NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F100676

Metagenome / Metatranscriptome Family F100676

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F100676
Family Type Metagenome / Metatranscriptome
Number of Sequences 102
Average Sequence Length 102 residues
Representative Sequence MKTAWYGRIVFGASAVLFGVIALMWHDSDTWQTLRQIWSLPFGAIIGGCLMIVQIAGGIGMQYARTARLASIALGVVYLLFSLACIPGIIAAPTVYV
Number of Associated Samples 92
Number of Associated Scaffolds 102

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 27.00 %
% of genes near scaffold ends (potentially truncated) 94.12 %
% of genes from short scaffolds (< 2000 bps) 90.20 %
Associated GOLD sequencing projects 91
AlphaFold2 3D model prediction Yes
3D model pTM-score0.34

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (97.059 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil
(12.745 % of family members)
Environment Ontology (ENVO) Unclassified
(26.471 % of family members)
Earth Microbiome Project Ontology (EMPO) Free-living → Non-saline → Soil (non-saline)
(46.078 % of family members)



 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      


 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Transmembrane (alpha-helical) Signal Peptide: No Secondary Structure distribution: α-helix: 68.80%    β-sheet: 0.00%    Coil/Unstructured: 31.20%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  
pTM-score: 0.34
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.


 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 102 Family Scaffolds
PF00578AhpC-TSA 4.90
PF00486Trans_reg_C 1.96
PF02782FGGY_C 0.98
PF00561Abhydrolase_1 0.98
PF02843GARS_C 0.98
PF02517Rce1-like 0.98
PF07676PD40 0.98
PF01053Cys_Met_Meta_PP 0.98
PF13242Hydrolase_like 0.98
PF01433Peptidase_M1 0.98
PF07519Tannase 0.98
PF01047MarR 0.98
PF01915Glyco_hydro_3_C 0.98
PF00126HTH_1 0.98
PF027395_3_exonuc_N 0.98
PF07920DUF1684 0.98
PF07394DUF1501 0.98
PF14031D-ser_dehydrat 0.98
PF01471PG_binding_1 0.98
PF12779WXXGXW 0.98
PF03404Mo-co_dimer 0.98
PF02954HTH_8 0.98
PF04191PEMT 0.98
PF13565HTH_32 0.98
PF01402RHH_1 0.98
PF13286HD_assoc 0.98
PF01546Peptidase_M20 0.98
PF06764DUF1223 0.98
PF01475FUR 0.98
PF02567PhzC-PhzF 0.98
PF02732ERCC4 0.98
PF00106adh_short 0.98

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 102 Family Scaffolds
COG1266Membrane protease YdiL, CAAX protease familyPosttranslational modification, protein turnover, chaperones [O] 0.98
COG5429Uncharacterized conserved protein, DUF1223 domainFunction unknown [S] 0.98
COG4449Predicted protease, Abi (CAAX) familyGeneral function prediction only [R] 0.98
COG4100Cystathionine beta-lyase family protein involved in aluminum resistanceInorganic ion transport and metabolism [P] 0.98
COG3358Uncharacterized conserved protein, DUF1684 familyFunction unknown [S] 0.98
COG2873O-acetylhomoserine/O-acetylserine sulfhydrylase, pyridoxal phosphate-dependentAmino acid transport and metabolism [E] 0.98
COG2008Threonine aldolaseAmino acid transport and metabolism [E] 0.98
COG1982Arginine/lysine/ornithine decarboxylaseAmino acid transport and metabolism [E] 0.98
COG1948ERCC4-type crossover junction endonucleaseReplication, recombination and repair [L] 0.98
COG1921Seryl-tRNA(Sec) selenium transferaseTranslation, ribosomal structure and biogenesis [J] 0.98
COG1472Periplasmic beta-glucosidase and related glycosidasesCarbohydrate transport and metabolism [G] 0.98
COG0075Archaeal aspartate aminotransferase or a related aminotransferase, includes purine catabolism protein PucGAmino acid transport and metabolism [E] 0.98
COG0735Fe2+ or Zn2+ uptake regulation protein Fur/ZurInorganic ion transport and metabolism [P] 0.98
COG0626Cystathionine beta-lyase/cystathionine gamma-synthaseAmino acid transport and metabolism [E] 0.98
COG0520Selenocysteine lyase/Cysteine desulfuraseAmino acid transport and metabolism [E] 0.98
COG0436Aspartate/methionine/tyrosine aminotransferaseAmino acid transport and metabolism [E] 0.98
COG0399dTDP-4-amino-4,6-dideoxygalactose transaminaseCell wall/membrane/envelope biogenesis [M] 0.98
COG0384Predicted epimerase YddE/YHI9, PhzF superfamilyGeneral function prediction only [R] 0.98
COG0308Aminopeptidase N, contains DUF3458 domainAmino acid transport and metabolism [E] 0.98
COG02585'-3' exonuclease Xni/ExoIX (flap endonuclease)Replication, recombination and repair [L] 0.98
COG01567-keto-8-aminopelargonate synthetase or related enzymeCoenzyme transport and metabolism [H] 0.98
COG0151Phosphoribosylamine-glycine ligaseNucleotide transport and metabolism [F] 0.98


 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms97.06 %
UnclassifiedrootN/A2.94 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
3300000935|JGI12407J12866_106781All Organisms → cellular organisms → Bacteria → Acidobacteria576Open in IMG/M
3300005524|Ga0070737_10147990All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA41015Open in IMG/M
3300005533|Ga0070734_10870638All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA4511Open in IMG/M
3300005538|Ga0070731_10957547All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA4567Open in IMG/M
3300005542|Ga0070732_10523186All Organisms → cellular organisms → Bacteria719Open in IMG/M
3300005566|Ga0066693_10095010All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA41068Open in IMG/M
3300006028|Ga0070717_11963523All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Pseudomonadales → Pseudomonadaceae → Pseudomonas → Pseudomonas fluorescens group → Pseudomonas veronii528Open in IMG/M
3300006046|Ga0066652_101142533All Organisms → cellular organisms → Bacteria738Open in IMG/M
3300006052|Ga0075029_100073002All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA42020Open in IMG/M
3300006804|Ga0079221_11121804All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA4604Open in IMG/M
3300006806|Ga0079220_10720905All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA4737Open in IMG/M
3300009525|Ga0116220_10252121All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA4771Open in IMG/M
3300009646|Ga0116132_1100146All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA4892Open in IMG/M
3300009646|Ga0116132_1244027All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA4546Open in IMG/M
3300010048|Ga0126373_10464335All Organisms → cellular organisms → Bacteria1303Open in IMG/M
3300010048|Ga0126373_13318821All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA4501Open in IMG/M
3300010360|Ga0126372_10563199All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1085Open in IMG/M
3300010366|Ga0126379_12582282All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA4606Open in IMG/M
3300010376|Ga0126381_103973075All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA4576Open in IMG/M
3300012202|Ga0137363_11035709All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA4697Open in IMG/M
3300013307|Ga0157372_13210645All Organisms → cellular organisms → Bacteria → Acidobacteria521Open in IMG/M
3300014153|Ga0181527_1406383All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA4520Open in IMG/M
3300014168|Ga0181534_10595182All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA4636Open in IMG/M
3300014489|Ga0182018_10408408All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA4726Open in IMG/M
3300014491|Ga0182014_10127647All Organisms → cellular organisms → Bacteria → Acidobacteria1474Open in IMG/M
3300014492|Ga0182013_10228738All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA41094Open in IMG/M
3300016294|Ga0182041_10767918All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA4859Open in IMG/M
3300016294|Ga0182041_10789281All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA4848Open in IMG/M
3300016357|Ga0182032_11511491All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA4583Open in IMG/M
3300016404|Ga0182037_10287461All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA41316Open in IMG/M
3300016422|Ga0182039_12163741All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA4513Open in IMG/M
3300016445|Ga0182038_10901698All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA4779Open in IMG/M
3300016445|Ga0182038_12049153All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA4518Open in IMG/M
3300017935|Ga0187848_10167833All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA4958Open in IMG/M
3300017946|Ga0187879_10148809All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA41325Open in IMG/M
3300017948|Ga0187847_10584761All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA4623Open in IMG/M
3300017970|Ga0187783_10225403All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA41374Open in IMG/M
3300017972|Ga0187781_10380359Not Available1007Open in IMG/M
3300017973|Ga0187780_10625676All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA4774Open in IMG/M
3300017975|Ga0187782_10376607All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA41077Open in IMG/M
3300017975|Ga0187782_11658447All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA4506Open in IMG/M
3300018025|Ga0187885_10033901All Organisms → cellular organisms → Bacteria2739Open in IMG/M
3300018033|Ga0187867_10514106All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA4658Open in IMG/M
3300018034|Ga0187863_10461407All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA4710Open in IMG/M
3300018038|Ga0187855_10448674All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA4751Open in IMG/M
3300018040|Ga0187862_10619859All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA4639Open in IMG/M
3300018044|Ga0187890_10341914All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium839Open in IMG/M
3300018047|Ga0187859_10574894All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA4633Open in IMG/M
3300018057|Ga0187858_10305019All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1008Open in IMG/M
3300018086|Ga0187769_11183587All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA4578Open in IMG/M
3300018090|Ga0187770_10859117All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA4727Open in IMG/M
3300021358|Ga0213873_10011622All Organisms → cellular organisms → Bacteria → Acidobacteria1890Open in IMG/M
3300021358|Ga0213873_10136528All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA4730Open in IMG/M
3300021377|Ga0213874_10377910All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA4547Open in IMG/M
3300021401|Ga0210393_10683554All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA4837Open in IMG/M
3300021406|Ga0210386_10484096All Organisms → cellular organisms → Bacteria1069Open in IMG/M
3300021407|Ga0210383_11314812All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA4604Open in IMG/M
3300021413|Ga0193750_1084395All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Terracidiphilus → Terracidiphilus gabretensis581Open in IMG/M
3300022557|Ga0212123_10074550All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales2904Open in IMG/M
3300025404|Ga0208936_1062020All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium512Open in IMG/M
3300025907|Ga0207645_10831371All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA4628Open in IMG/M
3300025922|Ga0207646_11053070All Organisms → cellular organisms → Bacteria717Open in IMG/M
3300026523|Ga0209808_1063670All Organisms → cellular organisms → Bacteria → Acidobacteria1634Open in IMG/M
3300026833|Ga0207728_104624All Organisms → cellular organisms → Bacteria → Acidobacteria1391Open in IMG/M
3300026862|Ga0207724_1010918All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium829Open in IMG/M
3300027703|Ga0207862_1051461All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1242Open in IMG/M
3300027767|Ga0209655_10310922All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA4507Open in IMG/M
3300029889|Ga0246001_1006079All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA44814Open in IMG/M
3300029922|Ga0311363_11038678All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA4713Open in IMG/M
3300030509|Ga0302183_10271526All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA4657Open in IMG/M
3300030524|Ga0311357_10635409All Organisms → cellular organisms → Bacteria → Acidobacteria978Open in IMG/M
3300030878|Ga0265770_1033676All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Acidobacterium → Acidobacterium ailaaui870Open in IMG/M
3300031236|Ga0302324_102554070All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA4622Open in IMG/M
3300031679|Ga0318561_10376565All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA4779Open in IMG/M
3300031680|Ga0318574_10631140All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA4628Open in IMG/M
3300031681|Ga0318572_10625210All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA4641Open in IMG/M
3300031708|Ga0310686_111740577All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae4090Open in IMG/M
3300031747|Ga0318502_10308155All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA4932Open in IMG/M
3300031771|Ga0318546_10760374All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA4682Open in IMG/M
3300031912|Ga0306921_10181629All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA42466Open in IMG/M
3300031941|Ga0310912_10608149All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA4850Open in IMG/M
3300031942|Ga0310916_10608946All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → unclassified Hyphomicrobiales → Hyphomicrobiales bacterium928Open in IMG/M
3300031947|Ga0310909_10884596All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA4734Open in IMG/M
3300032051|Ga0318532_10177690All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA4756Open in IMG/M
3300032076|Ga0306924_12599983All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA4505Open in IMG/M
3300032089|Ga0318525_10325028All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA4790Open in IMG/M
3300032160|Ga0311301_10208125All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales3332Open in IMG/M
3300032160|Ga0311301_12245372All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA4624Open in IMG/M
3300032783|Ga0335079_10860608All Organisms → cellular organisms → Bacteria934Open in IMG/M
3300032805|Ga0335078_12439193All Organisms → cellular organisms → Bacteria → Acidobacteria542Open in IMG/M
3300032828|Ga0335080_11458476All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA4678Open in IMG/M
3300032828|Ga0335080_11753730All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA4607Open in IMG/M
3300032828|Ga0335080_12255669All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA4522Open in IMG/M
3300032892|Ga0335081_11727347All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA4681Open in IMG/M
3300032892|Ga0335081_11795401All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA4664Open in IMG/M
3300032898|Ga0335072_11179468All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA4683Open in IMG/M
3300033134|Ga0335073_10574322All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA41267Open in IMG/M
3300033158|Ga0335077_11250660All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA4724Open in IMG/M
3300033402|Ga0326728_10312186All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA41422Open in IMG/M
3300033977|Ga0314861_0025774All Organisms → cellular organisms → Bacteria → Acidobacteria3594Open in IMG/M



 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil12.75%
PeatlandEnvironmental → Aquatic → Freshwater → Wetlands → Bog → Peatland10.78%
SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Soil9.80%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil8.82%
Tropical PeatlandEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland6.86%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil5.88%
Surface SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil3.92%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil3.92%
PeatlandEnvironmental → Aquatic → Freshwater → Wetlands → Unclassified → Peatland2.94%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil2.94%
Peatlands SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil2.94%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Soil2.94%
PalsaEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa2.94%
RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere2.94%
BogEnvironmental → Aquatic → Freshwater → Wetlands → Bog → Bog1.96%
Agricultural SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil1.96%
BogEnvironmental → Terrestrial → Soil → Wetlands → Permafrost → Bog1.96%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere1.96%
Bog Forest SoilEnvironmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil0.98%
Iron-Sulfur Acid SpringEnvironmental → Aquatic → Thermal Springs → Hot (42-90C) → Acidic → Iron-Sulfur Acid Spring0.98%
WatershedsEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds0.98%
Vadose Zone SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil0.98%
PeatlandEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Peatland0.98%
PalsaEnvironmental → Terrestrial → Soil → Wetlands → Permafrost → Palsa0.98%
FenEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Fen0.98%
PeatEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Peat0.98%
Peat SoilEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Peat Soil0.98%
Plant RootsHost-Associated → Plants → Roots → Unclassified → Unclassified → Plant Roots0.98%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere0.98%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere0.98%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
3300000935Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 40EnvironmentalOpen in IMG/M
3300005524Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen10_05102014_R1EnvironmentalOpen in IMG/M
3300005533Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen06_05102014_R1EnvironmentalOpen in IMG/M
3300005538Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen03_05102014_R1EnvironmentalOpen in IMG/M
3300005542Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen04_05102014_R1EnvironmentalOpen in IMG/M
3300005566Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_142EnvironmentalOpen in IMG/M
3300006028Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaGEnvironmentalOpen in IMG/M
3300006046Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_101EnvironmentalOpen in IMG/M
3300006052Freshwater sediment microbial communities from North America - Little Laurel Run_MetaG_LLR_2013EnvironmentalOpen in IMG/M
3300006804Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS200EnvironmentalOpen in IMG/M
3300006806Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS100EnvironmentalOpen in IMG/M
3300009525Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_7_NC metaGEnvironmentalOpen in IMG/M
3300009646Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_17_150EnvironmentalOpen in IMG/M
3300010048Tropical forest soil microbial communities from Panama - MetaG Plot_11EnvironmentalOpen in IMG/M
3300010360Tropical forest soil microbial communities from Panama - MetaG Plot_6EnvironmentalOpen in IMG/M
3300010366Tropical forest soil microbial communities from Panama - MetaG Plot_24EnvironmentalOpen in IMG/M
3300010376Tropical forest soil microbial communities from Panama - MetaG Plot_28EnvironmentalOpen in IMG/M
3300012202Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_115_16 metaGEnvironmentalOpen in IMG/M
3300013307Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaGHost-AssociatedOpen in IMG/M
3300014153Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin06_60_metaGEnvironmentalOpen in IMG/M
3300014168Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin17_10_metaGEnvironmentalOpen in IMG/M
3300014489Permafrost microbial communities from Stordalen Mire, Sweden - 812P2M metaGEnvironmentalOpen in IMG/M
3300014491Permafrost microbial communities from Stordalen Mire, Sweden - 612S2D metaGEnvironmentalOpen in IMG/M
3300014492Permafrost microbial communities from Stordalen Mire, Sweden - 612S2M metaGEnvironmentalOpen in IMG/M
3300016294Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178EnvironmentalOpen in IMG/M
3300016357Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.000EnvironmentalOpen in IMG/M
3300016404Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082EnvironmentalOpen in IMG/M
3300016422Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111EnvironmentalOpen in IMG/M
3300016445Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108EnvironmentalOpen in IMG/M
3300017935Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_4_40EnvironmentalOpen in IMG/M
3300017946Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_19_10EnvironmentalOpen in IMG/M
3300017948Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_4_10EnvironmentalOpen in IMG/M
3300017970Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_SJ02_MP02_20_MGEnvironmentalOpen in IMG/M
3300017972Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0715_SJ02_MP02_20_MGEnvironmentalOpen in IMG/M
3300017973Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP10_20_MGEnvironmentalOpen in IMG/M
3300017975Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0715_SJ02_MP15_20_MGEnvironmentalOpen in IMG/M
3300018025Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_20_100EnvironmentalOpen in IMG/M
3300018033Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_13_10EnvironmentalOpen in IMG/M
3300018034Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_11_10EnvironmentalOpen in IMG/M
3300018038Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_8_10EnvironmentalOpen in IMG/M
3300018040Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_10_150EnvironmentalOpen in IMG/M
3300018044Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_21_10EnvironmentalOpen in IMG/M
3300018047Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_10_10EnvironmentalOpen in IMG/M
3300018057Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_8_150EnvironmentalOpen in IMG/M
3300018086Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP02_10_MGEnvironmentalOpen in IMG/M
3300018090Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP02_20_MGEnvironmentalOpen in IMG/M
3300021358Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3Host-AssociatedOpen in IMG/M
3300021377Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7Host-AssociatedOpen in IMG/M
3300021401Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-OEnvironmentalOpen in IMG/M
3300021406Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-OEnvironmentalOpen in IMG/M
3300021407Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-OEnvironmentalOpen in IMG/M
3300021413Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L1c1EnvironmentalOpen in IMG/M
3300021441Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1Host-AssociatedOpen in IMG/M
3300021560Tropical forest soil microbial communities from Panama - MetaG Plot_4EnvironmentalOpen in IMG/M
3300022557Paint Pots_combined assemblyEnvironmentalOpen in IMG/M
3300025404Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_10_10 (SPAdes)EnvironmentalOpen in IMG/M
3300025907Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025922Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300026523Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_157 (SPAdes)EnvironmentalOpen in IMG/M
3300026833Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 54 (SPAdes)EnvironmentalOpen in IMG/M
3300026862Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 31 (SPAdes)EnvironmentalOpen in IMG/M
3300027703Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 81 (SPAdes)EnvironmentalOpen in IMG/M
3300027767Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP03_OM2 (SPAdes)EnvironmentalOpen in IMG/M
3300029889Peat microbial communities from Marcell Experimental Forest bog in Minnesota, USA - MG_T3F_30cmEnvironmentalOpen in IMG/M
3300029922III_Fen_E1 coassemblyEnvironmentalOpen in IMG/M
3300030509Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Palsa_N3_2EnvironmentalOpen in IMG/M
3300030524II_Palsa_N3 coassemblyEnvironmentalOpen in IMG/M
3300030878Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE1 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300031236Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Palsa_T0_1EnvironmentalOpen in IMG/M
3300031679Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f23EnvironmentalOpen in IMG/M
3300031680Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f22EnvironmentalOpen in IMG/M
3300031681Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f20EnvironmentalOpen in IMG/M
3300031708FICUS49499 Metagenome Czech Republic combined assemblyEnvironmentalOpen in IMG/M
3300031747Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.174b1f22EnvironmentalOpen in IMG/M
3300031771Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f19EnvironmentalOpen in IMG/M
3300031912Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080 (v2)EnvironmentalOpen in IMG/M
3300031941Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.OX080EnvironmentalOpen in IMG/M
3300031942Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.LF176EnvironmentalOpen in IMG/M
3300031947Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.T000HEnvironmentalOpen in IMG/M
3300032051Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f26EnvironmentalOpen in IMG/M
3300032076Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111 (v2)EnvironmentalOpen in IMG/M
3300032089Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f23EnvironmentalOpen in IMG/M
3300032160Sb_50d combined assembly (MetaSPAdes)EnvironmentalOpen in IMG/M
3300032783Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.3EnvironmentalOpen in IMG/M
3300032805Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.2EnvironmentalOpen in IMG/M
3300032828Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.4EnvironmentalOpen in IMG/M
3300032892Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.5EnvironmentalOpen in IMG/M
3300032898Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.1EnvironmentalOpen in IMG/M
3300033134Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.2EnvironmentalOpen in IMG/M
3300033158Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.1EnvironmentalOpen in IMG/M
3300033402Lab enriched peat soil microbial communities from McLean, Ithaca, NY, United States - MB31MNEnvironmentalOpen in IMG/M
3300033977Tropical peat soil microbial communities from peatlands in Loreto, Peru - SJ75EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap



 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
JGI12407J12866_10678123300000935Tropical Forest SoilMKTTSYERIVFGASAVFYGAMALRWYDAQTWQTLAEIWKLPIGRIVGGCLMAAQIAGGIGIQFTRTTRLASIVLVIVYLSFSLACVPGI
Ga0070737_1014799013300005524Surface SoilVLFGVIALMWHDAETWQTLGKIWNLPFGTIVGECLMIALIAGGIGIEHVRTARLASIILCVVYLLFSLACIPDIMAA
Ga0070734_1087063823300005533Surface SoilMKPALYGRMVFGASAALLGVISLMWYDADTWQTLREIWNLPFGRVIGGGLMVLQIAGGVAMQHPRTARPASAVLSVVYLLFSLACIPG
Ga0070731_1095754723300005538Surface SoilMKAALNGRIVFGASAVLFGVIALKWYDAATWQTLRQIWSLPFGRIIGGCLMAAQIAGGVGIVHPRTAHLASVVLGVTYLFFSLACVPGIISAPAVYEHYGSFFEQFC
Ga0070732_1052318613300005542Surface SoilMKTGLYGRIVFGASAVLFGVIALMWHDADTWQTLHKLWSLPFGAIVGACLMVAQIGGIGILFQRTARSASIVLGIVYLLFSLVCVAGIIAAPTVYAVYGSFFEQFCLVCGAVAVYASTEANAVQAAA
Ga0066693_1009501013300005566SoilMKTALYGRIVFGASAVLFGVIALIWYDSDTWQTLRQIWSLPFGAIIGRCLMTAQIAGGIGIQHSRVVRLASVVLGVVYLLFSLACIPGIIAAPSIYAQYGSFFEQFCLLCG
Ga0070717_1196352313300006028Corn, Switchgrass And Miscanthus RhizosphereVFGASGVLFGVIALLWHDSDTWQEMHHILSLPFGVAIGGGLMAAQIFGGIGMQVPRTTRLASIVLSVVYLVFSLACIPGIVATPSVYAQYGSFFEQFCILCGAIALYAATEVNAGR
Ga0066652_10114253313300006046SoilMKSAFYGRFVFGASAVLFGVIALMWHDAETWQTLRKLWSLPFGIIIGGSLMLAQIAGGIGILFQRTARSASLVLGFVYLFFSLACIPSIIAAPAIYAQYGSFFEQFCLLCGAMAVYAATE
Ga0075029_10007300213300006052WatershedsMKTALYGRIVFGASAVLFGVIALMWYDSDTWQTLRQIWSLPFGTIIGGCLMIVQIAGGIGMQYPKTARLASIVVGIIYLLFSLACIPGIVAAPTIYVHYGSFFEQ
Ga0079221_1112180423300006804Agricultural SoilMVFGASAVLFGFIALMWHDADTWQTLRQIWSLPFGAIIGACLMIAQIAGGTAMQHPRSARFASIILGVGYLLFSLACVPSIIAASDPFERYGGSF
Ga0079220_1072090513300006806Agricultural SoilVFGAAAVLFGVIALMWHDAATWQNLQHTWRLPLGAVIGGCLMGAQIAGGIGILYARTERLAAIVLSVVYLCFSLACIPDIIAAANVYDKYGGSF
Ga0116220_1025212123300009525Peatlands SoilMKTALYGRIVFGASAVLFGVIALMWHDSDTWQALSQIWSLPFGAIIGGCLMAVQIAGGIGMQFPRSARLASIVLGVVYLLFSLACIPGIIAAPAIYVHYGSFFE
Ga0116132_110014623300009646PeatlandMKTAFYGRIVFGASAVLFGAIALMWHDADTWQNLQHIWSLPLGVIIGGCLMTAQIAGGIGIQFPRTGRWASAGLCIVYLCFSLACVPDIV
Ga0116132_124402713300009646PeatlandMNTALYGRIVFGASAVLFGVIALMWHDADTWQTLREIWVLPFGTIIGGCLMTAQIAGGIGMQHLRTARLASVVLGVVYLLFSLACVPGVIAAPAVYAEYGS
Ga0126373_1046433533300010048Tropical Forest SoilMKTALYGRVVFGPSAVLFGVIALMWHDPDTWQNLQHIWSLPFGAVIGGCLMAAQISGGIGVLYSRTARLASVVLCVVYLCFSLACVPDIIAASNIYER
Ga0126373_1331882123300010048Tropical Forest SoilVKTALYGRIVLGASAVLFGVITLMWHDSDSWQNLQHIWRLPFGTIIGECLMVAQVAGGIGMLYPRTVRSAAVVLCIVYLCFSLACVPDIIAAANIYDKYGGSF
Ga0126372_1056319913300010360Tropical Forest SoilVKRALFGRVVFGAAAVLFGVIGLLWRDSDTWQELHQIWRLPFGVAIGVGLMIAQISGGIGIQVPRATRLASVVLSVVYLLFSLACVPGI
Ga0126379_1258228213300010366Tropical Forest SoilMETALYERIVFGASAVLFGVIALMWHDADTWQNLQHIWSLPFGTIIGGCLMSAQIAGGIGMQYPRTTRLASVVLCAVYLCFSLASIPDIIAASNIYERYG
Ga0126381_10397307513300010376Tropical Forest SoilMLLLFRVKTVPYGRMVFGASAVLFGVIALMWYDSDTWQTLRQIWSLPFGAIIGGGLMVGQIAGGIGMQYPRTVRLASIVLGIVYLLFSLACIPASLPHRPPTSTTRAS
Ga0137363_1103570913300012202Vadose Zone SoilMKTALYGRIVFGASAVLFGVIALLWHDADTWQNLQHIWSLPFGTIIGGCLMTAQIAGGIGIQYPRTGVLASVVLCVVYLCFSLACIPDVIAASNIYERYGG
Ga0157372_1321064513300013307Corn RhizosphereMKITLPGRILFGVSAVLYGVIALMWHDAETWENLQHIWSLPFGRAFGWCLMTAQIAGGIGVFYRRSVRLASVVLSLAYLCFSLACVPDIIAASNTYQR
Ga0181527_140638313300014153BogMKTALYGRIVFGASAVLFGVIALMWHDPDTWQTLSQIWSLPFGAILGGCLMTAQIAGGMGMQYPRTARWASIILGAVYLLFSLACIPGIIA
Ga0181534_1059518213300014168BogMKTASYGRTVFGASAVLFGVIALMWHDADTWQSMARIWSLPLGSFVGACLMIAQITGGIALMLPRTARQGAIVLGVVYALFSLACVPGIIASPAIAQVFPQDAIDRL
Ga0182018_1040840813300014489PalsaMKTALYGRIVFGASAVLFGVIALMWHDSATWQNLQQIWRLPFGTLIGRCLMVALIAGGIGMQYARTARVASVVLCAVYFCFSLACIPDIIAASNVYERY
Ga0182014_1012764713300014491BogMRTALYGRIVFGASAVLFGVVALMWYDSDTWQTLSQIWSLPFGTIIGGCLMIAQIAGGFGMQYPGTARWASIVLGIVYLLFSLACVPGIIAAPAVYEHYGSFFEQ
Ga0182013_1022873813300014492BogMKTALYGRIVFGASAVLFGVIALMWYDSDTWQTLRQIWSLPFGTIIGGCLMIVQIAGGIGMQYPKTARLASIVLGVVYLLFSLACIPGIIAAPTIYVHYGSFFEQF
Ga0182041_1076791813300016294SoilVKTELYGRIVFGAGAVLFGVIALMWYDSDTWQTLRQIWSLPFGTIIGGCLMTVQIAGGIGMQYSRTTRLASIVLGVVYLLFSLACIPGIIAAPAIYVRYGS
Ga0182041_1078928113300016294SoilVFGASGVLFGVIALLWHDADTWQELHRILSLPFGVVIGGGLMVAQIVGAIGMQIPRATRAASVVLGVVYLVFSLVCIPGIVAAPNVYAQYGSFFEQFCILCGAIALYAATEV
Ga0182032_1151149123300016357SoilVKTASYGRIVLGASAVLFGVITLMWHDSDTWQNLRHIWSLPFGAIIGECLMVAQIAGGIGMLYPRTVRSASVVLCIVYLCFSLACVPDIIA
Ga0182037_1028746123300016404SoilMKATSYGRIVFGASAVFYGVIALVWYDAQTWQTLAAIWKLPFGRVIGGCLMAAQIAGGIGIQFTRAARRASIILGTVYLLFSLACVPGILSAPGAYAE
Ga0182039_1216374113300016422SoilMKTALYGRIVFGASAVLFGVIALMWYDSDTWQTLRQIWSLPFGTIIGGCLMTVQIAGGIGMQYSRTTRLASIVLGVVYLLFSLACIPGIIAASTIYAQYGSFFEQ
Ga0182038_1090169813300016445SoilMKGVQYGRLAFGIAAVLFGVIALMWHDADTWQALTKIWSLPSGTIIGECLMVTQIAGGIGLLYPRTVRWASIILSVVYVLFSLACIPGIVAAPTNFGQYDG
Ga0182038_1204915313300016445SoilVKTELYGRIVFGAGAVLFGVIALMWYDSDTWQTLRQIWSLPFGTIIGGCLMTAQIAGGIGMQYPRTAHLASVILGVVYLLFSLACIPGIIAA
Ga0187848_1016783313300017935PeatlandMKTAFYGRIVFGGSAVLFGVIALMWHDSDTWQTLSQIWSLPFGAILGGCLMTAQIAGGIGMQYPRTAHLASIVLGAVYLLFSLACIPGIIAAPASYEHYGSFFEQ
Ga0187879_1014880923300017946PeatlandMKTALYGRIVFGASAVLWGVIALMWYDSDTWQTLTRIWGLPFGTTVGGCLMIVQIAGGMGIEYPRTAHLASLVLGIVYLLFSLACIPGIIAAPTVY
Ga0187847_1058476113300017948PeatlandMKTALYGRIVFGVSAVLCGVIALMWYDSDTWQTLRRIWSLPFGTIVGGCLMIVQIAGGIGMQYASTARLASIVLGVVYSLFSLACIPGIIAAPAVYVHYGSFIELF
Ga0187783_1022540323300017970Tropical PeatlandMNPPLNGRIVFGASAVLFGVIALLWHDSDTWQTLILIWNTQIRSLPFGAILGGCLMIAQIAGGIGIQHPRTLRPASILLGLVYLSFSLACIPGIAAAPTVYEHYGSFFEQFCLLCGAV
Ga0187781_1038035923300017972Tropical PeatlandMRTAFYGRIVFGASAVLFGIIALMWHDPDTWQNLHQIWRLPFGGFLGGCLMIALIAGGIGIEYPPTAHLASVILGVVYLSFSLACIPDIVAASNVYERYG
Ga0187780_1062567623300017973Tropical PeatlandMKSASYGRIVFGASAVLFGVIALKWHDADTWQTLHEIWRLPFGAIIGGCLMIGQIAGGIGMQSARTARWASIILGVVYLLFSLASIPGIVAS
Ga0187782_1037660723300017975Tropical PeatlandMVFGAAAVFFSVIALLWHDPDTWQNVQQIWSLPFGTVIGGCLMAAQIAGGIGMQFLRTARVAAVVLCVVYFCFSLACVPGIVAATNVYDKY
Ga0187782_1165844713300017975Tropical PeatlandMTIMSGRILFGASAVLFGVIALMWHDADTWQNLSQIWKLPSGAIIGACLMIAQIAGGIAMLLLRTARLASILLIAVYAIFALACIPGIIAAPGVYAQYGSFFEQFCLLSGAISLYA
Ga0187885_1003390133300018025PeatlandMKTALYGRIVFGVSAVLCGVIALMWYDSDTWQTLRRIWSLPFGTIVGGCLMIVQIAGGIGMQYASTARLASIVLGVVYSLFSLACIPGII
Ga0187867_1051410623300018033PeatlandMRTALYGRIVFGASAVLFGVIALMWHDSDTWQTLSQIWSLPFGAIVGGCLMIAQIAGGIGMQYPGTARLASIFLGVVYLLFSLACIPGIIAAP
Ga0187863_1046140723300018034PeatlandMKTALYGRIVFGASAVLFGVIALMWYDSDTWQTLRQIWRLPFGTIVGGCLMIVQIAGGIGIEYPKTARLASIVLGIVYLLFSLACIPGIIAAPAIYGYYGSFFEQL
Ga0187855_1044867413300018038PeatlandMKTALYGRIVFGASAVLFGVIALMWYDSDTWQSLSQIWSLPFGTIIGGCLMIVQIAGGIGMQYPTTARLASAVLGIVYLLFCLACIPGIIAAPAIYVH
Ga0187862_1061985913300018040PeatlandMKTALYGRIVFGVSAVLCGVIALMWYDSDTWQTLRRIWSLPFGTIVGGCLMIVQIAGGIGMQYASTARLASIVLGVVYSLFSLACIPGIIA
Ga0187890_1034191413300018044PeatlandLIPPASRDVCYLLCMKTAFYGRIVFGAAAVWFGVIALMWHDADTWQNLQHIWSLPFGAIIGGCLMAALIAGGIGIQYSRTARLASVALCVVYLCFSLACI
Ga0187859_1057489413300018047PeatlandMKTALYGRIVFGVSAVLCGVIALMWNDSDTWQTLRRIWSLPFGTIVGGCLMIVQIAGGIGMQYASTARLASIVLGVVYSLFSLACIPGIIAAPAVYVH
Ga0187858_1030501923300018057PeatlandMKTALYGRIVFGAAAVLFSVIALMWHDADTWQNLQYIWSLPFGTIIGGCLMTAQIAGGIGIQYARTARLASVVLCVVYLCFSLACIPDIIA
Ga0187769_1118358713300018086Tropical PeatlandMKTASYGRIVFGASAVLFGLIALMWYDPETWQNLRQIWSLPFGTLIGGFLMAAQIAGGIGMQCPRTVRLASVVLGVVYLLFSLANIPDIIAASNIYERY
Ga0187770_1085911713300018090Tropical PeatlandMKTALYGRIIFGASAVLFGVIALMWYDSDTWQTLRQIWSLPFGTIIGGCLMTVQIAGGIGIEYPRSARAASIALGGVYLLFSLACIPGIIAAPAVYEHYGSFFEQFTCFCG
Ga0213873_1001162223300021358RhizosphereMKTRYGKIFFGASAVLFGLIALMWHDPDTWQNLHEIWRLPFGGIIGECLMGAQIAAGIAMQCPRITRLASIVLSIVYLCFSLACVPATIAASNRYD
Ga0213873_1013652813300021358RhizosphereMKTSVYGRMVFGAAAVIFGVIALLWHDADTWQGLTKIWSLPYGTRIGEGLMIAQIAGGIGIVYPRTVRLASVVLTVVYALFSLACIPGIVGAPTNFG
Ga0213874_1037791013300021377Plant RootsVKSASYGRIVFGGSAVLFGVIALMWHDADTWQTPYKILTLPFGSAIGNALMIAQIAGGIGIVYPQTTRSASVVLGVVYGIFSLTCIPGIVAAPTVYAQYGSFFEQFCLLSGAIAVYAATEPNGTRAFALSRGARL
Ga0210393_1068355413300021401SoilMKTAWYGRAVFGASAVLFGVIALMWYDSDTWQTLVEIWRLPFGRIIGGCLMIVQIAGGIGMQHPRTVRLASMVLVATYLLFSLACIPDIIAAPTTYVH
Ga0210386_1048409613300021406SoilMKTAWYGRIVFGASAVLFGIIALMWWDADTWQTLSQIWTLPFGTVIGGCLMTGQIAGGIGIGFPSTARWASMVLGVVYLLFSLACIPGIIAAPAV
Ga0210383_1131481213300021407SoilMKAASYGRIVFGASAVLLGIIALMWYDADTWQTLRRIWSLPFGTTIGGCLMMVQIAAGIGMQYPRTAHLASMVLGILYLFFSLACIPDILAAPTVYVHYGSFFE
Ga0193750_108439513300021413SoilMKTGLAGRIVFGASAVLFGVIALMWHDADTWQTLHKLWNVPLGTIMGACLMLAQIAGGIGILFQRTARSASIVLGIVYLLFSLVCIAGIFAAPTVYAAYGSFFEQFCLVCGAVAVYAATEPNAAQVAALGR
Ga0213871_1016617223300021441RhizosphereMKPAYYARILFGLSAVLFGVIALMWHDADTWQTLRRIWSVPFGTLIGNGLMVAQIAGGVGILYPRTARSASIVLTVVYAVFSVACVPGIFAHPAVYAQYGSFFEQFCLLSGAVAMCAATDANAGRSLAFGRAARLGL
Ga0126371_1306958513300021560Tropical Forest SoilMKTGLYGRLLFGASAVLVGVIALMWHDIETWQNLHKLWSIPFGLIIGCCLMVAQIASGIGILFARTARVASIVLSVVYLLFSLVCIASIVAAPKVYAPYGSFFEQLCPLCGAIAVYASTELNAARAIAFRGTARLGLGLC
Ga0212123_1007455033300022557Iron-Sulfur Acid SpringMYGRVVFGASAVLFGVIALMWYDSDTWQTLRQIWSLPFGTVVGGCLMIVQIAGGIGIEYRRTAHVASIVLGIIYLLFSLACVPGIIAAPTI
Ga0208936_106202013300025404PeatlandMKTAFYGRIVFGAAAVWFGVIALMWHDADTWQNLQHIWSLPFGAIIGGCLMAALIAGGIGIQYSRTARLASVALCVVYLCFSLACIPDIIA
Ga0207645_1083137113300025907Miscanthus RhizosphereMKVASYGRIAFGASAVLFGVIGLMWYDAETWQTLAQIWKLPFGTIIGGCLMTLQIAGGIALQSPRTVRLGAIALCAVYLSFSLACVPDIIVAAS
Ga0207646_1105307023300025922Corn, Switchgrass And Miscanthus RhizosphereMKTGLYGRIVFGASAVLFGVIALMWHDADTWQTLHKLWNVPLGTIMGACLMVAQIAGGIGILFQRTARSTSIVLGIVYLLFSLVCIAGIFAAPTVYAAYGSFFEQFCLVCGAVAVYAATEPNAAQAAALGR
Ga0209808_106367043300026523SoilMKTALYGRIVFGASAVLFGVIALLWHDADTWQNLQHIWSLPFGTIIGGCLMTAQIAGGIGIQYPRTGRLASVVLCVVYLCFSLACIPGRHCRIEHL
Ga0207728_10462433300026833Tropical Forest SoilMKTTSYERIVFGASAVFYGAMALRWYDAQTWQTLAEIWKLPIGRIVGGCLMAAQIAGGIGIQFTRTTRLASIVLVIVYLSFSLACVPGILSAPGA
Ga0207724_101091823300026862Tropical Forest SoilMKTTSYERIVFGASAVFYGAMALRWYDAQTWQTLAEIWKLPIGRIVGGCLMAAQIAGGIGIQFTRTTRLASIVLVIVYLSFSLACVPGILSA
Ga0207862_105146133300027703Tropical Forest SoilMKTTSYERIVFGASAVFYGAMALRWYDAQTWQTLAEIWKLPIGRIVGGCLMAAQIAGGIGIQFTRTTRLASIVLVIVYLSFSLACVPGILSAPGAYAEYPNFFEQLSLLCGAVALC
Ga0209655_1031092213300027767Bog Forest SoilMKTAIYGRVFYGASAVLFGVIALLWHDADTWQNLQHIWKLPFGAIFGGCLMIALIAAGIGLQFPRTERLASLTLGVVYLSFSLACIPDILAAMNIYERFGG
Ga0246001_100607913300029889PeatMKTAIYGRMVFGASAVLFGVIALLWHDADTWQNLQHIWKLPFGVILGDCLMIAEIAAGIGIQFPKSARPASLVLGVVYLSFSLACIPDI
Ga0311363_1103867823300029922FenMKAASYGRIVFGAAAVLFGVIALMWYDAATWQTLREIWNLPFGATIGGCLMMVQIAAGIGIQYPRTAHLASIVLGMVYLLFSLACIPGILAEPAVYVHYGSFFEQFCLLCGAIALL
Ga0302183_1027152623300030509PalsaMKTALYGWIVFGASAVLFGVIALMWYDSDTWQTLRQIWSLPFGTIIGGCLMIVQIAGGIGMQYPGTARLASIVLGIIYSLFSLACIPGIIAAPTTYV
Ga0311357_1063540923300030524PalsaMKTALYGRIVFGASAVLFGVIALMWYDSDTWQTLRQIWSLPFGTIVGGCLMIAQIAGGIGMQYPRAAHLASIVLGIVYLLFSLACIPGILAAPAIYEHYGSFFEQFA
Ga0265770_103367623300030878SoilMKTALYARIVFGASAVLYGIIALMWHDPETWQNVHQIWRLPFGTFIGGCLMAALIAGGIGMQYSRTARLAAVALCVVYSCFSLACIPGIISATNIYDRYGCSFFLFFSLVC
Ga0302324_10255407013300031236PalsaMKTERYGRIVFGGSAVLLGVISLMWHDADTWQTLRRIWILPFGTIIGGGLMTVQIAGGIGMQRRGTARLASIFLGIAYSFFCLACIPGIVAAPTVYEHYGSFFEQFCALCGAIALYAATDANA
Ga0318561_1037656533300031679SoilMKTAWYGRIVFGAGAVLFGVIALMWHDPATWQTLRQIWRLPFGAVIGACLMAAQIAGGIGMQYPRTVRLASLVLCVVYLCFSLACIPDIIAASSLYERY
Ga0318574_1063114013300031680SoilMKTAWYGRIVFGAGAVLFGVIALMWHDPATWQTLRQIWRLPFGAVIGACLMAAQIAGGIGMQYPRTVRLASLVLCVVYLCFSLACIPDIIAASSLYERYGGSFF
Ga0318572_1062521013300031681SoilMKTAWYGRIVFGAGAVLFGVIALMWHDPATWQTLRQIWRLPFGAVIGACLMAAQIAGGIGMQYPRTVRLASLVLCVVYLCFSLACIPDIIAASSLYER
Ga0310686_11174057723300031708SoilMKTALYGRIFFGASAVLFGAIALMWHDADTWQNLQHIWSLPLGVIVGGSLMTTQIAGGIGIQFPRTGRWASAGLSIVYLCFSLACVPDIIAAANIYD
Ga0318502_1030815523300031747SoilMKTALYGRIVFGASAVLFGVIALMWHDADTWQNLRQIWSLPSGIVIGGCLMVLLIAGGIAMQYSRTARLASVVLCVVFGCFSLACIPGIIKAPTVYAEYG
Ga0318546_1076037413300031771SoilVKTELYGRIVFGAGAVLFGVIALMWYDSDTWQTLRQIWSLPFGTIIGGCLMTAQIAGGIGMQYPRTAHLASVILGVVYLLFSLACIPGIIAAPTIYAQYG
Ga0306921_1018162923300031912SoilMKTALYGRIVFGASAVLFGVIALMGSDSDTWQTLRQIWSLPFGTIIGGCLMTVQIAGGIGMQYSRTTRLASIVLGVVYLLFSLACIPGIIAAPAVYVHYGSFFEQSSSLCGAIAL
Ga0310912_1060814923300031941SoilMKGVQYGRLAFGIAAVLFGVIALMWHDADTWQALTKIWSLPSGTIIGECLMVTQIAGGIGLLYPRTVRWASIILSVVYVLFSLACIPGIVAAPTNFGQYDGF
Ga0310916_1060894613300031942SoilMGWRRIVFGASGVLFGVIALLWHDADTWQELHRILSLPFGVVIGGGLMVAQIVGAIGMQIPRATRAASVVLGVVYLVFSLVCIPGIVAAPNVYAQYGSFFEQFCILCGAIA
Ga0310909_1088459613300031947SoilVFGASGVLFGVIALLWHDADTWQELHRILSLPFGVVIGGGLMVAQIVGAIGMQIPRATRAASVVLGVVYLVFSLVCIPGIVAAPNVYAQYGSFFEQFCILCGAIALYAATEVNAGRTLAFGRA
Ga0318532_1017769033300032051SoilMKTAWYGRIVFGAGAVLFGVIALMWHDPATWQTLRQIWRLPFGAVIGACLMAAQIAGGIGMQYPRTVRLASLVLCVVYLCFSLACIPDI
Ga0306924_1259998313300032076SoilVLLFPGKKTALYGRIVFGASAVLFGVIALMWYDSDTWQTLRQIWSLPFGAIIGGCLMVGQIAGGIGMQYPQTVRLASIVLGIVYLLFSLACIP
Ga0318525_1032502833300032089SoilMKTAWYGRIVFGAGAVLFGVIALMWHDPATWQTLRQIWRLPFGAVIGACLMAAQIAGGIGMQYPRTVRLASLVLCVVYLCFSLACIPDIIAASSLYE
Ga0311301_1020812543300032160Peatlands SoilMKTPLYARIVFGASAVLLGVIALMWYDSDTWQTLRQIWSLPFGTIIGGCLMIVQIAGGIGIEYPPAARLASIGLGVVYLLFCLACTPGIIAAPTI
Ga0311301_1224537213300032160Peatlands SoilMKTAWYGRIVFGASAVLFGVIALMWHDSDTWQTLRQIWSLPFGAIIGGCLMIVQIAGGIGMQYARTARLASIALGVVYLLFSLACIPGIIAAPTVYV
Ga0335079_1086060813300032783SoilMKRVPYKRIVFGAAAVLFGVIALMWHDPDTWQSLRQLWSLPLGTVIGGCLMAAQIAGGIGMLHPRTVRWAAVVLSVVYLLFSLACIPGIIAAPSVYDSYGSFFEQFCLLC
Ga0335078_1243919313300032805SoilVPCHNLTTGTRSEAARVLLFLCMRTALYGRIVFGASAVLFGIIALMWHDADTWQTLRQIWSLPFGNVIGACLMTAQIAGGIGMQYPRTAHLAS
Ga0335080_1145847623300032828SoilMKTALYGRIVFGASAVLLGVIALMWHDPDTWQTLRQIWSLPFGTIIGWFLMSAQIAGGIGMLYPGTVRLSSIVLVAVYLLFSIACIPGIVAAPTIYA
Ga0335080_1175373023300032828SoilMVFGASAILFGVIALLWHDSDTWQTLRRILSLPLGAVIGGCLMLAQIAGGIAMQHPRAAHSAAIVLGIVYSLFSLACIPDIAAAPAVYAHYGSFFEQFCLL
Ga0335080_1225566913300032828SoilMKASLYGRTVFGVSAVLLGVIALMWYDIDTWQALHQIWKLPFGAVIGGCLMVFQIAGGVGMLHQRTTRWASIVLGIDYGLFSLACIPGIIAAPSVYEPYG
Ga0335081_1172734723300032892SoilVLFGIIALMWHDADTWQSLRQIRTLPFGAIIGSALMAAQIAGGIGIVYSRTARLASIVLGVVYLLFSLACIRAILAEPASYANFFEQFS
Ga0335081_1179540123300032892SoilMQSGAATAAAGVRWRPGRIVLGAAAVLCGVIALMWYDADTWQTVRQIWKLPFGRMIGGGLMILQIAGGIGILYPRSARPAAMVLAVVYFLFSLACVPGIVVAPTVYERYGSFFEQFCLLSGAI
Ga0335072_1117946813300032898SoilMSRPFYGRIIFGASAALFGVIALMWHDADTWQTLTQIWRLPFGSVIGACLMIAQIGGGIGIAIGIGRRGTAHAAALLLAVVYLLFSLACIPSIIAAPATYLHYGSFFEQACLLSGAIALF
Ga0335073_1057432223300033134SoilMTRPFYGRIIFGASAALFGVIALMWHDADTWQTLTQIWRLPFGSVIGACLMIAQIAGGIGIAIGIGRRGTAHAAALLLAAVYLLFSLACIPSIIAAPATYLHYGSFFEQACLL
Ga0335077_1125066013300033158SoilMKDAAGGRLVFGAAAVLFGAIALIWHDADTWQTLREIWKLPHGTMIGGCLMAAQIAGGIAIARAPTARLGSIVLGVVYLLFSLACVPGII
Ga0326728_1031218613300033402Peat SoilMVFGASAVLFGAIALMWHDPDTWQTLSQIWSLPSGALLGGCLMTAQIAGGVGMQYPQTARLASMVLGVVYLLFSLACIPGITAAPAVYEHYGSFFE
Ga0314861_0025774_367_6633300033977PeatlandMKTAFYGQIMFGAAAMLFGIVALMWHDSDTRQNLQHIWGLPLCTVMGGCLMAAQIAGGIGMLYPRTTRLAAIVLCAVYLCFSLACIPDIIAASNIYDK


 ⦗Top⦘


© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.