Basic Information | |
---|---|
Family ID | F100693 |
Family Type | Metagenome / Metatranscriptome |
Number of Sequences | 102 |
Average Sequence Length | 42 residues |
Representative Sequence | YKRGTLHAGINPKGPKKAPLAKSRKQAIAIALSEAGKSKKK |
Number of Associated Samples | 90 |
Number of Associated Scaffolds | 102 |
Quality Assessment | |
---|---|
Transcriptomic Evidence | Yes |
Most common taxonomic group | Unclassified |
% of genes with valid RBS motifs | 3.92 % |
% of genes near scaffold ends (potentially truncated) | 87.25 % |
% of genes from short scaffolds (< 2000 bps) | 84.31 % |
Associated GOLD sequencing projects | 86 |
AlphaFold2 3D model prediction | Yes |
3D model pTM-score | 0.37 |
Hidden Markov Model |
---|
Powered by Skylign |
Most Common Taxonomy | |
---|---|
Group | Unclassified (45.098 % of family members) |
NCBI Taxonomy ID | N/A |
Taxonomy | N/A |
Most Common Ecosystem | |
---|---|
GOLD Ecosystem | Environmental → Aquatic → Marine → Coastal → Unclassified → Aqueous (13.725 % of family members) |
Environment Ontology (ENVO) | Unclassified (37.255 % of family members) |
Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Water (non-saline) (42.157 % of family members) |
⦗Top⦘ |
⦗Top⦘ |
Predicted Topology & Secondary Structure | |||||
---|---|---|---|---|---|
Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 24.64% β-sheet: 0.00% Coil/Unstructured: 75.36% | Feature Viewer |
|
|||||
Powered by Feature Viewer |
Structure Viewer | |
---|---|
| |
Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.37 |
Powered by PDBe Molstar |
⦗Top⦘ |
Pfam ID | Name | % Frequency in 102 Family Scaffolds |
---|---|---|
PF13578 | Methyltransf_24 | 3.92 |
PF00961 | LAGLIDADG_1 | 2.94 |
PF11753 | DUF3310 | 1.96 |
PF01541 | GIY-YIG | 0.98 |
PF10544 | T5orf172 | 0.98 |
PF01551 | Peptidase_M23 | 0.98 |
PF01391 | Collagen | 0.98 |
PF04545 | Sigma70_r4 | 0.98 |
PF02945 | Endonuclease_7 | 0.98 |
PF04404 | ERF | 0.98 |
PF00383 | dCMP_cyt_deam_1 | 0.98 |
PF00685 | Sulfotransfer_1 | 0.98 |
PF01464 | SLT | 0.98 |
⦗Top⦘ |
Name | Rank | Taxonomy | Distribution |
All Organisms | root | All Organisms | 54.90 % |
Unclassified | root | N/A | 45.10 % |
Visualization |
---|
Powered by ApexCharts |
Scaffold | Taxonomy | Length | IMG/M Link |
---|---|---|---|
3300000882|FwDRAFT_10011967 | All Organisms → Viruses | 4065 | Open in IMG/M |
3300001335|ML8_10026776 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 2857 | Open in IMG/M |
3300002202|metazooDRAFT_1275704 | All Organisms → Viruses → Predicted Viral | 1330 | Open in IMG/M |
3300002835|B570J40625_100841119 | Not Available | 801 | Open in IMG/M |
3300005517|Ga0070374_10048237 | All Organisms → Viruses → Predicted Viral | 2215 | Open in IMG/M |
3300006030|Ga0075470_10080548 | Not Available | 983 | Open in IMG/M |
3300006802|Ga0070749_10501046 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 661 | Open in IMG/M |
3300006802|Ga0070749_10553725 | Not Available | 623 | Open in IMG/M |
3300006805|Ga0075464_11041075 | Not Available | 514 | Open in IMG/M |
3300007177|Ga0102978_1003117 | All Organisms → Viruses → Predicted Viral | 2018 | Open in IMG/M |
3300007234|Ga0075460_10140221 | Not Available | 847 | Open in IMG/M |
3300007363|Ga0075458_10190032 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 631 | Open in IMG/M |
3300007540|Ga0099847_1097744 | All Organisms → cellular organisms → Bacteria | 895 | Open in IMG/M |
3300007542|Ga0099846_1138958 | Not Available | 879 | Open in IMG/M |
3300007544|Ga0102861_1055909 | All Organisms → Viruses → Predicted Viral | 1028 | Open in IMG/M |
3300007973|Ga0105746_1283986 | Not Available | 573 | Open in IMG/M |
3300007992|Ga0105748_10155653 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 938 | Open in IMG/M |
3300008055|Ga0108970_10123237 | All Organisms → Viruses → Predicted Viral | 1777 | Open in IMG/M |
3300008107|Ga0114340_1190370 | Not Available | 703 | Open in IMG/M |
3300008117|Ga0114351_1033349 | All Organisms → cellular organisms → Bacteria | 5021 | Open in IMG/M |
3300008259|Ga0114841_1088767 | All Organisms → Viruses → Predicted Viral | 1377 | Open in IMG/M |
3300008266|Ga0114363_1090654 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1118 | Open in IMG/M |
3300008448|Ga0114876_1149277 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 855 | Open in IMG/M |
3300009165|Ga0105102_10804312 | All Organisms → Viruses | 535 | Open in IMG/M |
3300009168|Ga0105104_10173896 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1168 | Open in IMG/M |
3300009168|Ga0105104_10622272 | Not Available | 616 | Open in IMG/M |
3300009169|Ga0105097_10187531 | All Organisms → Viruses → Predicted Viral | 1138 | Open in IMG/M |
3300009180|Ga0114979_10491722 | Not Available | 710 | Open in IMG/M |
3300010316|Ga0136655_1101710 | Not Available | 868 | Open in IMG/M |
3300010334|Ga0136644_10489339 | Not Available | 687 | Open in IMG/M |
3300010354|Ga0129333_10751866 | Not Available | 835 | Open in IMG/M |
3300010370|Ga0129336_10268125 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → unclassified Flavobacteriaceae → Flavobacteriaceae bacterium | 956 | Open in IMG/M |
3300010388|Ga0136551_1000043 | Not Available | 33651 | Open in IMG/M |
3300010885|Ga0133913_12888968 | All Organisms → Viruses → Predicted Viral | 1152 | Open in IMG/M |
3300010966|Ga0137675_1022355 | Not Available | 531 | Open in IMG/M |
3300012779|Ga0138284_1291271 | Not Available | 702 | Open in IMG/M |
3300013005|Ga0164292_10434615 | Not Available | 870 | Open in IMG/M |
3300013010|Ga0129327_10370773 | Not Available | 754 | Open in IMG/M |
3300013295|Ga0170791_13532693 | Not Available | 765 | Open in IMG/M |
3300013372|Ga0177922_10345053 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 2969 | Open in IMG/M |
3300014962|Ga0134315_1021152 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 1009 | Open in IMG/M |
3300017707|Ga0181363_1059740 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 671 | Open in IMG/M |
3300017722|Ga0181347_1186730 | Not Available | 550 | Open in IMG/M |
3300017761|Ga0181356_1241411 | Not Available | 518 | Open in IMG/M |
3300017766|Ga0181343_1139517 | All Organisms → Viruses → environmental samples → uncultured marine virus | 677 | Open in IMG/M |
3300017777|Ga0181357_1021309 | All Organisms → cellular organisms → Bacteria | 2577 | Open in IMG/M |
3300017777|Ga0181357_1276546 | Not Available | 577 | Open in IMG/M |
3300017777|Ga0181357_1282618 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 569 | Open in IMG/M |
3300017785|Ga0181355_1317313 | Not Available | 581 | Open in IMG/M |
3300017785|Ga0181355_1323523 | Not Available | 573 | Open in IMG/M |
3300018080|Ga0180433_11075957 | Not Available | 585 | Open in IMG/M |
3300020161|Ga0211726_10664406 | Not Available | 818 | Open in IMG/M |
3300020161|Ga0211726_10911348 | All Organisms → Viruses → environmental samples → uncultured marine virus | 639 | Open in IMG/M |
3300020205|Ga0211731_10925469 | All Organisms → Viruses → Predicted Viral | 2287 | Open in IMG/M |
3300021332|Ga0210339_1408724 | Not Available | 500 | Open in IMG/M |
3300021963|Ga0222712_10618638 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 623 | Open in IMG/M |
3300022169|Ga0196903_1030045 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 644 | Open in IMG/M |
3300022190|Ga0181354_1185090 | Not Available | 630 | Open in IMG/M |
3300023179|Ga0214923_10008821 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 10631 | Open in IMG/M |
3300024343|Ga0244777_10000325 | Not Available | 38361 | Open in IMG/M |
3300024346|Ga0244775_11250160 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 577 | Open in IMG/M |
3300024354|Ga0255171_1031237 | Not Available | 1038 | Open in IMG/M |
3300025635|Ga0208147_1040944 | All Organisms → Viruses → Predicted Viral | 1201 | Open in IMG/M |
3300025635|Ga0208147_1122297 | Not Available | 620 | Open in IMG/M |
3300025732|Ga0208784_1052901 | All Organisms → Viruses → Predicted Viral | 1249 | Open in IMG/M |
3300025889|Ga0208644_1121373 | All Organisms → Viruses → Predicted Viral | 1247 | Open in IMG/M |
3300025889|Ga0208644_1287560 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 659 | Open in IMG/M |
3300027254|Ga0208177_1068427 | Not Available | 662 | Open in IMG/M |
3300027608|Ga0208974_1175051 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 531 | Open in IMG/M |
3300027710|Ga0209599_10007403 | All Organisms → Viruses → Predicted Viral | 3577 | Open in IMG/M |
3300027721|Ga0209492_1075575 | All Organisms → Viruses → Predicted Viral | 1190 | Open in IMG/M |
3300027759|Ga0209296_1250617 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 728 | Open in IMG/M |
3300027769|Ga0209770_10084166 | All Organisms → Viruses → Predicted Viral | 1322 | Open in IMG/M |
3300027797|Ga0209107_10314665 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 733 | Open in IMG/M |
3300027805|Ga0209229_10503434 | Not Available | 517 | Open in IMG/M |
3300027806|Ga0209985_10182119 | Not Available | 1012 | Open in IMG/M |
3300027808|Ga0209354_10360723 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 570 | Open in IMG/M |
3300027900|Ga0209253_10616162 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 794 | Open in IMG/M |
3300027956|Ga0209820_1161331 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 621 | Open in IMG/M |
3300027973|Ga0209298_10115738 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1157 | Open in IMG/M |
3300028073|Ga0255180_1002725 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 5272 | Open in IMG/M |
3300029349|Ga0238435_106598 | Not Available | 1205 | Open in IMG/M |
3300031669|Ga0307375_10794281 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 535 | Open in IMG/M |
3300031673|Ga0307377_10368613 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1073 | Open in IMG/M |
3300031758|Ga0315907_10054202 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 3517 | Open in IMG/M |
3300031758|Ga0315907_10126100 | All Organisms → Viruses | 2182 | Open in IMG/M |
3300031857|Ga0315909_10364545 | Not Available | 1050 | Open in IMG/M |
3300031951|Ga0315904_10974466 | All Organisms → Viruses | 675 | Open in IMG/M |
3300031963|Ga0315901_10209608 | All Organisms → Viruses → Predicted Viral | 1679 | Open in IMG/M |
3300031963|Ga0315901_10267320 | Not Available | 1436 | Open in IMG/M |
3300031963|Ga0315901_10789062 | Not Available | 690 | Open in IMG/M |
3300031963|Ga0315901_10840512 | Not Available | 660 | Open in IMG/M |
3300031999|Ga0315274_11441557 | Not Available | 659 | Open in IMG/M |
3300032050|Ga0315906_10445884 | Not Available | 1112 | Open in IMG/M |
3300032053|Ga0315284_12039339 | Not Available | 580 | Open in IMG/M |
3300033981|Ga0334982_0501830 | Not Available | 536 | Open in IMG/M |
3300034012|Ga0334986_0121731 | Not Available | 1537 | Open in IMG/M |
3300034018|Ga0334985_0779218 | Not Available | 507 | Open in IMG/M |
3300034061|Ga0334987_0672071 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 598 | Open in IMG/M |
3300034062|Ga0334995_0581376 | Not Available | 655 | Open in IMG/M |
3300034092|Ga0335010_0039631 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 3487 | Open in IMG/M |
3300034117|Ga0335033_0160978 | All Organisms → Viruses → Predicted Viral | 1240 | Open in IMG/M |
⦗Top⦘ |
Habitat | Taxonomy | Distribution |
Freshwater Lake | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lake | 13.73% |
Aqueous | Environmental → Aquatic → Marine → Coastal → Unclassified → Aqueous | 13.73% |
Freshwater | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater | 8.82% |
Freshwater | Environmental → Aquatic → Freshwater → Unclassified → Unclassified → Freshwater | 8.82% |
Freshwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Freshwater Sediment | 5.88% |
Freshwater Lake | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake | 5.88% |
Freshwater | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater | 5.88% |
Freshwater, Plankton | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater, Plankton | 3.92% |
Freshwater To Marine Saline Gradient | Environmental → Aquatic → Marine → Coastal → Unclassified → Freshwater To Marine Saline Gradient | 3.92% |
Estuarine | Environmental → Aquatic → Marine → Intertidal Zone → Estuary → Estuarine | 3.92% |
Freshwater Lake | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake | 1.96% |
Sediment | Environmental → Aquatic → Freshwater → Lake → Sediment → Sediment | 1.96% |
Freshwater | Environmental → Aquatic → Freshwater → River → Unclassified → Freshwater | 1.96% |
Pond Fresh Water | Environmental → Aquatic → Freshwater → Pond → Unclassified → Pond Fresh Water | 1.96% |
Estuary Water | Environmental → Aquatic → Marine → Coastal → Unclassified → Estuary Water | 1.96% |
Soil | Environmental → Terrestrial → Soil → Clay → Unclassified → Soil | 1.96% |
Freshwater | Environmental → Aquatic → Freshwater → Lentic → Epilimnion → Freshwater | 0.98% |
Lake | Environmental → Aquatic → Freshwater → Lentic → Epilimnion → Lake | 0.98% |
Freshwater Lentic | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lentic | 0.98% |
Freshwater And Sediment | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater And Sediment | 0.98% |
Freshwater And Sediment | Environmental → Aquatic → Freshwater → Lentic → Hypolimnion → Freshwater And Sediment | 0.98% |
Freshwater Lake Sediment | Environmental → Aquatic → Freshwater → Lentic → Sediment → Freshwater Lake Sediment | 0.98% |
Freshwater And Marine | Environmental → Aquatic → Freshwater → Lotic → Unclassified → Freshwater And Marine | 0.98% |
Surface Water | Environmental → Aquatic → Freshwater → Groundwater → Unclassified → Surface Water | 0.98% |
Wetlands Benthic | Environmental → Aquatic → Marine → Wetlands → Unclassified → Wetlands Benthic | 0.98% |
Estuarine | Environmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine | 0.98% |
Estuarine Water | Environmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine Water | 0.98% |
Hypersaline Lake Sediment | Environmental → Aquatic → Non-Marine Saline And Alkaline → Hypersaline → Sediment → Hypersaline Lake Sediment | 0.98% |
Deep Subsurface | Environmental → Terrestrial → Deep Subsurface → Unclassified → Unclassified → Deep Subsurface | 0.98% |
Estuary | Host-Associated → Plants → Leaf → Unclassified → Unclassified → Estuary | 0.98% |
Visualization |
---|
Powered by ApexCharts |
Taxon OID | Sample Name | Habitat Type | IMG/M Link |
---|---|---|---|
3300000882 | Freshwater microbial communities from the Columbia River | Environmental | Open in IMG/M |
3300001335 | Wetlands benthic microbial communities from British Columbia, Canada - ML8 | Environmental | Open in IMG/M |
3300002202 | Freshwater microbial communities from San Paulo Zoo lake, Brazil - SEP 2012 | Environmental | Open in IMG/M |
3300002835 | Freshwater microbial communities from Lake Mendota, WI - (Lake Mendota Combined Ray assembly, ASSEMBLY_DATE=20140605) | Environmental | Open in IMG/M |
3300005517 | Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MM15.SN (version 4) | Environmental | Open in IMG/M |
3300006030 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_0.19_D_<0.8_DNA | Environmental | Open in IMG/M |
3300006802 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_18 | Environmental | Open in IMG/M |
3300006805 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_0.19_<0.8_DNA | Environmental | Open in IMG/M |
3300007177 | Combined Assembly of cyanobacterial bloom in Marina Bay water reservoir, Singapore (Diel cycle-Surface and Bottom layers) 16 sequencing projects | Environmental | Open in IMG/M |
3300007234 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Fall_15_<0.8_DNA | Environmental | Open in IMG/M |
3300007363 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Fall_0.3_<0.8_DNA | Environmental | Open in IMG/M |
3300007540 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1504_2 Viral MetaG | Environmental | Open in IMG/M |
3300007542 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1504_1 Viral MetaG | Environmental | Open in IMG/M |
3300007544 | Estuarine microbial communities from the Columbia River estuary - metaG 1449B-3 | Environmental | Open in IMG/M |
3300007973 | Coastal water column microbial communities from Columbia River Estuary, Oregon, USA - CMOP_DNA_1460A_0.2um | Environmental | Open in IMG/M |
3300007992 | Coastal water column microbial communities from Columbia River Estuary, Oregon, USA - CMOP_DNA_1461AB_0.2um | Environmental | Open in IMG/M |
3300008055 | Metatranscriptomes of the Eelgrass leaves and roots. Combined Assembly of Gp0128390, Gp0128391, Gp0128392, and Gp0128393 | Host-Associated | Open in IMG/M |
3300008107 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE2, Sample E2014-0046-3-NA | Environmental | Open in IMG/M |
3300008117 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, Sample E2014-0108-C-NA | Environmental | Open in IMG/M |
3300008259 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, sample HABS-E2014-0132-C-NA | Environmental | Open in IMG/M |
3300008266 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, Sample HABS-E2014-0108-C-NA | Environmental | Open in IMG/M |
3300008448 | Freshwater viral communities during cyanobacterial harmful algal blooms (CHABs) in Western Lake Erie, USA - August 4, 2014 all contigs | Environmental | Open in IMG/M |
3300009165 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (6) Depth 1-3cm September2015 | Environmental | Open in IMG/M |
3300009168 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (6) Depth 19-21cm September2015 | Environmental | Open in IMG/M |
3300009169 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (1) Depth 10-12cm May2015 | Environmental | Open in IMG/M |
3300009180 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140625_EF_MetaG | Environmental | Open in IMG/M |
3300010316 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Spr_15_0.8_DNA | Environmental | Open in IMG/M |
3300010334 | Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_130820_EF_MetaG (v2) | Environmental | Open in IMG/M |
3300010354 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_0.6_0.8_DNA | Environmental | Open in IMG/M |
3300010370 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_0.6_0.2_DNA | Environmental | Open in IMG/M |
3300010388 | Freshwater microbial communities from the surface of the forest pond in Jussy, Geneva, Switzerland - JEBV, may 2015 | Environmental | Open in IMG/M |
3300010885 | northern Canada Lakes Co-assembly | Environmental | Open in IMG/M |
3300010966 | Freshwater microbial communities from the surface of the forest pond in Jussy, Geneva, Switzerland - JEBV1bis, april 2016 | Environmental | Open in IMG/M |
3300012779 | Freshwater microbial communities from Lake Simoncouche, Canada - S_130206_E_mt (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300013005 | Eutrophic lake water microbial communities from Lake Mendota, Wisconsin, USA - GEODES117 metaG | Environmental | Open in IMG/M |
3300013010 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Spr_31_0.8_DNA | Environmental | Open in IMG/M |
3300013295 | northern Canada Lakes metatranscriptome co-assembly | Environmental | Open in IMG/M |
3300013372 | Freshwater microbial communities from Lake Erie, Ontario, Canada. Combined Assembly of 10 SPs | Environmental | Open in IMG/M |
3300014962 | Surface water microbial communities from Bangladesh - BaraHaldiaSW0309 | Environmental | Open in IMG/M |
3300017707 | Freshwater viral communities from Lake Michigan, USA - Fa13.ND.MLB.S.N | Environmental | Open in IMG/M |
3300017722 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM110.S.N | Environmental | Open in IMG/M |
3300017761 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM110.S.N | Environmental | Open in IMG/M |
3300017766 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MLB.S.D | Environmental | Open in IMG/M |
3300017777 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM110.D.N | Environmental | Open in IMG/M |
3300017785 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM15.D.N | Environmental | Open in IMG/M |
3300018080 | Hypersaline lake sediment archaeal communities from the Salton Sea, California, USA - SS_1_D_1 metaG | Environmental | Open in IMG/M |
3300020161 | Freshwater lake microbial communities from Lake Erken, Sweden - P4710_101 megahit1 | Environmental | Open in IMG/M |
3300020205 | Freshwater lake microbial communities from Lake Erken, Sweden - P4710_103 megahit1 | Environmental | Open in IMG/M |
3300021332 | Metatranscriptome of estuarine sediment microbial communities from the Columbia River estuary, Oregon, United States ? S.384 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300021963 | Estuarine water microbial communities from San Francisco Bay, California, United States - C33_657D | Environmental | Open in IMG/M |
3300022169 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1504_2 Viral MetaG (v3) | Environmental | Open in IMG/M |
3300022190 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM15.S.N | Environmental | Open in IMG/M |
3300023179 | Freshwater microbial communities from Lake Lanier, Atlanta, Georgia, United States - LL-1510 | Environmental | Open in IMG/M |
3300024343 | Combined assembly of estuarine microbial communities from Columbia River, Washington, USA >3um size fraction | Environmental | Open in IMG/M |
3300024346 | Whole water sample coassembly | Environmental | Open in IMG/M |
3300024354 | Freshwater microbial communities from Altamaha River, Georgia, United States - Atl_Yuk_RepB_8d | Environmental | Open in IMG/M |
3300025635 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Fall_0.3_<0.8_DNA (SPAdes) | Environmental | Open in IMG/M |
3300025732 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_0.19_N_>0.8_DNA (SPAdes) | Environmental | Open in IMG/M |
3300025889 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_18 (SPAdes) | Environmental | Open in IMG/M |
3300027254 | Estuarine microbial communities from the Columbia River estuary - metaG 1561A-3 (SPAdes) | Environmental | Open in IMG/M |
3300027608 | Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG ER15MSRF (SPAdes) | Environmental | Open in IMG/M |
3300027710 | Subsurface microbial communities from deep shales in Ohio, USA - Utica-3 well 1 S input2 FT (SPAdes) | Environmental | Open in IMG/M |
3300027721 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (1) Depth 10-12cm May2015 (SPAdes) | Environmental | Open in IMG/M |
3300027759 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130206_EF_MetaG (SPAdes) | Environmental | Open in IMG/M |
3300027769 | Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MLB.DD (SPAdes) | Environmental | Open in IMG/M |
3300027797 | Freshwater microbial communities from dead zone in Lake Erie, Canada - CCB hypolimnion July 2011 (SPAdes) | Environmental | Open in IMG/M |
3300027805 | Freshwater and sediment microbial communities from dead zone in Sandusky Bay, Ohio, USA (SPAdes) | Environmental | Open in IMG/M |
3300027806 | Freshwater lake microbial communities from Lake Erie, under a cyanobacterial bloom - NOAA_Erie_Diel6S_1000h metaG (SPAdes) | Environmental | Open in IMG/M |
3300027808 | Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM15.DD (SPAdes) | Environmental | Open in IMG/M |
3300027900 | Freshwater lake sediment microbial communities from the University of Notre Dame, USA, for methane emissions studies - BRP12 BR (SPAdes) | Environmental | Open in IMG/M |
3300027956 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (1) Depth 19-21cm May2015 (SPAdes) | Environmental | Open in IMG/M |
3300027973 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140806_EF_MetaG (SPAdes) | Environmental | Open in IMG/M |
3300028073 | Freshwater microbial communities from Altamaha River, Georgia, United States - Atl_Colum_RepB_8d | Environmental | Open in IMG/M |
3300029349 | Freshwater microbial communities from Iron Gate Dam, Klamath Basin, California, USA - IR103 | Environmental | Open in IMG/M |
3300031669 | Soil microbial communities from Risofladan, Vaasa, Finland - TR-1 | Environmental | Open in IMG/M |
3300031673 | Soil microbial communities from Risofladan, Vaasa, Finland - TR-3 | Environmental | Open in IMG/M |
3300031758 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 12 MA123 | Environmental | Open in IMG/M |
3300031857 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 2 MA125 | Environmental | Open in IMG/M |
3300031951 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 12 MA120 | Environmental | Open in IMG/M |
3300031963 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 2 MA116 | Environmental | Open in IMG/M |
3300031999 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G02_20 | Environmental | Open in IMG/M |
3300032050 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 2 MA122 | Environmental | Open in IMG/M |
3300032053 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G09_16 | Environmental | Open in IMG/M |
3300033981 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME24Aug2014-rr0011 | Environmental | Open in IMG/M |
3300034012 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME18Aug2017-rr0027 | Environmental | Open in IMG/M |
3300034018 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME04Jul2014-rr0021 | Environmental | Open in IMG/M |
3300034061 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME02Sep2004-rr0028 | Environmental | Open in IMG/M |
3300034062 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME27Jul2012-rr0045 | Environmental | Open in IMG/M |
3300034092 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME03Aug2012-rr0069 | Environmental | Open in IMG/M |
3300034117 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME18Jun2014-rr0124 | Environmental | Open in IMG/M |
Geographical Distribution | |
---|---|
Zoom: | Powered by OpenStreetMap |
⦗Top⦘ |
Protein ID | Sample Taxon ID | Habitat | Sequence |
FwDRAFT_100119675 | 3300000882 | Freshwater And Marine | MGEYKAGTLHAGRNPKGPKKAPMAKSRKQAIAIAMSESGMKKRK* |
ML8_100267762 | 3300001335 | Wetlands Benthic | MREYKAGKLKAGVNPKGPKKAPMAKSRRQAVAIALRSAGVPKKKK* |
metazooDRAFT_12757042 | 3300002202 | Lake | MREFKSGKLHGGVNPKGPKKAPVVKSKRQALAIALSQAGVKKK* |
B570J40625_1008411191 | 3300002835 | Freshwater | MGEYKKGTLHAGVNPKGPAKAPLAKSRKQAIAIAMSEAGKSKKK* |
Ga0070374_100482371 | 3300005517 | Freshwater Lake | EYKRGTLHSGKNPKGPKKAPLVKSRKQAVAIALSEAGKSRGKKR* |
Ga0075470_100805481 | 3300006030 | Aqueous | MGEFKRGTLHAGVNPKGPAKAPLAKSRKQAIAIALSEAGKSKKK* |
Ga0070749_105010461 | 3300006802 | Aqueous | KRGTLHAGINPKGPKKAPMAKSRKQAIAIALSEAGKSKKRS* |
Ga0070749_105537252 | 3300006802 | Aqueous | HSGINPKGPKKAPLAKSRKQALAIAISVTRKKKK* |
Ga0075464_110410752 | 3300006805 | Aqueous | HSGKDPKGPKKAPVVKNRKQAITIALSSAGMSKKKAKKK* |
Ga0102978_10031171 | 3300007177 | Freshwater Lake | VMGEFKRGTLHAGKDPKGPKKAKIVKSKKQAIAIALSQAGKAKKK* |
Ga0075460_101402211 | 3300007234 | Aqueous | LHAGVDPKGPKKAPVVKSRNQAIAIALSQAGKAKKK* |
Ga0075458_101900322 | 3300007363 | Aqueous | MGEYKRGTLHAGINPKGPAKAPMAKSRKQAIAIALSEAGMSKKKKK* |
Ga0099847_10977441 | 3300007540 | Aqueous | KAGTLHGGIDPKGKKKAPVVKSRKQAIAIALSQAGVAKKKKGH* |
Ga0099846_11389583 | 3300007542 | Aqueous | VDPDGKGPKKAPVVKSQKQAIAIALRQAGAPPKGKKK* |
Ga0102861_10559093 | 3300007544 | Estuarine | AGVNPKGPAKAPLAKSRKQAIAIALSEAGKSKKK* |
Ga0105746_12839863 | 3300007973 | Estuary Water | TLNAGKDPKGPKKAAVVKNRKQAIAIALSQAGKAKKRAK* |
Ga0105748_101556535 | 3300007992 | Estuary Water | GTLNAGKDPKGPKKAPVVKNRKQAIAIALSQAGKAKKRAK* |
Ga0108970_101232371 | 3300008055 | Estuary | YKRGKLHAGVNPKGPAKAPMAKSRKQAIAIALSEAGKSKKK* |
Ga0114340_11903702 | 3300008107 | Freshwater, Plankton | MKEYKAGTLHAGKNPKGPKKAKIVRSKKQAIAIALSEAGKAKKK* |
Ga0114351_10333496 | 3300008117 | Freshwater, Plankton | KVLGEYKRGTLHSGKDPKGPKKAPVVKNRRQAIAIALSSAGKAKKK* |
Ga0114841_10887674 | 3300008259 | Freshwater, Plankton | KAGKLKAGINPKGPKKAPMAKSRKQAVAIALSQAGMSKKK* |
Ga0114363_10906541 | 3300008266 | Freshwater, Plankton | HSGKDPKGPKKAPVVKSRKQAIAIALSEAGKAKKK* |
Ga0114876_11492773 | 3300008448 | Freshwater Lake | YKSGKLHAGINPKGPKKAPMAKNRSQALAIALRSAGVAKKKK* |
Ga0105102_108043121 | 3300009165 | Freshwater Sediment | GKLKAGIDPKGPKKAPLAKSRAQAVAIALRSAGVKKKK* |
Ga0105104_101738965 | 3300009168 | Freshwater Sediment | AKVMGEYKRGTLHAGINPKGPKKAPMAKSRSQAVAIAMSESGMKRKGK* |
Ga0105104_106222722 | 3300009168 | Freshwater Sediment | EYKRGTLKAGINPKGPKKAPMAKSRKQAVAIAMSQAGMKKKK* |
Ga0105097_101875311 | 3300009169 | Freshwater Sediment | FKRGTLHAGVNPKGPAKAPLAKSRKQAIAIALSEAGKSKKK* |
Ga0114979_104917221 | 3300009180 | Freshwater Lake | HKVMGEYKDKSLHSGKDGKVVKNRKQAIAIALSESGAAKKKK* |
Ga0136655_11017103 | 3300010316 | Freshwater To Marine Saline Gradient | AGVDPDGKGPKKAPVVKSQKQAIAIALRQAGAPPKGKKK* |
Ga0136644_104893391 | 3300010334 | Freshwater Lake | LHAGVNPKGPKKAPIVKSRKQAVAIALSQAGISKRK* |
Ga0129333_107518661 | 3300010354 | Freshwater To Marine Saline Gradient | YKAGTLHSGVDPKGPKKAPIVKSRKQAIAIALSEAGKAKKK* |
Ga0129336_102681252 | 3300010370 | Freshwater To Marine Saline Gradient | GKLHAGVNPKGPKKAPLAKSRKQAIAIALSEAGMSKKK* |
Ga0136551_10000431 | 3300010388 | Pond Fresh Water | MGEYKRGTLHAGVNPKGPAKAPMAKSRKQAIAIALSEAGKSKKK* |
Ga0133913_128889683 | 3300010885 | Freshwater Lake | GKVMKEYGAGKLHGGINPKGPKKAPIVKNRKQAVAIAMSMAGMKKKKSK* |
Ga0137675_10223551 | 3300010966 | Pond Fresh Water | RGTLHAGVNPKGPAKAPLAKSRKQAIAIALSEAGKSKKK* |
Ga0138284_12912711 | 3300012779 | Freshwater Lake | SGTLHAGRNPKGPKKAPIVKSRKQAIAISLSMAGMQKKNRQK* |
Ga0164292_104346151 | 3300013005 | Freshwater | EYKRGTLHAGVNPKGPAKAPLAKSRKQAIAIALSEAGKSKKK* |
Ga0129327_103707731 | 3300013010 | Freshwater To Marine Saline Gradient | GGIDPKGKKKAPVVKSRKQAIAIALSQAGVAKKKKGH* |
Ga0170791_135326931 | 3300013295 | Freshwater | GRNPKGPKKAPIVKSRKQAIAISLSMAGMQKKNRQK* |
Ga0177922_103450531 | 3300013372 | Freshwater | GEYKAGTLHAGVNPKGPKKAPLAKSRKQAVAIALSQAGMTKRK* |
Ga0134315_10211521 | 3300014962 | Surface Water | AGVDPKGPKKAPMAKSRKQAIAIAMRSAGMPKKKK* |
Ga0181363_10597401 | 3300017707 | Freshwater Lake | LHGGVDPKGPKKAPIVKSRKQAIAIAMSEAGMSKKKK |
Ga0181347_11867303 | 3300017722 | Freshwater Lake | YKRGTLHSGKDPKGPKKAPLVKSRKQAVAIALSEAGKSRGKKR |
Ga0181356_12414111 | 3300017761 | Freshwater Lake | QAKIAKVLGEFKDKKLHSGVDPKGPKKARVVKSRKQTIAIALSEAGKLKGKK |
Ga0181343_11395174 | 3300017766 | Freshwater Lake | AGINPKGPKKAPLAKSRKQAVAIALSQAGMSKKKK |
Ga0181357_10213098 | 3300017777 | Freshwater Lake | EYKRGTLHGGIDPKGPKKAPVVTSRKQAVAIALSQAGKAKKGKM |
Ga0181357_12765461 | 3300017777 | Freshwater Lake | VLGEFKDKKLHSGIDPKGPKKARVVKSRKQAIAIALSEAGKLRGKK |
Ga0181357_12826181 | 3300017777 | Freshwater Lake | EFKTGKLHGGIDPKGPKKAMLVKNPKQAIAIALVQAAAMKKKKGK |
Ga0181355_13173133 | 3300017785 | Freshwater Lake | KRGTLHGGIDPKGPKKAPVVKSRKQAIAIALSEAGKSRKTK |
Ga0181355_13235233 | 3300017785 | Freshwater Lake | KRGTLHSGKDPKGPKKAAVVKNRKQAVAIALSVAGKSKKKGK |
Ga0180433_110759573 | 3300018080 | Hypersaline Lake Sediment | LRAGKDPKGPKKAPKAKSRKQAIAIALSEAGMSKPEKRAKGG |
Ga0211726_106644064 | 3300020161 | Freshwater | HAGRDPKGPKKAPVVKSRKQAIAIALSEAGKSKKK |
Ga0211726_109113483 | 3300020161 | Freshwater | YKRGTLHAGINPKGPKKAPLAKSRKQAIAIALSEAGKSKKK |
Ga0211731_109254694 | 3300020205 | Freshwater | AKVMGEYKAGTLHAGVNPKGPRKAPLAKSRAQATAIAMSQAGMSKRK |
Ga0210339_14087241 | 3300021332 | Estuarine | VMGEFKRGTLHAGVNPKGPAKAPLAKSRKQAIAIALSEAGKSKKK |
Ga0222712_106186383 | 3300021963 | Estuarine Water | MGEYKRGTLHAGVNPKGPKKAPLAKSRKQALAIAMSEAGMKKKK |
Ga0196903_10300454 | 3300022169 | Aqueous | HGGIDPKGPKKAPLVKNPKQAIAIALSQANAKKKKK |
Ga0181354_11850902 | 3300022190 | Freshwater Lake | GTLHAGVNPKGPKKAPLAKNRKQAVAIAMSEAGIKKRK |
Ga0214923_100088212 | 3300023179 | Freshwater | MSEFKKGTLHAGKDPDGKGPKKAPIVKSRKQAIAIALSEQAKSKPKGGKK |
Ga0244777_1000032543 | 3300024343 | Estuarine | MGEYKSGTLHAGRNPKGSKKAPLAQSRKQAIAIAMSAMGMKKK |
Ga0244775_112501603 | 3300024346 | Estuarine | TLSAGMNPKGPKKAPMAKSRKQAVAIAMSEAGMAKKGKKK |
Ga0255171_10312373 | 3300024354 | Freshwater | KLHAGVDPKGPKKAPMAKSRKQAIAIALSEAGKSKKK |
Ga0208147_10409445 | 3300025635 | Aqueous | KAGTLHSGKDPKGPKKAPVVKSRKQAIAIALSSAGMAKKKKK |
Ga0208147_11222973 | 3300025635 | Aqueous | EFKMGTLHGGRNPKGPKKAPIVKSRKQAIAIALSEAGKSRKRR |
Ga0208784_10529011 | 3300025732 | Aqueous | KGTLHGGINPKGPKKAPVVKSQKQAIAIALSSAGISKKKGKK |
Ga0208644_11213733 | 3300025889 | Aqueous | VMHEWKTGKLHAGVDPDGKGPKKAPVVKSQKQAIAIALRQAGAPPKGKKK |
Ga0208644_12875603 | 3300025889 | Aqueous | TLHAGRDPKGPKKAPIVKSRKQAIAIALSEAGKARKK |
Ga0208177_10684273 | 3300027254 | Estuarine | VSKVMGEYKSGTLHAGRNPKGPKKAPLARSRKQAIAIAMSEAGMKKRK |
Ga0208974_11750512 | 3300027608 | Freshwater Lentic | KMSKVMGEYKMGTLKAGVNPKGPAKAPMAKSRKQAVAIAMSEAGKMKRK |
Ga0209599_100074031 | 3300027710 | Deep Subsurface | FKAGELHAGKDPKGPKKAPIVKNRKQAIAIALSEAGASKGKKK |
Ga0209492_10755751 | 3300027721 | Freshwater Sediment | EYKAGTLHAGVNPKGPKKAPLAKNRKQAVAIAMSEAGIKKRK |
Ga0209296_12506174 | 3300027759 | Freshwater Lake | EYKRGTLKAGVNPKGPKKAPMAKSRKQAVAIAMSQAGMSKKK |
Ga0209770_100841661 | 3300027769 | Freshwater Lake | LHAGVNPKGPKKAPMAKSRKQAIAIAMSEAGMKRKK |
Ga0209107_103146653 | 3300027797 | Freshwater And Sediment | MGEYKRGTLHAGINPKGPKKAPLAKSRAQAVAIAMSEAGMKKKKK |
Ga0209229_105034342 | 3300027805 | Freshwater And Sediment | SGVDPKGPKKARIVKSRKQAIAIALSEAGKSIKKVKGK |
Ga0209985_101821191 | 3300027806 | Freshwater Lake | SGKNPKGPKKAPIVKNRKQAVAIALSQAGMSKKKKKK |
Ga0209354_103607231 | 3300027808 | Freshwater Lake | GTLNAGVNPKGPAKAKKAGSREQAIAIALSEAGMSKKKK |
Ga0209253_106161621 | 3300027900 | Freshwater Lake Sediment | MGEYKRGTLHAGINPKGPKKAPLAKSRKQAVAIALSVAGKSKKK |
Ga0209820_11613314 | 3300027956 | Freshwater Sediment | LHAGINPKGPKKAPMAKSRAQAVAIAMSESGMKRKGK |
Ga0209298_101157385 | 3300027973 | Freshwater Lake | EYKAGTLHGGVNPKGPKKAPIVKSRKQAIAIALSEAGKSIKKAKGK |
Ga0255180_10027255 | 3300028073 | Freshwater | GEYKRGTLHAGVNPKGPKKAPMAGSRKQAIAIAMSEAGKMKKK |
Ga0238435_1065981 | 3300029349 | Freshwater | MKEYKAGTLHSGVDPKGPKKAKVVTSRNQAIAIALSEANKSKKKAKGK |
Ga0307375_107942811 | 3300031669 | Soil | AKVMGEYKRGTLHAGINPKGPKKAPLAKSRAQAVAIAMSEAGMKKKKK |
Ga0307377_103686133 | 3300031673 | Soil | RGTLHAGVNPKGPAKAPLAKSRKQAIAIALSEAGMSKKMKKK |
Ga0315907_100542022 | 3300031758 | Freshwater | MKEYKAGTLHAGKNPKGPKKAKIVRSKKQAIAIALSEAGKAKKK |
Ga0315907_101261005 | 3300031758 | Freshwater | GKLKAGINPKGPKKAPMAKSRKQAVAIALSQAGMSKKK |
Ga0315909_103645455 | 3300031857 | Freshwater | TLHSGKDPKGPKKAPVVKNRKQAIAIALSSAGMSKKKAKKK |
Ga0315904_109744663 | 3300031951 | Freshwater | LHGGVDPAGPKKAPVVKSRKQAIAIALSQAGKARKK |
Ga0315901_102096081 | 3300031963 | Freshwater | KLKAGINPKGPKKAPMAKSRKQAVAIALSQAGMSKKK |
Ga0315901_102673203 | 3300031963 | Freshwater | MGEYKAGTLHAGVNPKGPKKAPLAKSRKQAVAIALSQAGMTKRK |
Ga0315901_107890621 | 3300031963 | Freshwater | GTLHGGVDPAGPKKAPVVKSRKQAIAIALSQAGKARKK |
Ga0315901_108405121 | 3300031963 | Freshwater | LHAGRDPKGPKKAPVVKNRKQAVAIALSQAGMAKKRGKKK |
Ga0315274_114415573 | 3300031999 | Sediment | TLHSGQDPKGPRKAPVVKSRKQAVAIAMSQAGMSKKRK |
Ga0315906_104458844 | 3300032050 | Freshwater | KVMGEFKRGTLHAGIDPKGPKKAKIVKNKKQAIAIALSQAGKAKKK |
Ga0315284_120393392 | 3300032053 | Sediment | GKIMSEFKAGVLHSGINPKGPKKAPLAKSRKQAIAIALSVTGKAKKTTKKK |
Ga0334982_0501830_406_534 | 3300033981 | Freshwater | KEGKLHSGKDPKGPKKAPKVKSSKQAIAIALSEAGVAKKKGK |
Ga0334986_0121731_14_151 | 3300034012 | Freshwater | MKEFKSGTLHSGKNPKGPKKAKVVTNRKQAIAIAMSEAGMKRKKK |
Ga0334985_0779218_372_506 | 3300034018 | Freshwater | MGEFKRGTLHAGVNPKGPAKAPLAKSRKQAIAIALSEAGKSKKK |
Ga0334987_0672071_469_597 | 3300034061 | Freshwater | KSGTLHSGKDPKGPKKAPVVKSKKQAVAIAMSEAGMSKKGKK |
Ga0334995_0581376_505_639 | 3300034062 | Freshwater | MGEYKRGTLHGGVDPAGPKKAPVVKSRKQAIAIALSQAGKAKKK |
Ga0335010_0039631_3330_3470 | 3300034092 | Freshwater | MGEFKRGTLHSGKDPKGPKKAAVVKNRKQAVAIALSVAGKSKKKGK |
Ga0335033_0160978_1118_1240 | 3300034117 | Freshwater | KRGTLHAGVNPKGPAKAPLAKSRKQAIAIALSEAGKSKKK |
⦗Top⦘ |