| Basic Information | |
|---|---|
| Family ID | F100760 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 102 |
| Average Sequence Length | 45 residues |
| Representative Sequence | MNTPCIEQSEAELVVIKGFEGEEIEVSVEQLETRIVPESTAGFLD |
| Number of Associated Samples | 71 |
| Number of Associated Scaffolds | 102 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 81.37 % |
| % of genes near scaffold ends (potentially truncated) | 31.37 % |
| % of genes from short scaffolds (< 2000 bps) | 83.33 % |
| Associated GOLD sequencing projects | 66 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.28 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (59.804 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil (19.608 % of family members) |
| Environment Ontology (ENVO) | Unclassified (39.216 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (62.745 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 0.00% β-sheet: 0.00% Coil/Unstructured: 100.00% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.28 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 102 Family Scaffolds |
|---|---|---|
| PF02518 | HATPase_c | 18.63 |
| PF08447 | PAS_3 | 13.73 |
| PF13519 | VWA_2 | 5.88 |
| PF00092 | VWA | 3.92 |
| PF00072 | Response_reg | 2.94 |
| PF12770 | CHAT | 2.94 |
| PF07730 | HisKA_3 | 1.96 |
| PF12705 | PDDEXK_1 | 1.96 |
| PF13147 | Obsolete Pfam Family | 0.98 |
| PF04337 | DUF480 | 0.98 |
| PF13474 | SnoaL_3 | 0.98 |
| PF00593 | TonB_dep_Rec | 0.98 |
| PF08264 | Anticodon_1 | 0.98 |
| PF07690 | MFS_1 | 0.98 |
| PF13620 | CarboxypepD_reg | 0.98 |
| PF00190 | Cupin_1 | 0.98 |
| PF00756 | Esterase | 0.98 |
| PF08811 | DUF1800 | 0.98 |
| COG ID | Name | Functional Category | % Frequency in 102 Family Scaffolds |
|---|---|---|---|
| COG3850 | Signal transduction histidine kinase NarQ, nitrate/nitrite-specific | Signal transduction mechanisms [T] | 1.96 |
| COG3851 | Signal transduction histidine kinase UhpB, glucose-6-phosphate specific | Signal transduction mechanisms [T] | 1.96 |
| COG4564 | Signal transduction histidine kinase | Signal transduction mechanisms [T] | 1.96 |
| COG4585 | Signal transduction histidine kinase ComP | Signal transduction mechanisms [T] | 1.96 |
| COG3132 | Uncharacterized conserved protein YceH, UPF0502 family | Function unknown [S] | 0.98 |
| COG5267 | Uncharacterized conserved protein, DUF1800 family | Function unknown [S] | 0.98 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 59.80 % |
| Unclassified | root | N/A | 40.20 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300000550|F24TB_14792949 | Not Available | 578 | Open in IMG/M |
| 3300003267|soilL1_10028637 | All Organisms → cellular organisms → Bacteria | 6369 | Open in IMG/M |
| 3300003319|soilL2_10171271 | All Organisms → cellular organisms → Bacteria | 1575 | Open in IMG/M |
| 3300003321|soilH1_10114214 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1203 | Open in IMG/M |
| 3300004114|Ga0062593_103230852 | Not Available | 522 | Open in IMG/M |
| 3300004463|Ga0063356_100544516 | All Organisms → cellular organisms → Bacteria | 1550 | Open in IMG/M |
| 3300004463|Ga0063356_103570791 | Not Available | 670 | Open in IMG/M |
| 3300004633|Ga0066395_10026005 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 2388 | Open in IMG/M |
| 3300004633|Ga0066395_10728648 | Not Available | 590 | Open in IMG/M |
| 3300005166|Ga0066674_10009293 | All Organisms → cellular organisms → Bacteria | 4015 | Open in IMG/M |
| 3300005332|Ga0066388_100358002 | All Organisms → cellular organisms → Bacteria | 2106 | Open in IMG/M |
| 3300005332|Ga0066388_101218383 | Not Available | 1289 | Open in IMG/M |
| 3300005332|Ga0066388_101438466 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1201 | Open in IMG/M |
| 3300005332|Ga0066388_102368362 | Not Available | 962 | Open in IMG/M |
| 3300005347|Ga0070668_101278639 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 666 | Open in IMG/M |
| 3300005354|Ga0070675_100975314 | Not Available | 778 | Open in IMG/M |
| 3300005441|Ga0070700_101019714 | Not Available | 681 | Open in IMG/M |
| 3300005445|Ga0070708_100075158 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 3049 | Open in IMG/M |
| 3300005446|Ga0066686_10176964 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1421 | Open in IMG/M |
| 3300005558|Ga0066698_10891854 | Not Available | 570 | Open in IMG/M |
| 3300005598|Ga0066706_10145686 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1776 | Open in IMG/M |
| 3300005713|Ga0066905_100077849 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 2165 | Open in IMG/M |
| 3300005713|Ga0066905_100359566 | Not Available | 1166 | Open in IMG/M |
| 3300005713|Ga0066905_102116972 | Not Available | 523 | Open in IMG/M |
| 3300005764|Ga0066903_100681244 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1807 | Open in IMG/M |
| 3300005764|Ga0066903_101803741 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1169 | Open in IMG/M |
| 3300005764|Ga0066903_102334551 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1034 | Open in IMG/M |
| 3300005764|Ga0066903_104690758 | Not Available | 728 | Open in IMG/M |
| 3300005764|Ga0066903_106703759 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 599 | Open in IMG/M |
| 3300005764|Ga0066903_107593904 | Not Available | 559 | Open in IMG/M |
| 3300005764|Ga0066903_107986401 | Not Available | 543 | Open in IMG/M |
| 3300005764|Ga0066903_109136865 | Not Available | 501 | Open in IMG/M |
| 3300005840|Ga0068870_10301884 | All Organisms → cellular organisms → Bacteria | 1011 | Open in IMG/M |
| 3300005841|Ga0068863_101733074 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 634 | Open in IMG/M |
| 3300006797|Ga0066659_10903386 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 737 | Open in IMG/M |
| 3300006845|Ga0075421_100044526 | All Organisms → cellular organisms → Bacteria | 5620 | Open in IMG/M |
| 3300006845|Ga0075421_100852708 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1044 | Open in IMG/M |
| 3300006854|Ga0075425_100068576 | All Organisms → cellular organisms → Bacteria | 3991 | Open in IMG/M |
| 3300006854|Ga0075425_102262952 | Not Available | 605 | Open in IMG/M |
| 3300006854|Ga0075425_102494066 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 573 | Open in IMG/M |
| 3300006871|Ga0075434_100360996 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1474 | Open in IMG/M |
| 3300006954|Ga0079219_10684324 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 775 | Open in IMG/M |
| 3300007004|Ga0079218_10646554 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 978 | Open in IMG/M |
| 3300007076|Ga0075435_100781750 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 831 | Open in IMG/M |
| 3300009012|Ga0066710_101076603 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1243 | Open in IMG/M |
| 3300009012|Ga0066710_101632404 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 986 | Open in IMG/M |
| 3300009162|Ga0075423_10408795 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1425 | Open in IMG/M |
| 3300009162|Ga0075423_12432729 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 571 | Open in IMG/M |
| 3300009597|Ga0105259_1042174 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1003 | Open in IMG/M |
| 3300009814|Ga0105082_1085995 | Not Available | 576 | Open in IMG/M |
| 3300010043|Ga0126380_11798943 | Not Available | 554 | Open in IMG/M |
| 3300010046|Ga0126384_10490048 | Not Available | 1057 | Open in IMG/M |
| 3300010047|Ga0126382_11813665 | Not Available | 574 | Open in IMG/M |
| 3300010048|Ga0126373_11356774 | Not Available | 777 | Open in IMG/M |
| 3300010301|Ga0134070_10050149 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1407 | Open in IMG/M |
| 3300010304|Ga0134088_10337291 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 731 | Open in IMG/M |
| 3300010358|Ga0126370_11260127 | Not Available | 691 | Open in IMG/M |
| 3300010360|Ga0126372_10674150 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1005 | Open in IMG/M |
| 3300010360|Ga0126372_12541742 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 563 | Open in IMG/M |
| 3300010361|Ga0126378_11147595 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 876 | Open in IMG/M |
| 3300010362|Ga0126377_11367911 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 780 | Open in IMG/M |
| 3300010366|Ga0126379_11678237 | Not Available | 740 | Open in IMG/M |
| 3300010366|Ga0126379_12615963 | All Organisms → cellular organisms → Bacteria | 602 | Open in IMG/M |
| 3300010376|Ga0126381_102296282 | Not Available | 775 | Open in IMG/M |
| 3300010398|Ga0126383_12612690 | Not Available | 588 | Open in IMG/M |
| 3300010400|Ga0134122_13005663 | Not Available | 526 | Open in IMG/M |
| 3300011403|Ga0137313_1010135 | All Organisms → cellular organisms → Bacteria | 1522 | Open in IMG/M |
| 3300011409|Ga0137323_1013266 | All Organisms → cellular organisms → Bacteria | 1882 | Open in IMG/M |
| 3300012206|Ga0137380_10425356 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1177 | Open in IMG/M |
| 3300012401|Ga0134055_1394508 | Not Available | 631 | Open in IMG/M |
| 3300012948|Ga0126375_11082569 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 659 | Open in IMG/M |
| 3300012948|Ga0126375_11196841 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 632 | Open in IMG/M |
| 3300012948|Ga0126375_11310718 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 609 | Open in IMG/M |
| 3300012971|Ga0126369_11270822 | Not Available | 826 | Open in IMG/M |
| 3300012971|Ga0126369_11367402 | Not Available | 798 | Open in IMG/M |
| 3300012971|Ga0126369_13500966 | Not Available | 514 | Open in IMG/M |
| 3300012972|Ga0134077_10583507 | Not Available | 504 | Open in IMG/M |
| 3300012976|Ga0134076_10022728 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 2232 | Open in IMG/M |
| 3300014150|Ga0134081_10410513 | Not Available | 510 | Open in IMG/M |
| 3300015371|Ga0132258_10127265 | Not Available | 6066 | Open in IMG/M |
| 3300015371|Ga0132258_10329168 | All Organisms → cellular organisms → Bacteria | 3770 | Open in IMG/M |
| 3300015371|Ga0132258_10644633 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 2663 | Open in IMG/M |
| 3300015371|Ga0132258_10679868 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 2590 | Open in IMG/M |
| 3300015371|Ga0132258_13743584 | All Organisms → cellular organisms → Bacteria | 1037 | Open in IMG/M |
| 3300015374|Ga0132255_102742987 | Not Available | 753 | Open in IMG/M |
| 3300015374|Ga0132255_103836699 | Not Available | 639 | Open in IMG/M |
| 3300016341|Ga0182035_10783084 | Not Available | 836 | Open in IMG/M |
| 3300017656|Ga0134112_10084428 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1182 | Open in IMG/M |
| 3300018431|Ga0066655_10021913 | All Organisms → cellular organisms → Bacteria | 2988 | Open in IMG/M |
| 3300019249|Ga0184648_1032718 | Not Available | 663 | Open in IMG/M |
| 3300021560|Ga0126371_11137482 | Not Available | 919 | Open in IMG/M |
| 3300025908|Ga0207643_10916871 | Not Available | 568 | Open in IMG/M |
| 3300025922|Ga0207646_10010685 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 8938 | Open in IMG/M |
| 3300025926|Ga0207659_10398696 | Not Available | 1150 | Open in IMG/M |
| 3300025930|Ga0207701_11480185 | Not Available | 551 | Open in IMG/M |
| 3300027874|Ga0209465_10176197 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1065 | Open in IMG/M |
| 3300027909|Ga0209382_10046326 | All Organisms → cellular organisms → Bacteria | 5193 | Open in IMG/M |
| 3300027909|Ga0209382_10115856 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 3128 | Open in IMG/M |
| 3300031719|Ga0306917_10708841 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 791 | Open in IMG/M |
| 3300031820|Ga0307473_10394356 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 905 | Open in IMG/M |
| 3300032076|Ga0306924_10847907 | All Organisms → cellular organisms → Bacteria | 1015 | Open in IMG/M |
| 3300032180|Ga0307471_100996631 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1005 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 19.61% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 17.65% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 10.78% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 6.86% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 6.86% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 4.90% |
| Soil | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Soil | 2.94% |
| Sugarcane Root And Bulk Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Sugarcane Root And Bulk Soil | 2.94% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 2.94% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 2.94% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 2.94% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 1.96% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 1.96% |
| Arabidopsis Thaliana Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Thaliana Rhizosphere | 1.96% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 1.96% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere | 1.96% |
| Groundwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Groundwater Sediment | 0.98% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 0.98% |
| Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 0.98% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 0.98% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Corn, Switchgrass And Miscanthus Rhizosphere | 0.98% |
| Soil | Environmental → Terrestrial → Soil → Loam → Grasslands → Soil | 0.98% |
| Groundwater Sand | Environmental → Terrestrial → Soil → Sand → Unclassified → Groundwater Sand | 0.98% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 0.98% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 0.98% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300000550 | Amended soil microbial communities from Kansas Great Prairies, USA - BrdU amended with acetate total DNA F2.4 TB clc assemly | Environmental | Open in IMG/M |
| 3300003267 | Sugarcane bulk soil Sample L1 | Environmental | Open in IMG/M |
| 3300003319 | Sugarcane bulk soil Sample L2 | Environmental | Open in IMG/M |
| 3300003321 | Sugarcane bulk soil Sample H1 | Environmental | Open in IMG/M |
| 3300004114 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of AARS Block 5 | Environmental | Open in IMG/M |
| 3300004463 | Combined assembly of Arabidopsis thaliana microbial communities | Host-Associated | Open in IMG/M |
| 3300004633 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 1 MoBio | Environmental | Open in IMG/M |
| 3300005166 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_123 | Environmental | Open in IMG/M |
| 3300005332 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Host-Associated | Open in IMG/M |
| 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Host-Associated | Open in IMG/M |
| 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Environmental | Open in IMG/M |
| 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Environmental | Open in IMG/M |
| 3300005446 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_135 | Environmental | Open in IMG/M |
| 3300005558 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_147 | Environmental | Open in IMG/M |
| 3300005598 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_155 | Environmental | Open in IMG/M |
| 3300005713 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 36 (version 2) | Environmental | Open in IMG/M |
| 3300005764 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2) | Environmental | Open in IMG/M |
| 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Host-Associated | Open in IMG/M |
| 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Host-Associated | Open in IMG/M |
| 3300006797 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_108 | Environmental | Open in IMG/M |
| 3300006845 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD5 | Host-Associated | Open in IMG/M |
| 3300006854 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD4 | Host-Associated | Open in IMG/M |
| 3300006871 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Host-Associated | Open in IMG/M |
| 3300006954 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Control | Environmental | Open in IMG/M |
| 3300007004 | Agricultural soil microbial communities from Utah to study Nitrogen management - NC Compost | Environmental | Open in IMG/M |
| 3300007076 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Host-Associated | Open in IMG/M |
| 3300009012 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_159 | Environmental | Open in IMG/M |
| 3300009162 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD2 | Host-Associated | Open in IMG/M |
| 3300009597 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMZT299 | Environmental | Open in IMG/M |
| 3300009814 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW S2_50_60 | Environmental | Open in IMG/M |
| 3300010043 | Tropical forest soil microbial communities from Panama - MetaG Plot_26 | Environmental | Open in IMG/M |
| 3300010046 | Tropical forest soil microbial communities from Panama - MetaG Plot_36 | Environmental | Open in IMG/M |
| 3300010047 | Tropical forest soil microbial communities from Panama - MetaG Plot_30 | Environmental | Open in IMG/M |
| 3300010048 | Tropical forest soil microbial communities from Panama - MetaG Plot_11 | Environmental | Open in IMG/M |
| 3300010301 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_2_09082015 | Environmental | Open in IMG/M |
| 3300010304 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_5_09182015 | Environmental | Open in IMG/M |
| 3300010358 | Tropical forest soil microbial communities from Panama - MetaG Plot_3 | Environmental | Open in IMG/M |
| 3300010360 | Tropical forest soil microbial communities from Panama - MetaG Plot_6 | Environmental | Open in IMG/M |
| 3300010361 | Tropical forest soil microbial communities from Panama - MetaG Plot_23 | Environmental | Open in IMG/M |
| 3300010362 | Tropical forest soil microbial communities from Panama - MetaG Plot_22 | Environmental | Open in IMG/M |
| 3300010366 | Tropical forest soil microbial communities from Panama - MetaG Plot_24 | Environmental | Open in IMG/M |
| 3300010376 | Tropical forest soil microbial communities from Panama - MetaG Plot_28 | Environmental | Open in IMG/M |
| 3300010398 | Tropical forest soil microbial communities from Panama - MetaG Plot_35 | Environmental | Open in IMG/M |
| 3300010400 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-2 | Environmental | Open in IMG/M |
| 3300011403 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMZT166_2 | Environmental | Open in IMG/M |
| 3300011409 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMZT423_2 | Environmental | Open in IMG/M |
| 3300012206 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_100_16 metaG | Environmental | Open in IMG/M |
| 3300012401 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Glu_40cm_5_16_1 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300012948 | Tropical forest soil microbial communities from Panama - MetaG Plot_14 | Environmental | Open in IMG/M |
| 3300012971 | Tropical forest soil microbial communities from Panama - MetaG Plot_1 | Environmental | Open in IMG/M |
| 3300012972 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_40cm_5_24_1 metaG | Environmental | Open in IMG/M |
| 3300012976 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_40cm_5_0_1 metaG | Environmental | Open in IMG/M |
| 3300014150 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Met_20cm_5_24_1 metaG | Environmental | Open in IMG/M |
| 3300015371 | Combined assembly of cpr5 and col0 rhizosphere and soil | Host-Associated | Open in IMG/M |
| 3300015374 | Col-0 rhizosphere combined assembly | Host-Associated | Open in IMG/M |
| 3300016341 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 | Environmental | Open in IMG/M |
| 3300017656 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_5_11112015 | Environmental | Open in IMG/M |
| 3300018431 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_104 | Environmental | Open in IMG/M |
| 3300019249 | Metatranscriptome of groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM4_32 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300021560 | Tropical forest soil microbial communities from Panama - MetaG Plot_4 | Environmental | Open in IMG/M |
| 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025930 | Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) | Environmental | Open in IMG/M |
| 3300027874 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 1 MoBio (SPAdes) | Environmental | Open in IMG/M |
| 3300027909 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD5 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300031719 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.000 (v2) | Environmental | Open in IMG/M |
| 3300031820 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_515 | Environmental | Open in IMG/M |
| 3300032076 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111 (v2) | Environmental | Open in IMG/M |
| 3300032180 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| F24TB_147929491 | 3300000550 | Soil | TQSVERSETELVVVKGFEGEDIEVTIEQLETKILPQSTAGFLD* |
| soilL1_100286375 | 3300003267 | Sugarcane Root And Bulk Soil | MNTPCNETPKAEVVVIKGFENEEIEVSIEQLESRIVPESTAGFLD* |
| soilL2_101712712 | 3300003319 | Sugarcane Root And Bulk Soil | MSTPRNEPSKTETVVVKGFESEDIEVTVEQLETRTMPESTAGFLD* |
| soilH1_101142141 | 3300003321 | Sugarcane Root And Bulk Soil | TERTNTMRKPYVESSKAEPIVIKGFEGEDIEITIEQLEDRIAPDQSTAGFLD* |
| Ga0062593_1032308521 | 3300004114 | Soil | MNTPRNQPSKTETVVIKGFESEDIEVTVEQLETRTMPESTAGFLD* |
| Ga0063356_1005445162 | 3300004463 | Arabidopsis Thaliana Rhizosphere | MSALIIEQTKNDTVVIKGFENEEITVSVEQLETRLVPESLAGFLD* |
| Ga0063356_1035707911 | 3300004463 | Arabidopsis Thaliana Rhizosphere | MTRPCIEAINVEQVVIKGFEDDDLEITVEQLEMRIVPESTAGFLE* |
| Ga0066395_100260053 | 3300004633 | Tropical Forest Soil | MKTQSVERSETELVVVKGFEGEEIEITIEQLETKILPQSTAGFLD* |
| Ga0066395_107286481 | 3300004633 | Tropical Forest Soil | MNTPCTDQSKAELLVIKGFEGEDIEVSVEQLEMKIMPESLAGFLD* |
| Ga0066674_100092933 | 3300005166 | Soil | MNTQDIEPSKTELVVIKGFEGEHIEVSVEQLEMRIMPESTAGFLD* |
| Ga0066388_1003580022 | 3300005332 | Tropical Forest Soil | MNTPCIEPSDAELVVIKGFEGEDIEVTVEQLEVRIIPESLAGFLD* |
| Ga0066388_1012183831 | 3300005332 | Tropical Forest Soil | MNTPCIEKTNAEDVVIKGFEGEDIEVSVEELEPRIVPQSSAGFLD* |
| Ga0066388_1014384661 | 3300005332 | Tropical Forest Soil | MNTPCIEPSEAELVVIKGFEGEDIEVSVEELEVRIVPESLAGFLD* |
| Ga0066388_1023683622 | 3300005332 | Tropical Forest Soil | MMKTQSVKPLETELVVIKGFEGEDIEVTVEQLETRILPQSTAGFLD* |
| Ga0070668_1012786391 | 3300005347 | Switchgrass Rhizosphere | MSAPCIESAKAEVLVIKGFEGESIEIVEQLETRLVPESLAGFLD* |
| Ga0070675_1009753142 | 3300005354 | Miscanthus Rhizosphere | MSALIIEQTKNDTVVIKGFENEEINVSVEQLETRLVPESLAGFLD* |
| Ga0070700_1010197142 | 3300005441 | Corn, Switchgrass And Miscanthus Rhizosphere | MNTPCIEPSERELVVIKGFADEDIEIKVEQLETRIMPSSLAGFLD* |
| Ga0070708_1000751582 | 3300005445 | Corn, Switchgrass And Miscanthus Rhizosphere | MNTPCIEQSQAELIVIKGFEGEDIEVSVEQLETRLMPESTAGFLE* |
| Ga0066686_101769642 | 3300005446 | Soil | MDTPYIELSKTELVVIKGFEGEDIELNVEQLELRIMPESTAGFLE* |
| Ga0066698_108918541 | 3300005558 | Soil | MNKQDIEPSKTELVVIKGFEGEDIEVSVEQLETRIMPESTAGFLE* |
| Ga0066706_101456861 | 3300005598 | Soil | KTELVVIKGFEGEHIEVSVEQLEMRIMPESTAGFLD* |
| Ga0066905_1000778491 | 3300005713 | Tropical Forest Soil | MMKTQSVERSETELVVVKGFEGEEIEITIEQLETKILPQSTAGFLD* |
| Ga0066905_1003595662 | 3300005713 | Tropical Forest Soil | MMKTQSVEPLETELVVIKGFEGEDIEVTVEQLETRILPQSTAGFLD* |
| Ga0066905_1021169721 | 3300005713 | Tropical Forest Soil | MKTQSVEPLETELVVIKGFEGEDIEVTVEQLETRILPQ |
| Ga0066903_1006812442 | 3300005764 | Tropical Forest Soil | MNTPCIEESKSKLAVIKGFEGEDIEVSVEQLEPRIMPESTAGFLD* |
| Ga0066903_1018037411 | 3300005764 | Tropical Forest Soil | MKTQSVELSETELAVIKGFEGEDIEVTFEQLETRILPQSTAGFLD* |
| Ga0066903_1023345512 | 3300005764 | Tropical Forest Soil | MMKTKSVERSETELVVVKGFEGEDIEVTIEQLETKILPQSTAGFLD* |
| Ga0066903_1046907582 | 3300005764 | Tropical Forest Soil | MMKTQSVNPLETELVVIKGFEGEDIEVTVEQLETRILPQSTAGFLD* |
| Ga0066903_1067037591 | 3300005764 | Tropical Forest Soil | MNRPSLELSEPELVVIKGFEGEDVDTSVEQLEMRIMPESLAGFLD* |
| Ga0066903_1075939042 | 3300005764 | Tropical Forest Soil | MNTPCTEQAESELVVIKGFHGEDIEVSVEQLETRIMPESSAGFLD* |
| Ga0066903_1079864011 | 3300005764 | Tropical Forest Soil | MNTPSIEKSKAEHIAIKGFEGEDIEISIEQLEPRITPESTAGFLD* |
| Ga0066903_1091368651 | 3300005764 | Tropical Forest Soil | TKSMNTPCIEKTKAEDVVTKGFEGEDIEVNVEELEPRIVPQSTAGFLD* |
| Ga0068870_103018842 | 3300005840 | Miscanthus Rhizosphere | MNTPCIEPSESELVVIKGFADEDIEIKVEQLETRIMPSSLAGFLD* |
| Ga0068863_1017330741 | 3300005841 | Switchgrass Rhizosphere | KAPHVESTQPELVVIKGFKGEEIEVTIEQLEDRIAPDQSTAGFLD* |
| Ga0066659_109033862 | 3300006797 | Soil | MNTPCIEQSQAELSVIKGFEGEDIEVSVEQLETRLMPESTAGFLE* |
| Ga0075421_1000445262 | 3300006845 | Populus Rhizosphere | MMKTQSVERSVTELVVVKGFEGEDIEVTIEQLETKILPQSTAGFLD* |
| Ga0075421_1008527082 | 3300006845 | Populus Rhizosphere | MMKTQSVERSETELVVVKGFEGEDIEITIEQLETKILPQSTAGFLD* |
| Ga0075425_1000685762 | 3300006854 | Populus Rhizosphere | MNTPCAEQSKAELVVIKGFEGENIEVSVELLETRIMPESTAGFLE* |
| Ga0075425_1022629522 | 3300006854 | Populus Rhizosphere | MKTKSVERSETERVVVKGFEGEDIEVTIEQLETKI |
| Ga0075425_1024940661 | 3300006854 | Populus Rhizosphere | MNTPCIEPSEAELVVIKGFEGEDIEVSVEQLEVRIMPESLAGFLD* |
| Ga0075434_1003609961 | 3300006871 | Populus Rhizosphere | MKTQCVERSVTELVVVKGFEGEDIEITIEQLETKI |
| Ga0079219_106843242 | 3300006954 | Agricultural Soil | QRSDSMNTPCIEESKAEVVVFKGFEGEDIEVSFEQLEPRIVPQSTAGFLD* |
| Ga0079218_106465541 | 3300007004 | Agricultural Soil | MKTCIDPPKTELVVVKGFESEDIEVSVEQLEMRIVPESTAGFLD* |
| Ga0075435_1007817502 | 3300007076 | Populus Rhizosphere | MMKTQSVERSETELVVVKGFEGEDIEVTIEQLETKILPQSTAGFLD |
| Ga0066710_1010766032 | 3300009012 | Grasslands Soil | ISKKGSTAMNTPCIEQSQAELSVIKGFEGEDIEVSVEQLETRLMPESTAGFLE |
| Ga0066710_1016324042 | 3300009012 | Grasslands Soil | MDTPYIELSKTELVVIKGFEGEDIELNVEQLELRIMPESTAGFLE |
| Ga0075423_104087951 | 3300009162 | Populus Rhizosphere | MNTPCIEPSEAELVVIKGFEGEDIEVSVEELEVRIVPESLAGFLD |
| Ga0075423_124327291 | 3300009162 | Populus Rhizosphere | MNRPSLELSELELVVIKGFEGEDIDASVEQLEMRIMPESLAGF |
| Ga0105259_10421741 | 3300009597 | Soil | RHEQQPTEGSTTMSTCIEPSKTELVVIKGFESEDIEVTVEQLEMRIVPESTAGFLD* |
| Ga0105082_10859951 | 3300009814 | Groundwater Sand | MSTSSIDLSKAEVVAIKGFEGDDLEISVEQLETRIVPQSTAGFLD* |
| Ga0126380_117989432 | 3300010043 | Tropical Forest Soil | MNTPCIKESKSELVVVKGFEGEDIEVSVEQLEPRIMPESSAGFLD* |
| Ga0126384_104900482 | 3300010046 | Tropical Forest Soil | MNTSSIEQSKPELVVIKGFEGEDIEVSVEQLETRITPGATAGFLD* |
| Ga0126382_118136652 | 3300010047 | Tropical Forest Soil | MNTPCIEPLEAELVVIKGFEGEDIEVGVEQLEVRTMPESLAGFLD* |
| Ga0126373_113567742 | 3300010048 | Tropical Forest Soil | MNTPCIEQSESGLVVIKGFDGVDIEVSVEQLETRIVPESTAGFLD* |
| Ga0134070_100501491 | 3300010301 | Grasslands Soil | SKTELVVIKGFEGEHIEVSVEQLEMRIMPESTAGFLD* |
| Ga0134088_103372912 | 3300010304 | Grasslands Soil | MNTPCAEQSKAELVVIKGFEGENIEVSVELLETRIMSESTAGFLE* |
| Ga0126370_112601271 | 3300010358 | Tropical Forest Soil | MNTPCIEKTKAEDVVTKGFEGEDIEVSVEELEPRIVPQSTAGFLD* |
| Ga0126372_106741501 | 3300010360 | Tropical Forest Soil | MMKAKCVERSETELVVVKGFEGEEIEITIEQLETKILPQSTAGFLD* |
| Ga0126372_125417422 | 3300010360 | Tropical Forest Soil | MNTPCIEPSNAELVVIKGFEGEDIEVTVEQLEVRIIPES |
| Ga0126378_111475951 | 3300010361 | Tropical Forest Soil | MMKTQSVERSETELVVVKGFEGEDIEITIEQLETKILPQSTAGF |
| Ga0126377_113679112 | 3300010362 | Tropical Forest Soil | MNTPCIEPSEAELVVIKGFEGEDIEVGVEQLEVRIMPESLAGF |
| Ga0126379_116782372 | 3300010366 | Tropical Forest Soil | MKTRSVEPSETELVVIKGFEGEDIEVTVEQLETRILPQSTAGFLD* |
| Ga0126379_126159632 | 3300010366 | Tropical Forest Soil | MSTPCIEKSKVEEVVFEGFEGENIEVTFETLEPRIVPQSTAGFLD* |
| Ga0126381_1022962821 | 3300010376 | Tropical Forest Soil | TERTKMMKTKSVERSETELVVVKGFEGEDIEVTIEQLETKILPQSTAGFLD* |
| Ga0126383_126126901 | 3300010398 | Tropical Forest Soil | MKPACIEPSKTDLVVIKGFENEVIEVTVEQLENRIMPDQSTAGFLE* |
| Ga0134122_130056631 | 3300010400 | Terrestrial Soil | SNAVNTSSIELLESESVVIKGFENEIIDVGVEQLETRIVPESLAGFLE* |
| Ga0137313_10101352 | 3300011403 | Soil | MSTCIEPSKTELVVIKGFESEDIEVTVEQLEMRIVPESTAGFLD* |
| Ga0137323_10132662 | 3300011409 | Soil | MSICIEPSKTELVVIKGFENEDIEVTVEQLEMRIVPESTAGFLD* |
| Ga0137380_104253562 | 3300012206 | Vadose Zone Soil | ANWPSAQFLLLRERTETMDTPYIELSKTELVVIKGFEGEDIELNVEQLELRIMPESTAGFLE* |
| Ga0134055_13945081 | 3300012401 | Grasslands Soil | MNTQDIEPSKTELVVIKGFEGEHIEVSVEQLETRIMPESTAGFLE* |
| Ga0126375_110825691 | 3300012948 | Tropical Forest Soil | MNTPCIEPSNAELVVIKGFEGEDIEVTVEQLEVRIIPESLAGFLD* |
| Ga0126375_111968411 | 3300012948 | Tropical Forest Soil | MNTPCIEPLEAELVVIKGFEGEDIEVSVEQLEVRIMPESLAGFLD* |
| Ga0126375_113107182 | 3300012948 | Tropical Forest Soil | MNTPCIEQTKAEVVVIKGFEGENIELSIEQLETRLMPESTAGFL |
| Ga0126369_112708221 | 3300012971 | Tropical Forest Soil | NSSEERTNKMNESCIEESKSELVVIKGFDCEDIEVSVEQLESRIMPESTAGFLD* |
| Ga0126369_113674021 | 3300012971 | Tropical Forest Soil | MKTQSVELSETELVVIKGFEAEDIEVTVEQLETRILPQSTAGFLD* |
| Ga0126369_135009662 | 3300012971 | Tropical Forest Soil | MEQTKTELVVFKGFEGEDVEVTFEQLEPRIVPQSTAGFLE* |
| Ga0134077_105835072 | 3300012972 | Grasslands Soil | MNKQDIEPSKTELVVIKGFEGEDIEVSVEQLEMRIMPESTAGF |
| Ga0134076_100227282 | 3300012976 | Grasslands Soil | MNTQDIEPSKTELVVIKGFEGEDIEVSVEQLETRIMPESTAGFLE* |
| Ga0134081_104105132 | 3300014150 | Grasslands Soil | RERTETMNTQDIEPSKTELVVIKGFEGEHIEVSVEQLEMRIMPESTAGFLD* |
| Ga0132258_101272654 | 3300015371 | Arabidopsis Rhizosphere | MSTPFVEASKTELLVIRGFEGEEIEVAVEQLENRIVPQSSAGFLD* |
| Ga0132258_103291683 | 3300015371 | Arabidopsis Rhizosphere | MNTPSIELLEKESIAIKGFENEVLEVSVEQLETRIVPESLAGFLE* |
| Ga0132258_106446333 | 3300015371 | Arabidopsis Rhizosphere | MMKTKSVERSETERVVVKGFEGEDIEITIEQLETKILPQSTAGFLD* |
| Ga0132258_106798683 | 3300015371 | Arabidopsis Rhizosphere | METPSIESSKTELVVVKGFDGEDIEITFEQLETRIVPQSSAGFLD* |
| Ga0132258_137435842 | 3300015371 | Arabidopsis Rhizosphere | MSTPSIELSNAELVVTTGFEGEDLDVTVEQLEMRNMPESLAGFLD* |
| Ga0132255_1027429871 | 3300015374 | Arabidopsis Rhizosphere | EKESIAIKGFENEVLEVSVEQLETRIVPESLAGFLE* |
| Ga0132255_1038366991 | 3300015374 | Arabidopsis Rhizosphere | ERVVVKGFEGEDIEVTIEQLETKILPQSTAGFLD* |
| Ga0182035_107830842 | 3300016341 | Soil | LPAALLIKRKDKTMNTPCTEQSKAELFVLKGFEGEDITVSVEELEPRIVPESTAGFLD |
| Ga0134112_100844281 | 3300017656 | Grasslands Soil | MNKQDIEPSKTELVVIKGFEGEDIEVSVEQLETRIMPESTAGFLE |
| Ga0066655_100219133 | 3300018431 | Grasslands Soil | MNTQDIEPSKTELVVIKGFEGEHIEVSVEQLEMRIMPESTAGFLD |
| Ga0184648_10327181 | 3300019249 | Groundwater Sediment | RKEPTMSTPYSDSTKAGTIVIKGFESEDIEVTVEQLEARIVPESSAGFLD |
| Ga0126371_111374822 | 3300021560 | Tropical Forest Soil | MNTPCIEESKSKLVVIKGFEGEDIEVSVEQLEPRIMPESSAGFLD |
| Ga0207643_109168712 | 3300025908 | Miscanthus Rhizosphere | MNTPCIEPSESELVVIKGFADEDIEIKVEQLETRIMPSSLAGFLD |
| Ga0207646_100106855 | 3300025922 | Corn, Switchgrass And Miscanthus Rhizosphere | MNTPCIEQSQAELIVIKGFEGEDIEVSVEQLETRLMPESTAGFLE |
| Ga0207659_103986962 | 3300025926 | Miscanthus Rhizosphere | MSALIIEQTKNDTVVIKGFENEEINVSVEQLETRLVPESLAGFLD |
| Ga0207701_114801851 | 3300025930 | Corn, Switchgrass And Miscanthus Rhizosphere | MSALIIEQTKNDTVVIKGFENEEITVSVEQLETRIVPESLAGFLD |
| Ga0209465_101761972 | 3300027874 | Tropical Forest Soil | MKTQSVERSETELVVVKGFEGEEIEITIEQLETKILPQSTAGFLD |
| Ga0209382_100463263 | 3300027909 | Populus Rhizosphere | MMKTQSVERSVTELVVVKGFEGEDIEVTIEQLETKILPQSTAGFLD |
| Ga0209382_101158563 | 3300027909 | Populus Rhizosphere | MMKTQSVERSETELVVVKGFEGEDIEITIEQLETKILPQSTAGFLD |
| Ga0306917_107088412 | 3300031719 | Soil | MNTPCIEQSEAELVVIKGFEGEEIEVSVEQLETRIVPESTAGFLD |
| Ga0307473_103943562 | 3300031820 | Hardwood Forest Soil | MNTPCIEQSQAELSVIKGFEGEDIEVSVEQLETRLMPESTAGFLE |
| Ga0306924_108479071 | 3300032076 | Soil | MNTPCIEQSEAELVVIKGFEGEEIEVSVEQLETRIV |
| Ga0307471_1009966312 | 3300032180 | Hardwood Forest Soil | MDTLYSEPSKTELVVIKGFEGEDIELSVEQLEMRIMPESTAGFLD |
| ⦗Top⦘ |