NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F100779

Metagenome / Metatranscriptome Family F100779

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F100779
Family Type Metagenome / Metatranscriptome
Number of Sequences 102
Average Sequence Length 48 residues
Representative Sequence LSLQDAANGIKALYDDMLNRAWSDSKARGEKLPPESQKAIPPTVPGQQ
Number of Associated Samples 88
Number of Associated Scaffolds 102

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 0.98 %
% of genes near scaffold ends (potentially truncated) 100.00 %
% of genes from short scaffolds (< 2000 bps) 98.04 %
Associated GOLD sequencing projects 87
AlphaFold2 3D model prediction Yes
3D model pTM-score0.66

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (100.000 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil
(23.529 % of family members)
Environment Ontology (ENVO) Unclassified
(39.216 % of family members)
Earth Microbiome Project Ontology (EMPO) Free-living → Non-saline → Soil (non-saline)
(64.706 % of family members)



 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      


 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 39.47%    β-sheet: 0.00%    Coil/Unstructured: 60.53%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  
pTM-score: 0.66
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.


 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 102 Family Scaffolds
PF00115COX1 4.90
PF00072Response_reg 0.98
PF13670PepSY_2 0.98
PF03597FixS 0.98

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 102 Family Scaffolds
COG3197Cytochrome oxidase maturation protein, CcoS/FixS familyPosttranslational modification, protein turnover, chaperones [O] 0.98


 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms100.00 %
UnclassifiedrootN/A0.00 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
2124908016|OU_2_1_1_newblercontig110417All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria512Open in IMG/M
2170459016|G1P06HT02HB7R2All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria581Open in IMG/M
3300000956|JGI10216J12902_121356807All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria822Open in IMG/M
3300004114|Ga0062593_101214479All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria792Open in IMG/M
3300004479|Ga0062595_101425934All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria633Open in IMG/M
3300005172|Ga0066683_10202890All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1225Open in IMG/M
3300005435|Ga0070714_101255928All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria723Open in IMG/M
3300005518|Ga0070699_100491215All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1115Open in IMG/M
3300005558|Ga0066698_11014752All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria527Open in IMG/M
3300005561|Ga0066699_10502079All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria867Open in IMG/M
3300005574|Ga0066694_10609527All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria509Open in IMG/M
3300005575|Ga0066702_10083032All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1797Open in IMG/M
3300005576|Ga0066708_10183531All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1304Open in IMG/M
3300005587|Ga0066654_10157908All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1156Open in IMG/M
3300005598|Ga0066706_10119655All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1942Open in IMG/M
3300005618|Ga0068864_100197809All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1845Open in IMG/M
3300006031|Ga0066651_10619054All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria577Open in IMG/M
3300006034|Ga0066656_10385932All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria906Open in IMG/M
3300006046|Ga0066652_100654071All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria997Open in IMG/M
3300006046|Ga0066652_100978453All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria804Open in IMG/M
3300006046|Ga0066652_101969517All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria522Open in IMG/M
3300006796|Ga0066665_11300337All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria558Open in IMG/M
3300006796|Ga0066665_11480791All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria529Open in IMG/M
3300009012|Ga0066710_104542856All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria519Open in IMG/M
3300009137|Ga0066709_101672700All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria905Open in IMG/M
3300009137|Ga0066709_102500642All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria696Open in IMG/M
3300010044|Ga0126310_11637087All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria532Open in IMG/M
3300010325|Ga0134064_10157353All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium790Open in IMG/M
3300010325|Ga0134064_10479250All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria512Open in IMG/M
3300010335|Ga0134063_10116705All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1220Open in IMG/M
3300010335|Ga0134063_10415945All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium662Open in IMG/M
3300010335|Ga0134063_10453461All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria636Open in IMG/M
3300010336|Ga0134071_10615577All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria569Open in IMG/M
3300010373|Ga0134128_10362439All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1619Open in IMG/M
3300010375|Ga0105239_10443901All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1471Open in IMG/M
3300010399|Ga0134127_12722354All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria574Open in IMG/M
3300012011|Ga0120152_1175165All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium552Open in IMG/M
3300012198|Ga0137364_11318664All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria537Open in IMG/M
3300012201|Ga0137365_10318602All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1151Open in IMG/M
3300012208|Ga0137376_10628970All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria928Open in IMG/M
3300012212|Ga0150985_106274046All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria562Open in IMG/M
3300012356|Ga0137371_10145809All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1855Open in IMG/M
3300012356|Ga0137371_10163806All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1744Open in IMG/M
3300012356|Ga0137371_10449300All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria997Open in IMG/M
3300012356|Ga0137371_10638331All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria816Open in IMG/M
3300012356|Ga0137371_11006098All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria632Open in IMG/M
3300012359|Ga0137385_10594352All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria931Open in IMG/M
3300012359|Ga0137385_10667409All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria870Open in IMG/M
3300012532|Ga0137373_10302206All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1272Open in IMG/M
3300012892|Ga0157294_10025924All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1187Open in IMG/M
3300012895|Ga0157309_10072161All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria903Open in IMG/M
3300012896|Ga0157303_10003674All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria2078Open in IMG/M
3300012907|Ga0157283_10007571All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1719Open in IMG/M
3300012907|Ga0157283_10251268All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria587Open in IMG/M
3300012914|Ga0157297_10516634All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria506Open in IMG/M
3300012977|Ga0134087_10201970All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria890Open in IMG/M
3300013296|Ga0157374_10987384All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria861Open in IMG/M
3300014166|Ga0134079_10039898All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1613Open in IMG/M
3300014166|Ga0134079_10666801All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria526Open in IMG/M
3300014487|Ga0182000_10451233All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria585Open in IMG/M
3300015200|Ga0173480_10029359All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria2356Open in IMG/M
3300015242|Ga0137412_10881389All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria650Open in IMG/M
3300015262|Ga0182007_10102237All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria950Open in IMG/M
3300015356|Ga0134073_10378180All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria528Open in IMG/M
3300015357|Ga0134072_10431031All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria527Open in IMG/M
3300015358|Ga0134089_10404001All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria584Open in IMG/M
3300017659|Ga0134083_10348392All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria637Open in IMG/M
3300018433|Ga0066667_10278223All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1287Open in IMG/M
3300018468|Ga0066662_11492644All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria703Open in IMG/M
3300019255|Ga0184643_1268984All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1195Open in IMG/M
3300019868|Ga0193720_1038681All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria680Open in IMG/M
3300019869|Ga0193705_1066407All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria720Open in IMG/M
3300020170|Ga0179594_10416310All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria510Open in IMG/M
3300022195|Ga0222625_1481679All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria529Open in IMG/M
3300025906|Ga0207699_10717748All Organisms → cellular organisms → Bacteria732Open in IMG/M
3300025918|Ga0207662_11191781All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium541Open in IMG/M
3300025949|Ga0207667_10535556All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1185Open in IMG/M
3300026310|Ga0209239_1240729All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria626Open in IMG/M
3300026324|Ga0209470_1373975All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria509Open in IMG/M
3300026342|Ga0209057_1186776All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium594Open in IMG/M
3300026530|Ga0209807_1208314All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria679Open in IMG/M
3300026547|Ga0209156_10079496All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1664Open in IMG/M
3300026552|Ga0209577_10698735All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria574Open in IMG/M
3300027717|Ga0209998_10027460All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1247Open in IMG/M
3300028381|Ga0268264_12113512All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria571Open in IMG/M
3300028710|Ga0307322_10157846All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria606Open in IMG/M
3300028717|Ga0307298_10015345All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1950Open in IMG/M
3300028720|Ga0307317_10153131All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria774Open in IMG/M
3300028755|Ga0307316_10162019All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria799Open in IMG/M
3300028771|Ga0307320_10161424All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria869Open in IMG/M
3300028784|Ga0307282_10129059All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1188Open in IMG/M
3300028799|Ga0307284_10195313All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria794Open in IMG/M
3300028811|Ga0307292_10279163All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria697Open in IMG/M
3300028814|Ga0307302_10591547All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria551Open in IMG/M
3300028878|Ga0307278_10112363All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1224Open in IMG/M
3300028884|Ga0307308_10438826All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria626Open in IMG/M
3300028885|Ga0307304_10558187All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria528Open in IMG/M
3300030989|Ga0308196_1026184All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria711Open in IMG/M
3300030993|Ga0308190_1020743All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1077Open in IMG/M
3300031114|Ga0308187_10339805All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria576Open in IMG/M
3300031938|Ga0308175_102094788All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria634Open in IMG/M
3300032159|Ga0268251_10506803All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria541Open in IMG/M



 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil23.53%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Soil20.59%
Vadose Zone SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil12.75%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil12.75%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil5.88%
Groundwater SedimentEnvironmental → Aquatic → Freshwater → Sediment → Unclassified → Groundwater Sediment1.96%
Terrestrial SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil1.96%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil1.96%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere1.96%
Switchgrass RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere1.96%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil0.98%
Serpentine SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Serpentine Soil0.98%
PermafrostEnvironmental → Terrestrial → Soil → Unclassified → Permafrost → Permafrost0.98%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural → Soil0.98%
Switchgrass RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere0.98%
Agricultural SoilEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Agricultural Soil0.98%
Environmental → Unclassified → Unclassified → Unclassified → Unclassified → 0.98%
Avena Fatua RhizosphereHost-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Avena Fatua Rhizosphere0.98%
Corn RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere0.98%
Arabidopsis Thaliana RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Thaliana Rhizosphere0.98%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere0.98%
RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere0.98%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere0.98%
AgaveHost-Associated → Plants → Phylloplane → Unclassified → Unclassified → Agave0.98%
Switchgrass, Maize And Mischanthus LitterEngineered → Solid Waste → Grass → Composting → Unclassified → Switchgrass, Maize And Mischanthus Litter0.98%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
2124908016Sample 642EnvironmentalOpen in IMG/M
2170459016Litter degradation ZMR2EngineeredOpen in IMG/M
3300000956Soil microbial communities from Great Prairies - Kansas, Native Prairie soilEnvironmentalOpen in IMG/M
3300004114Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of AARS Block 5EnvironmentalOpen in IMG/M
3300004479Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of All WPAsEnvironmentalOpen in IMG/M
3300005172Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_132EnvironmentalOpen in IMG/M
3300005435Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaGEnvironmentalOpen in IMG/M
3300005518Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaGEnvironmentalOpen in IMG/M
3300005558Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_147EnvironmentalOpen in IMG/M
3300005561Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_148EnvironmentalOpen in IMG/M
3300005574Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_143EnvironmentalOpen in IMG/M
3300005575Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_151EnvironmentalOpen in IMG/M
3300005576Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_157EnvironmentalOpen in IMG/M
3300005587Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_103EnvironmentalOpen in IMG/M
3300005598Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_155EnvironmentalOpen in IMG/M
3300005618Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2Host-AssociatedOpen in IMG/M
3300006031Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Angelo_100EnvironmentalOpen in IMG/M
3300006034Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_105EnvironmentalOpen in IMG/M
3300006046Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_101EnvironmentalOpen in IMG/M
3300006796Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_114EnvironmentalOpen in IMG/M
3300009012Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_159EnvironmentalOpen in IMG/M
3300009137Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_158EnvironmentalOpen in IMG/M
3300010044Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot60EnvironmentalOpen in IMG/M
3300010325Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_20cm_2_0_1 metaGEnvironmentalOpen in IMG/M
3300010335Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_5_09082015EnvironmentalOpen in IMG/M
3300010336Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_5_09082015EnvironmentalOpen in IMG/M
3300010373Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-4EnvironmentalOpen in IMG/M
3300010375Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaGHost-AssociatedOpen in IMG/M
3300010399Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-3EnvironmentalOpen in IMG/M
3300012011Permafrost microbial communities from Nunavut, Canada - A30_65cm_6MEnvironmentalOpen in IMG/M
3300012198Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_20_16 metaGEnvironmentalOpen in IMG/M
3300012201Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_40_16 metaGEnvironmentalOpen in IMG/M
3300012208Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_20_16 metaGEnvironmentalOpen in IMG/M
3300012212Combined assembly of Hopland grassland soilHost-AssociatedOpen in IMG/M
3300012356Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_40_16 metaGEnvironmentalOpen in IMG/M
3300012359Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_80_16 metaGEnvironmentalOpen in IMG/M
3300012532Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_80_16 metaGEnvironmentalOpen in IMG/M
3300012892Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S209-509C-1EnvironmentalOpen in IMG/M
3300012895Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S208-509C-2EnvironmentalOpen in IMG/M
3300012896Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S118-311C-2EnvironmentalOpen in IMG/M
3300012907Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S044-104R-1EnvironmentalOpen in IMG/M
3300012914Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S028-104C-2EnvironmentalOpen in IMG/M
3300012977Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Glu_20cm_5_24_1 metaGEnvironmentalOpen in IMG/M
3300013296Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaGHost-AssociatedOpen in IMG/M
3300014166Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_2_09182015EnvironmentalOpen in IMG/M
3300014487Bulk soil microbial communities from Mexico - Magueyal (Ma) metaGEnvironmentalOpen in IMG/M
3300015200Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S209-509C-1 (version 2)EnvironmentalOpen in IMG/M
3300015242Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_16fungal (Hybrid Assembly)EnvironmentalOpen in IMG/M
3300015262Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaGHost-AssociatedOpen in IMG/M
3300015356Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_20cm_5_24_1 metaGEnvironmentalOpen in IMG/M
3300015357Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_20cm_5_0_1 metaGEnvironmentalOpen in IMG/M
3300015358Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Glu_40cm_5_24_1 metaGEnvironmentalOpen in IMG/M
3300017659Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Met_40cm_5_24_1 metaGEnvironmentalOpen in IMG/M
3300018433Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_116EnvironmentalOpen in IMG/M
3300018468Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_111EnvironmentalOpen in IMG/M
3300019255Metatranscriptome of groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_60 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300019868Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U2s1EnvironmentalOpen in IMG/M
3300019869Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U3m2EnvironmentalOpen in IMG/M
3300020170Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad1_1_08_16fungal (Illumina Assembly)EnvironmentalOpen in IMG/M
3300022195Metatranscriptome of groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM2_5 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300025906Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025918Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025949Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026310Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 10_02_2013_2_20cm (SPAdes)EnvironmentalOpen in IMG/M
3300026324Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_125 (SPAdes)EnvironmentalOpen in IMG/M
3300026342Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_146 (SPAdes)EnvironmentalOpen in IMG/M
3300026530Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_154 (SPAdes)EnvironmentalOpen in IMG/M
3300026547Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_124 (SPAdes)EnvironmentalOpen in IMG/M
3300026552Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_109 (SPAdes)EnvironmentalOpen in IMG/M
3300027717Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes)Host-AssociatedOpen in IMG/M
3300028381Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300028710Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_380EnvironmentalOpen in IMG/M
3300028717Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_158EnvironmentalOpen in IMG/M
3300028720Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_357EnvironmentalOpen in IMG/M
3300028755Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_356EnvironmentalOpen in IMG/M
3300028771Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_369EnvironmentalOpen in IMG/M
3300028784Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_121EnvironmentalOpen in IMG/M
3300028799Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_123EnvironmentalOpen in IMG/M
3300028811Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_149EnvironmentalOpen in IMG/M
3300028814Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_183EnvironmentalOpen in IMG/M
3300028878Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_117EnvironmentalOpen in IMG/M
3300028884Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_195EnvironmentalOpen in IMG/M
3300028885Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_185EnvironmentalOpen in IMG/M
3300030989Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_197 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300030993Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_185 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300031114Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_182 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300031938Soil microbial communities from UC Gill Tract Community Farm, Albany, California, United States - DLSLS.C.R1EnvironmentalOpen in IMG/M
3300032159Agave microbial communities from Guanajuato, Mexico - As.Ma.e (v2)Host-AssociatedOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap



 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
OU_019782102124908016KTELSLTSAAAGIKALYQDMLNRAWSDAQARGEKLPDPAQKAAPPEVPGQQ
2ZMR_022861002170459016Switchgrass, Maize And Mischanthus LitterDGKTQLSLQSAAAGIKALYDDMLNRAWSDANSRGETLPPAAQKAVPPTVPGQQ
JGI10216J12902_12135680733300000956SoilLTDAAAGIKTIYEDLLNRAWADARERGDKLPDEAQMAIPPTVPGQQ*
Ga0062593_10121447913300004114SoilLSLQDAANGIKALYDDMLNRAWSDSKARGEKLPPESQKAIPPTVPGQQ*
Ga0062595_10142593413300004479SoilMKLNDGKTELSLQSAAAGIRALYEDMLNRAWSEARARGEKLPDGMQRAIPPTVPGQQ*
Ga0066683_1020289053300005172SoilIRALYEDMLNRAWSDARSRGEKLPDGAQKAIPPTVPGQQ*
Ga0070714_10125592833300005435Agricultural SoilQIAAAGIKAIYEDMLNRAWNDAAARGEKLPAASQKALPPTVPGQQ*
Ga0070699_10049121543300005518Corn, Switchgrass And Miscanthus RhizospherePLSLQDAANGIKALYEDMLSRAWSDAKERGEKLPPERQKAIPPTVPGQQ*
Ga0066698_1101475213300005558SoilALYEDMLNRAWSDARSRGEKLPDGAQKAIPPTVPGQQ*
Ga0066699_1050207913300005561SoilHLKLNNTAHTPLTLQDAATGIKALYTDMLNRAWADAKARGEKMPPEAQKNVPPTVPGQQ*
Ga0066694_1060952713300005574SoilELSLQSAAAGIRALYEDMLNRAWSDARSRGEKLPDGAQKAIPPTVPGQQ*
Ga0066702_1008303263300005575SoilDAANGIKAIYDDLLDRAWNEARARGEKLPPESQKALPPTVPGQQ*
Ga0066708_1018353153300005576SoilGDAMRLNDGKTQLSIQVAAAGIRALYEDMLNRAWSEARARGEKLPDVAQKDILPTVPGQQ
Ga0066654_1015790813300005587SoilQDAANGIKALYQDMLNRAWSDAQARGEKLPSTAQKAVPPTVPGQQ*
Ga0066706_1011965513300005598SoilQDAANGIKALYQDMLNRAWSDAKARGEKLPPESQKAIAPTVPGQQ*
Ga0068864_10019780963300005618Switchgrass RhizosphereNDGKTQLSLISAAAGIKALYDDMLNRAWSEARARGEKLPNPAQRLVPPEVPGQQ*
Ga0066651_1061905413300006031SoilDAANGIKALYDDMLNRAWSEAKARGEKMPSESQKAIAPTVPGQQ*
Ga0066656_1038593213300006034SoilLQAAAAGIKSIYEDMLNRAWSDAKARGEKMPPAAQKDVPPTVPGQQ*
Ga0066652_10065407113300006046SoilYEDMLNRAWSDARARGEKLPGGTQKAIPPTVPGQQ*
Ga0066652_10097845313300006046SoilLNNQAHTPLSLQSAANGIKAIYEDMLNRAWSDAKARGEKLPSTAQKAIPPTVPGQQ*
Ga0066652_10196951713300006046SoilLSIQTAAAGIKALYQDMLDRAWADAQARGEKLPPAAQKDVPPRVPGE*
Ga0066665_1130033733300006796SoilSAAAGIRALYEDMLNRAWSDARARGEKLPDVVQKDMPPTVPGQQ*
Ga0066665_1148079113300006796SoilLSIQSAAAGIKALYMDMLNRAWADARARGEKLPPESNKTVPPTVPGQQ*
Ga0066710_10454285633300009012Grasslands SoilGIKALYDDMLNRAWDEARKRGENLPSSSQKAIQPAVPGQQ
Ga0066709_10167270043300009137Grasslands SoilINDGKTRLSIKDAAAGIRGLYLDMLNRAWVDARQRGEKLPPLSQKSILPTVPGQQ*
Ga0066709_10250064213300009137Grasslands SoilSFLINDGKTRLSIKDAAAGIRAIYVDMLDRAWAEARDRGENLPCEAQRNILATVPGQQ*
Ga0126310_1163708713300010044Serpentine SoilNDGKTELSLRTAAAGIKSLYEDMLDRAWQDARDRGEKLPPEAQRAIPPEVPGQQ*
Ga0134064_1015735333300010325Grasslands SoilKTRLSIKDAAAGIRAIYLDMLDRAWAEARNRGENLPSEAQRNILPTVPGIQ*
Ga0134064_1047925013300010325Grasslands SoilGADSMMLNDGTTELSLKSAAAGIRALYEDMLNRAWAEAKARGEKLPHPMQKDIPPTVPGQQ*
Ga0134063_1011670513300010335Grasslands SoilQSAAAGIRALYEDMLNRAWSDARSRGEKLPDGAQKAIPPTVPGQQ*
Ga0134063_1041594513300010335Grasslands SoilMLNDRKTPLSLQDAAAGIRALYEQMLNQAWEDARARGENLPPASQKDIPPTVPGEQ*
Ga0134063_1045346113300010335Grasslands SoilTQLSIQVAAAGIRALYEDMLNRAWSEARARGEKLPDVAQKDILPTVPGQQ*
Ga0134071_1061557733300010336Grasslands SoilSIKDAAAGIRALYLDMLNRAWADAQDRGEKLPPLSQRSILPTVPGQQ*
Ga0134128_1036243963300010373Terrestrial SoilSLQDAANGIKAIYDDMLNRAWSDAKARGEKLPTESQKAIPPTVPGQQ*
Ga0105239_1044390163300010375Corn RhizosphereANGIKALYDDMLNRAWSDSKARGEKLPPESQKAIPPTVPGQQ*
Ga0134127_1272235413300010399Terrestrial SoilHTPLSLQEAANGIKALYDDMLNRAWSDSKARGEKLPPESQKAIPPTVPGQQ*
Ga0120152_117516523300012011PermafrostVLNNKTNTPLSLDEAAAGIKSLYQDMLDRAWTEAKARGEKLPPEAQKNILPKVPGQQ*
Ga0137364_1131866433300012198Vadose Zone SoilQDAANGIKALYDDMLNRAWTEAKARGEKMPSESQRAIAPTVPGQQ*
Ga0137365_1031860243300012201Vadose Zone SoilTETLSLPAAAAAIKAIYTDLLNRAWADAKARGEKLPPESQKAIPPEVPGQQ*
Ga0137376_1062897043300012208Vadose Zone SoilLSLQDAAAGIKAIYDDLLNRAWDEARARGNKLPPESQKAIPPTVPGQQ*
Ga0150985_10627404633300012212Avena Fatua RhizosphereNDGKTPLSLQDAANGIKALYEDMLNRAWSDAKSRGEKLPSEAQRAIPPTVPGQQ*
Ga0137371_1014580913300012356Vadose Zone SoilAAGIKALYDDMLTRAWDEARQRGENLPPSSQKAIQPAVPGQQ*
Ga0137371_1016380613300012356Vadose Zone SoilPLSLRDAANGIRALYEDMLSRAWSDAKGRGEKLPSETQKAIPPTVPGQQ*
Ga0137371_1044930043300012356Vadose Zone SoilYEDMLNRAWSDARARGEKLPDPMQKDIPPTVPGQQ*
Ga0137371_1063833133300012356Vadose Zone SoilPLSLRDAANGIRALYEDMLSRAWSDAKGRGEKLPPASQKLIPPEVPGQQ*
Ga0137371_1100609813300012356Vadose Zone SoilRLSIKDAAAGIRALYLDMLNRAWTEAQARGEKLPPLSQKTILPTVPGQQ*
Ga0137385_1059435243300012359Vadose Zone SoilALYEDMLNRAWSDARARGEKLPDPMQKDIPPTVPGQQ*
Ga0137385_1066740913300012359Vadose Zone SoilIKALYDDMLNRAWSDSKARGEKLPPESQKAIPPEVPGQQ*
Ga0137373_1030220653300012532Vadose Zone SoilALYEDMLNRAWSEAGARGEKLPLVSQKDIPPTVPGQQ*
Ga0157294_1002592413300012892SoilDGKTELSLITAAAGIKALYQDMLDRAWRDAVLRGEKVPNLAQKAIPPEVPGQQ*
Ga0157309_1007216113300012895SoilINDGKTNLSLKDAAAGIKTIYNDLLNRAWADAKDRDGKLPSEAQKAIPPTVPGQQ*
Ga0157303_1000367413300012896SoilKTELSLITAAAGIKALYQDMLDRAWRDAVLRGEKVPNLAQKAIPPEVPGQQ*
Ga0157283_1000757163300012907SoilAAGIKAIYEDMLNRAWSDARARGEKLPAAAQKAIPPEVPGQQ*
Ga0157283_1025126833300012907SoilDGKTNLSLKDAAAGIKTIYNDLLNRAWADAKDRDGKLPSEAQKAIPPTVPGQQ*
Ga0157297_1051663413300012914SoilAAAAAAGIKAIYEDMLNRAWSDARARGEKLPAAAQKAIPPEVPGQQ*
Ga0134087_1020197043300012977Grasslands SoilAGIRALYEDMLNRAWSEARARGEKLPDVAQKDILPTVPGQQ*
Ga0157374_1098738443300013296Miscanthus RhizosphereQDAANGIKELYDDMLNRAWSDSKARGEKLPPESQKAIPPTVPGQQ*
Ga0134079_1003989813300014166Grasslands SoilQDAANGIKALYDDMLNRAWSEAKARGEKLPPESQKAIPPTVPGQQ*
Ga0134079_1066680113300014166Grasslands SoilGKTRLSIKDAAAGIRAIYLDMLDRAWAEARDRGENLPSEAQRNILPTVPGQQ*
Ga0182000_1045123333300014487SoilLSLQDAANGIRALYQQMLDRAWADAKRRGDTLPPESQKAIPPHVEGQQ*
Ga0173480_1002935913300015200SoilMKLNDGKTELSLITAAAGIKALYQDMLDRAWRDAVLRGEKVPNLAQKAIPPEVPGQQ*
Ga0137412_1088138913300015242Vadose Zone SoilDGKTPLSLQDAANGIKALYEDMLNRAWTEAKARGEKLPSETQKAIPPTVPGQQ*
Ga0182007_1010223743300015262RhizosphereNNSDHTALSLKDAAAGIKALYTDMLNRAWADAKARGEKLPPDAQKSVPPTVPGQQ*
Ga0134073_1037818013300015356Grasslands SoilALYEDMLNRAWSDAKGRGEKLPPESQKAIAPTVPGQQ*
Ga0134072_1043103113300015357Grasslands SoilIKALYEDMLNRAWSDAKGRGEKLPPESQKAIAPTVPGQQ*
Ga0134089_1040400113300015358Grasslands SoilRLSIKDAAAGIRAIYLDMLDRAWAEARDRGENLPSEAQRNILPTVPGQQ*
Ga0134083_1034839233300017659Grasslands SoilMMLNDGKTRLSILSAAAGIKAIYEDMLNRAWADARARGEKLPPESNKTVPPTVPGQQ
Ga0066667_1027822353300018433Grasslands SoilQSAAAGIKAVFEDMLNRAWSDARARGEKLPPEVMKEIPPTVPGQQ
Ga0066662_1149264433300018468Grasslands SoilSLQDAANGIKALYEDMLDRAWRDAKTRGEKLPSVAQRAIPPQVPGQQ
Ga0184643_126898443300019255Groundwater SedimentLSLPDAAAGIKAIYDDLLNKAWDEARARGNKLPPESQKAIPPTVPGQQ
Ga0193720_103868133300019868SoilLLNDGKTPLSLQDAAHGIKALYEDMLNRAWSDAKGRGEKLPSEAQKIIPPTVPGQQ
Ga0193705_106640733300019869SoilSLRDAADGIKTIYNDLLNRAWDEARGRGNKLPSESQKAIPPTVPGQQ
Ga0179594_1041631013300020170Vadose Zone SoilSLQDAPNGIKALYEDMLNRAWSDAKSRGEKLPSEAQRAIPPTVPGQQ
Ga0222625_148167913300022195Groundwater SedimentIKALYDDMLSRAWSDAKARDEKLPSESQKAIPPTVPGQQ
Ga0207699_1071774823300025906Corn, Switchgrass And Miscanthus RhizosphereVAAGLSLADAAAGIKSIYEDLLNRAWSDAAARGEKLPAASQKALPP
Ga0207662_1119178113300025918Switchgrass RhizosphereDAANGIKALYDDMLNRAWSDSKARGEKLPPESQKAIPPTVPGQQ
Ga0207667_1053555653300025949Corn RhizosphereAANGIKALYDDMLNRAWSDSKARGEKLPPESQKAIPPTVPGQQ
Ga0209239_124072933300026310Grasslands SoilKDHLLLNDGKTPLSLQDAANGIKALYEDMLNRAWTEARARGEKLPSETQKAIPPTVPGQQ
Ga0209470_137397513300026324SoilDHLLLNDGKTPLSLQDAANGIKALYEDMLNRAWSDAKSRGEELPSEAQRAIPPTVPGQQ
Ga0209057_118677633300026342SoilLNDTARTPLSLQDAAAGIKALYTDMLNRAWADAKARGEKMPPDAQKDVPPTVPGQQ
Ga0209807_120831433300026530SoilSAAAGIRALYEDMLNRAWSEARARGETLPPTVQKDIPPTVPGQQ
Ga0209156_1007949613300026547SoilYEDMLNRAWSDAKGRGEKLPPESQKAIAPTVPGQQ
Ga0209577_1069873533300026552SoilAAAGIKAIYEDMLNRAWNDARARGEKLPPASQKAIPPTVPGQE
Ga0209998_1002746053300027717Arabidopsis Thaliana RhizosphereNDGKTELSLITAAAGIKALYQDMLDRAWRDAVLRGEKVPNLAQKAIPPEVPGQQ
Ga0268264_1211351233300028381Switchgrass RhizosphereNGIKALYDDMLNRAWSDSKARGEKLPPESQKAIPPTVPGQQ
Ga0307322_1015784613300028710SoilELSLTSAAAGIKALYEDMLDRAWRDAVNRGEKLPNLAQKAIPPGVPGQQ
Ga0307298_1001534513300028717SoilIKALYEDMLNRAWSDAKGRGEKLPSEAQKIIPPTVPGQQ
Ga0307317_1015313133300028720SoilLNNQAHTPLSLQDAANGIKALYDDMLNRAWSDAKARGEKLPPESQKAIPPTVPGQQ
Ga0307316_1016201933300028755SoilLNNQAHTPLSLQDAANGIKALYDDMLSRAWSDAKARDEKLPSESQKAIPPTVPGQQ
Ga0307320_1016142433300028771SoilADNFLLNDGKTPLSLQDAAAGIKAIYNDLLNRAWDEARARGNKLPSESQKAIPPTVPGQQ
Ga0307282_1012905913300028784SoilSLQTAAAGIKSMYEDMLNRAWQDAQARGEKLPLEVQRAIPPEVPGQQ
Ga0307284_1019531333300028799SoilKDHLLLNDGKTPLSLQDAANGIKALYEDMLSRAWSDAKGRGEKLPSETQKAIPPTVPGQQ
Ga0307292_1027916313300028811SoilALYEDMLSRAWSDAKGRGEKLPSETQKAIPPTVPGQQ
Ga0307302_1059154733300028814SoilSLEDAAAGIKTIYTRLLDQAWSDAAARGEKLPPESQKAIPPTVPGQQ
Ga0307278_1011236353300028878SoilKTELSLQTAAAGIKSIYDDMLNRAWQDAQARGEKLPIEAQKAIPPEVPGQQ
Ga0307308_1043882613300028884SoilLSLQDAENGIKALYEDMLNRAWSDAKGRGEKLPSEAQKAIPPTVPGQQ
Ga0307304_1055818733300028885SoilSLQDAAAEIKKIYEQLLDQSWADARARGEKLPSESQKAIPPTVPGQQ
Ga0308196_102618433300030989SoilLNDGKTPLSLQDAANGIKALYEDMLNRAWSDAKGRGEKLPSEAQKIIPPTVPGQQ
Ga0308190_102074313300030993SoilIKTIYNDLLNRAWDEARGRGNKLPSESQKAIPPTVPGQQ
Ga0308187_1033980513300031114SoilTPLSLQDAANGIKALYDDMLSRAWSDAKARDEKLPSESQKAIPPTVPGQQ
Ga0308175_10209478833300031938SoilLNDGKTELSLQSAANGIKAIYQDMLDRAWADARARGEKLPTEAQKEILPTVPGQQ
Ga0268251_1050680323300032159AgaveNDGKTVLSLQTAAAGIKAIYEDMLNRAWQDARDRGEKLPAEAQKAIPPVVPGQQ


 ⦗Top⦘


© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.