEIAPYLKP
Ga0311354_1025223323300030618PalsaMRKLAVAVLGCALLGSTFLAAQKQPQASSKKIETLFKTAEIPFTSSEEGSYVAVITVEEGESDRFHVYVSTIGNNPNDEKLQVVQLYFLLGQLPKDTPAPIALTKQINEWNANLTVGKVVVIGSAILYTSSSWL
Ga0265760_1003353023300031090SoilMRNVAVVALCCALLGSTLLAAQKQSPASGKKIEALFKAAEIPFTSSEEGSYVAVITVEEGESDRFHVYLSTIGNDPNDEKLQVVQLYFLLGALPKDAPVPIALTKQIAEWNANLTVGKVVVIGSAILYTSSSWLSRTDADGLAQDAVLGHYLSKSLRKEVAPYLKP
Ga0302325_1004631323300031234PalsaMRKLAVAVLGCALLGSTFLAAQKQPQASSKKIETLFKTAEIPFTSSEEGSYVAVITVEEGESDRFHVYVSTIGNNPNDEKLQVVQLYFLLGQLPKDTPAPIALTKQINEWNANLTVGKVVVIGSAILYTSSSWLSRPDADGLAQDAVLGHYLSKDLRKEIAPYLKP
Ga0302325_1080122023300031234PalsaMRKVVVVALCCALLGSTLLAAQKQSPASGKKIEALFKAAEIPFTSSEEGSYVAVITVEEGESDRFHVYLSTIGNDPNDEKLQVVQLYFLLGALPKDAPVPIALTKQIAEWNANLTVGKVVVSGSAILYTSSSWLSRTDADGLAQDA
Ga0302320_1008948013300031524BogMRKVVVVALCCALLGSTLLAAQKQSPASGKKIEALFKAAEIPFTSSEEGSYVAVITVEEGESDRFHVYLSTIGNDPNDEKLQVVQLYFLLGALPKDAPVPIALTKQIAEWNANLTVGKVVVSGSAILYTSSSWLSRTDADGLAQDAVLGHYLSKSLRKEVAPYLKP
Ga0310686_10545592713300031708SoilIQDTRRNNMRKVAVVALCCALLGSSLLAARKQSPASGKKIETLFKAAEIPFTSSEEGSYVAVITVEEGESDRFHVYLSTIGNDPNDEKLQVVQLYFLLGALPKDAPVPIVLTKQIAEWNANLTVGKVVVIGSAILYTSSLWLSRTDADGLAQDAVLGHYLSKSLRKEVAPYLKP
Ga0310686_10583315623300031708SoilMRKLAVIALSCALLGSTLLAAQKQPPASSKKIEALFKTAEIPFTSSEEGSYVAVITVEEGESDRFHVYVTAIGNDPNNEKLQVVQLYFLLGQLPKDTPVPVALTKQIAEWNANLTLGKVVVIGSAILYTSSSWLSRTDADGLTQDAVLGHYLSKDLRKEIAPYLKP
Ga0307476_1026605723300031715Hardwood Forest SoilMRKLAVVVLGCTLLGSTFLAAQKQPQASSKKIETLFKTAEIPFTSSEEGSYVAVITVEEGESDRFHVYVSAIGSNPNDEKLQVVQLYFLLGQLPKDTPAPIALTKQINEWNANLTVGKVVVIGSAILYTSSSWLSRTDADGLAQDAVLGHYLSKDLRKEIAPYLKP
Ga0307477_1000115283300031753Hardwood Forest SoilMRKLAVVALSCALLGSTLLAAQKQPQASSKKIEALFKTAEIPFTSSEEGSYVAVITVEEGESDRFHVYVTAIGSDPNNEKLQVVQLYFLLGQLPKGTPVPVALTKQIAEWNANLTLGKVVVIGSTILYTSSSWLSRTDADGLAQDAVLGHYLSKDLRKEIAPYLKP
Ga0307475_1061715213300031754Hardwood Forest SoilMRKLAVVALSCALLGSTLLAAQKQPQASGKKIEALFKTAEIPFTSSEEGSYVAVITVEEGESDRFHVYVTAIGSDPNNEKLQVVQLYFLLGQLPKGTPVPVALTKQIAEWNSNLTLGKVVVIGSAILYTSSSWLSRTDADGLAQDAVLGHYLSKDLRKEIAPYLKP
Ga0307479_1073246013300031962Hardwood Forest SoilMRKLAVVALSCALLGSTLLAAQKQPQASSKKIEALFKTAEIPFTSSEEGSYVAVITVEEGESDRFHLYVTAIGSDPNNEKLQVVQLYFLLGQLPKGTPVPVALTKQIAEWNSNLTLGKVVVIGTAILYTSSSWLSRTDADGLAQDAVLGHYLSKDLRKEIAPYLKP
Ga0311301_1254270813300032160Peatlands SoilIIALVCAILWPVLPAAAQQQPSSQSSGKKLEALFTTAEIPFTKAEEGRYIAVITVEEGESDRFQVFLTALGNDPNNEKLQVIQLYFLLGQLPKGAQVPAALIKQVAEWNANLTLGKVVILGNAILYTSSSWLSRTDADTLAVDAVVGHYASRDLRKNVEPYLKQ
Ga0335078_1029830223300032805SoilMSKILAVALGWALLGSTLFAAQTQSSASSKKIEALFKAAEIPFTSSEEGSYVAVVTVEEGESDRFHVYLSSLGNDPNNEKLQIVQLYFLLGALPKGSPVPIALTKQIAEWNANLTMGKIVVIGNAILYTSSEWLSRT
Ga0335080_1155078713300032828SoilMSKILAVALGCALLGSTLFAAQTQSSASSKKIEALFKAAEIPFTSSEEGSYVAVVTVEEGESDRFHVYLSSLGNDPNNEKLQIVQLYFLLGALPKGSPVPIALTKQIAEWNANLTMGKIVVIGNAILYTSSEWLSRTDADTLAQDAVL
Ga0335081_1201627313300032892SoilMSKILAVALGWALLGSTLFAAQTQSSASSKKIEALFKAAEIPFTSSEEGSYVAVVTVEEGESDRFHVYLSSLGNDPNNEKLQIVQLYFLLGALPKGSPVPIALTKQIAEWNANLTMGKIVVIGNAILYTSSEWLSRTDADTLAQDAVLAHYVSKDLRKEVAPYLKQ
Ga0326728_1095688313300033402Peat SoilMRTLALCVLMCALCGPGIPASAQPQTQTRGAKLEALFTAAQMPFVKTEEGSYVAVITVDEGESDRFHVYQTAIGNDPNDEQLQVVHLYFLLGQLPKDAPVPIALIKQIVEWNAGLTMGKVVILDNTIVYTSSSWLSKTDADSLSLDALVGHYAS
Ga0326727_1047254723300033405Peat SoilMRTLALCVLMCALCGPGIPASAQPQTQTRGAKLEALFTAAQMPFVKTEEGSYVAVITVDEGESDRFHVYQTAIGNDPNDEQLQVVHLYFLLGQLPKDAPVPIALIKQIVEWNAGLTMGKVVILDNTIVYTSSSWLSKTDADSLSLDALVGHYASKKLRKDIEPYLKQ


 ⦗Top⦘


© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.