| Basic Information | |
|---|---|
| Family ID | F100640 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 102 |
| Average Sequence Length | 41 residues |
| Representative Sequence | LLQELAAEVAGWPDAPSEAETAAMLRPVGRNFIPDRYR |
| Number of Associated Samples | 95 |
| Number of Associated Scaffolds | 102 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Unclassified |
| % of genes with valid RBS motifs | 0.00 % |
| % of genes near scaffold ends (potentially truncated) | 99.02 % |
| % of genes from short scaffolds (< 2000 bps) | 94.12 % |
| Associated GOLD sequencing projects | 92 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.43 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Unclassified (76.471 % of family members) |
| NCBI Taxonomy ID | N/A |
| Taxonomy | N/A |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil (36.274 % of family members) |
| Environment Ontology (ENVO) | Unclassified (35.294 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (42.157 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 30.30% β-sheet: 0.00% Coil/Unstructured: 69.70% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.43 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 102 Family Scaffolds |
|---|---|---|
| PF08245 | Mur_ligase_M | 68.63 |
| PF13599 | Pentapeptide_4 | 0.98 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| Unclassified | root | N/A | 76.47 % |
| All Organisms | root | All Organisms | 23.53 % |
| Visualization |
|---|
| Powered by ApexCharts |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 36.27% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment | 6.86% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 4.90% |
| Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 4.90% |
| Peatlands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil | 3.92% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 3.92% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 3.92% |
| Boreal Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Boreal Forest Soil | 3.92% |
| Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil | 2.94% |
| Palsa | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa | 2.94% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere | 2.94% |
| Bog Forest Soil | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil | 1.96% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 1.96% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 1.96% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 1.96% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 1.96% |
| Peatland | Environmental → Aquatic → Freshwater → Wetlands → Bog → Peatland | 0.98% |
| Soil | Environmental → Aquatic → Freshwater → Groundwater → Unclassified → Soil | 0.98% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 0.98% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 0.98% |
| Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 0.98% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 0.98% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 0.98% |
| Prmafrost Soil | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Prmafrost Soil | 0.98% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Rhizosphere | 0.98% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 0.98% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.98% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.98% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere | 0.98% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 2199352024 | Bare-fallow DEEP SOIL | Environmental | Open in IMG/M |
| 3300001356 | Peat soil microbial communities from Weissenstadt, Germany - SII-SIP-2007 | Environmental | Open in IMG/M |
| 3300004092 | Coassembly of ECP03_0M1, ECP03_OM2, ECP03_OM3, ECP04_OM1, ECP04_OM2, ECP04_OM3, ECP14_OM1, ECP14_OM2, ECP14_OM3 | Environmental | Open in IMG/M |
| 3300005186 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_125 | Environmental | Open in IMG/M |
| 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Host-Associated | Open in IMG/M |
| 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Environmental | Open in IMG/M |
| 3300005541 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen05_05102014_R1 | Environmental | Open in IMG/M |
| 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Environmental | Open in IMG/M |
| 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Host-Associated | Open in IMG/M |
| 3300005575 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_151 | Environmental | Open in IMG/M |
| 3300005602 | Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF2 | Environmental | Open in IMG/M |
| 3300006806 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS100 | Environmental | Open in IMG/M |
| 3300009029 | Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Permafrost soil replicate 1 DNA2013-189 | Environmental | Open in IMG/M |
| 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Host-Associated | Open in IMG/M |
| 3300009162 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD2 | Host-Associated | Open in IMG/M |
| 3300009683 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_b_LC metaG | Environmental | Open in IMG/M |
| 3300009698 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_3_AS metaG | Environmental | Open in IMG/M |
| 3300010152 | Soil microbial communities from Oklahoma, USA to study soil gas exchange rates - GP-OK-ARM metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300010329 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_2_11112015 | Environmental | Open in IMG/M |
| 3300010376 | Tropical forest soil microbial communities from Panama - MetaG Plot_28 | Environmental | Open in IMG/M |
| 3300010867 | Boreal forest soil eukaryotic communities from Alaska, USA - C3-5 Metatranscriptome (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300010876 | Boreal forest soil eukaryotic communities from Alaska, USA - W5-5 Metatranscriptome (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300010880 | Boreal forest soil eukaryotic communities from Alaska, USA - C5-1 Metatranscriptome (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300012507 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.7.yng.070610 | Host-Associated | Open in IMG/M |
| 3300012683 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz2.16 metaG | Environmental | Open in IMG/M |
| 3300012955 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_216_MG | Environmental | Open in IMG/M |
| 3300012977 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Glu_20cm_5_24_1 metaG | Environmental | Open in IMG/M |
| 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Host-Associated | Open in IMG/M |
| 3300016294 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178 | Environmental | Open in IMG/M |
| 3300016387 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176 | Environmental | Open in IMG/M |
| 3300016404 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082 | Environmental | Open in IMG/M |
| 3300016422 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111 | Environmental | Open in IMG/M |
| 3300017821 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW-S_2 | Environmental | Open in IMG/M |
| 3300017823 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_3 | Environmental | Open in IMG/M |
| 3300017928 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW_1 | Environmental | Open in IMG/M |
| 3300017942 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW_3 | Environmental | Open in IMG/M |
| 3300017955 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_2 | Environmental | Open in IMG/M |
| 3300017959 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP10_10_MG | Environmental | Open in IMG/M |
| 3300017975 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0715_SJ02_MP15_20_MG | Environmental | Open in IMG/M |
| 3300017993 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SourceSoil_3 | Environmental | Open in IMG/M |
| 3300018044 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_21_10 | Environmental | Open in IMG/M |
| 3300018062 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_SJ02_MP15_20_MG | Environmental | Open in IMG/M |
| 3300018085 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP15_20_MG | Environmental | Open in IMG/M |
| 3300020579 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-M | Environmental | Open in IMG/M |
| 3300021180 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-O | Environmental | Open in IMG/M |
| 3300021181 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-O | Environmental | Open in IMG/M |
| 3300021401 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-O | Environmental | Open in IMG/M |
| 3300021479 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-4-M | Environmental | Open in IMG/M |
| 3300024186 | Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK29 | Environmental | Open in IMG/M |
| 3300024288 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_08_16fungal | Environmental | Open in IMG/M |
| 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300027696 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_b_LC metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027783 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP14_OM2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027889 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 6 (SPAdes) | Environmental | Open in IMG/M |
| 3300028773 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_N3_2 | Environmental | Open in IMG/M |
| 3300028877 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_N3_3 | Environmental | Open in IMG/M |
| 3300028879 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_N1_3 | Environmental | Open in IMG/M |
| 3300028906 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5 (v2) | Environmental | Open in IMG/M |
| 3300031199 | Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 7_S | Environmental | Open in IMG/M |
| 3300031543 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f20 | Environmental | Open in IMG/M |
| 3300031545 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.166b4f26 | Environmental | Open in IMG/M |
| 3300031546 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.166b4f23 | Environmental | Open in IMG/M |
| 3300031564 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f21 | Environmental | Open in IMG/M |
| 3300031572 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f19 | Environmental | Open in IMG/M |
| 3300031668 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.168b4f23 | Environmental | Open in IMG/M |
| 3300031680 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f22 | Environmental | Open in IMG/M |
| 3300031681 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f20 | Environmental | Open in IMG/M |
| 3300031682 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f22 | Environmental | Open in IMG/M |
| 3300031713 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.109b1f22 | Environmental | Open in IMG/M |
| 3300031748 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.108b1f22 | Environmental | Open in IMG/M |
| 3300031764 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.117b4f27 | Environmental | Open in IMG/M |
| 3300031778 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.109b1f24 | Environmental | Open in IMG/M |
| 3300031781 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f20 | Environmental | Open in IMG/M |
| 3300031797 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f23 | Environmental | Open in IMG/M |
| 3300031894 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f18 | Environmental | Open in IMG/M |
| 3300031941 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.OX080 | Environmental | Open in IMG/M |
| 3300031981 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f25 | Environmental | Open in IMG/M |
| 3300032009 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.066b5f19 | Environmental | Open in IMG/M |
| 3300032035 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.HF170 | Environmental | Open in IMG/M |
| 3300032060 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f18 | Environmental | Open in IMG/M |
| 3300032064 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.171b2f17 | Environmental | Open in IMG/M |
| 3300032067 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f22 | Environmental | Open in IMG/M |
| 3300032068 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f21 | Environmental | Open in IMG/M |
| 3300032076 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111 (v2) | Environmental | Open in IMG/M |
| 3300032090 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f22 | Environmental | Open in IMG/M |
| 3300032180 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515 | Environmental | Open in IMG/M |
| 3300032805 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.2 | Environmental | Open in IMG/M |
| 3300032829 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_1.3 | Environmental | Open in IMG/M |
| 3300033134 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.2 | Environmental | Open in IMG/M |
| 3300033158 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.1 | Environmental | Open in IMG/M |
| 3300033289 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.AN108 | Environmental | Open in IMG/M |
| 3300033290 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f15 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| deeps_02278410 | 2199352024 | Soil | SGLLQELAAEVAGWPDAPSQAETAAMLEPVGRNFIPDRYR |
| JGI12269J14319_101429912 | 3300001356 | Peatlands Soil | LLQELAAEVAGWPDAPSAADAAAMLRPAGNEPGNEPGNEPGNEQGENFIPAGYR* |
| Ga0062389_1014402252 | 3300004092 | Bog Forest Soil | RADRAGDRLLRELADEVASRPDAPTDADAAAMLAPVGEAFIPAGYR* |
| Ga0066676_110331731 | 3300005186 | Soil | RVGSGLLQDLAAEVAGWPDAPSEAEIAAMFRPVGRNFIPDRYR* |
| Ga0070660_1003626492 | 3300005339 | Corn Rhizosphere | AGLLQDLAAEVAGWPDAPSQAETAAMLEPVGRNFIPDRYR* |
| Ga0070709_102857152 | 3300005434 | Corn, Switchgrass And Miscanthus Rhizosphere | SGLLQELAAEVASWPDAPSPAETAAMLEPVGRNFIPDRYR* |
| Ga0070733_109836871 | 3300005541 | Surface Soil | SLLQELAREVASWPDAPDEADAAAMLRPVGQNFIPAGYR* |
| Ga0070696_1002235891 | 3300005546 | Corn, Switchgrass And Miscanthus Rhizosphere | GSSLLQELAAEVVGWPDAPSEAETAAMLRPVGRNFIPDRYR* |
| Ga0070664_1016856961 | 3300005564 | Corn Rhizosphere | LAGLAAEVAGWPDAPSEAETEAMLRPVSRNFIPNGYR* |
| Ga0066702_108073202 | 3300005575 | Soil | LLQELAAEVASWPDAPSEAEIAAMLRPVGRNFIPDRYR* |
| Ga0070762_112490941 | 3300005602 | Soil | SGHALLAELALEVAGWPDAPSAADATAMLAPVGESFIPAGYR* |
| Ga0079220_115251091 | 3300006806 | Agricultural Soil | RADTALLQELAAEVAGWPDTPSEAEIGVMLRPVGRSFVPGRYR* |
| Ga0066793_105933121 | 3300009029 | Prmafrost Soil | LQELAVEVTGWPDAPSATDAAAMLTPVAANFIPAGYR* |
| Ga0105243_102841931 | 3300009148 | Miscanthus Rhizosphere | DSGLLQELAAEVASWPDAPSPAETAAMLEPVGRNFIPDRYR* |
| Ga0075423_106585862 | 3300009162 | Populus Rhizosphere | LRELAAEVASWPDAPSQAETAAMLGPVGRNFIPDRYR* |
| Ga0116224_103792831 | 3300009683 | Peatlands Soil | LAAEVAGWPDAPSAADAAAMLRPAGNEPGNEPGNEPGNEQGENFIPAGYR* |
| Ga0116216_100773474 | 3300009698 | Peatlands Soil | RHDRVRPGLLQELAAEVAGWPDAPSDADAAAMLQPVGPNFIPARYR* |
| Ga0126318_105711981 | 3300010152 | Soil | QELAAEVASWPDAPSPAETAAMLEPAGRNFIPDRYR* |
| Ga0134111_105675311 | 3300010329 | Grasslands Soil | RADSGLLQELAADVAGWPDAPSQAETAAMLEPVGRNFIPDRYR* |
| Ga0126381_1050385362 | 3300010376 | Tropical Forest Soil | ELAAEVAAWPDAPSEAEIAAMLRPVGRNFVPDRYR* |
| Ga0126347_15798422 | 3300010867 | Boreal Forest Soil | GDGLLATLAPEVASWPDAPTPAEVGAMLRPVSRNFIPNEYADEPA* |
| Ga0126361_108514192 | 3300010876 | Boreal Forest Soil | RDDRAGTALLQELAIEVAGWPDAPSAADADAMLKPVATNFIPAGYR* |
| Ga0126350_107006001 | 3300010880 | Boreal Forest Soil | LQELALEVAGWPDAPSAADADAMLKPVAANFIPAGYR* |
| Ga0126350_116734721 | 3300010880 | Boreal Forest Soil | DRLSDALLTELAGEVTSWPDAPSAADASAMLTPVSENFIPAGYR* |
| Ga0157342_10123971 | 3300012507 | Arabidopsis Rhizosphere | TDSGLLQELAAEVASWPDAPSEAETAAMLEPVGRNFIPDRYR* |
| Ga0137398_105788461 | 3300012683 | Vadose Zone Soil | LLQELAAEVAGWPDAPSEAETAAMLRPVGRNFIPDRYR* |
| Ga0164298_103268692 | 3300012955 | Soil | DRAGSGLLQELAAEVASWPDAPSPAETAAMLEPVGRHFIPDRSR* |
| Ga0134087_106553782 | 3300012977 | Grasslands Soil | TDSGLLQELAAEVAGWPDAPSQAETAAMLEPVGRNLIPDRYR* |
| Ga0157374_111192011 | 3300013296 | Miscanthus Rhizosphere | RAESGLLQELAAEVASWPDAPSPAETAAMLEPVGRNFIPDRYR* |
| Ga0182041_122464711 | 3300016294 | Soil | ELAAEVAGWPDAPSEAEIGAMLKPVGRSFVPPGYR |
| Ga0182040_115642571 | 3300016387 | Soil | ELAAEVASWPDAPSETETAAMLRPVGRNFIPPGYR |
| Ga0182037_109255921 | 3300016404 | Soil | QVASWPDAPSAADAAAMLAPTGNEQGANFIPAGYQ |
| Ga0182039_101561483 | 3300016422 | Soil | ADRADCLLLQDLAAEVASWPDAPSAADAAAMLAPTGNEQGGNFIPAGYR |
| Ga0187812_11618302 | 3300017821 | Freshwater Sediment | VDRVGTGLLQELAAEVAGWPDAPSDADAAAMLRPVGRNFIPAGYQ |
| Ga0187812_11850322 | 3300017821 | Freshwater Sediment | QELAAEVAGWPDAPSAADAAAMLRPAGGNFIPTGYR |
| Ga0187818_101926323 | 3300017823 | Freshwater Sediment | CRLLQELAAEVAGWPDAPSAADAAAMLRPAGNEQGGNFIPAGYR |
| Ga0187806_10400481 | 3300017928 | Freshwater Sediment | GWPDAPSAADAAAMLRPAGNEPGNEPGNEPGNEQGENFIPAGYR |
| Ga0187808_100634571 | 3300017942 | Freshwater Sediment | DLAADVARWPDAPSAVDVAAMFRPVGENFVPAGYR |
| Ga0187817_101644272 | 3300017955 | Freshwater Sediment | RLLQELAAEVTGWPDAPSAADAAAMLRPAGNEPGNEPGNEPGNEQGENFIPAGYR |
| Ga0187779_112027861 | 3300017959 | Tropical Peatland | LLQELAAEVAAWPDAPSAAEAAAMLRPVGRNFVPNEYR |
| Ga0187782_102518162 | 3300017975 | Tropical Peatland | GQGLLAELAREVASWPDAPSEAEAAAMLRPVGDSFVPAGYR |
| Ga0187782_108066121 | 3300017975 | Tropical Peatland | DLAAEVASWPDAPSAADVAAMLRPVGENFIPAGYR |
| Ga0187823_100765811 | 3300017993 | Freshwater Sediment | GLAAEVAGWPDAPSAAETEAMLRPVSRNFIPNGYADEPS |
| Ga0187890_101132432 | 3300018044 | Peatland | GHPLLTELALEVSGWPDAPSAADAVAMLAPVAENFIPAGYR |
| Ga0187784_109658112 | 3300018062 | Tropical Peatland | RELAREVAGWPDAPSAADAAAMLRPVGRNFVPAGYR |
| Ga0187772_106508732 | 3300018085 | Tropical Peatland | EDRAGCGLLQALAAEVAGWPDAPSAAGIAAMLAPAGDERGETFIPAGFR |
| Ga0210407_114237072 | 3300020579 | Soil | GSALLQELAAEVAGWPDAPSEAEIAGMFRPVGRNFIPDRYR |
| Ga0210396_109572792 | 3300021180 | Soil | VGDGLLQELAAEVAGWPDAPSDADAAAMLRPVGQNFIPAGYR |
| Ga0210388_107863312 | 3300021181 | Soil | RVGGRLLQDLAAEVSGWPDAPTDADAAAMLRPVGDSFVPSGYRS |
| Ga0210393_108964252 | 3300021401 | Soil | AGDRLLQDLAAEVASWPDAPSDADAAAMLHPVGENFVPVRYR |
| Ga0210410_115209531 | 3300021479 | Soil | ELAAEVASWPDAPSEAEIAAMLRPVGRNFIPPGYR |
| Ga0247688_10632331 | 3300024186 | Soil | QELAAEVASWPDAPSPAETAAMLEPVGRNFIPDRYR |
| Ga0179589_101328472 | 3300024288 | Vadose Zone Soil | DRTDSGLLQDLAAEVAGWPDAPSQAETAAMLEPVGRNFIPDRYR |
| Ga0207684_109628291 | 3300025910 | Corn, Switchgrass And Miscanthus Rhizosphere | SGLLQELAAEVAGWPDAPSEAEIAAMFRPVGRNFIPGRYR |
| Ga0207659_114796571 | 3300025926 | Miscanthus Rhizosphere | GLLQELAAEVASWPDAPSPAETAAMLEPVGRNFIPDRYR |
| Ga0207665_104087502 | 3300025939 | Corn, Switchgrass And Miscanthus Rhizosphere | KDSALLQELAAEVASWPDAPTEPDAMLRPVGRNFIPDAYR |
| Ga0207679_102826861 | 3300025945 | Corn Rhizosphere | RDDRAGSGLLQELAAEVASWPDAPSPAETAAMLEPVGRNFIPDRYR |
| Ga0208696_10945052 | 3300027696 | Peatlands Soil | QELAAEVAGWPDAPSAADAAAMLRPAGNEPGNEPGNEPGNEQGENFIPAGYR |
| Ga0209448_100774681 | 3300027783 | Bog Forest Soil | RLLQELAGEVASWPDAPTAADTAAMLRPAGNEPGNEPGNEQRESFIPAGYR |
| Ga0209380_104019852 | 3300027889 | Soil | ELAAEVAGWPDAPSDADAAAMLRPVGQNFIPAGYR |
| Ga0302234_103021142 | 3300028773 | Palsa | PLLTELALEVDAWPDAPSAADAVAMLAPVGENFIPAGYR |
| Ga0302235_103969941 | 3300028877 | Palsa | LLTELALEVAGWPDAPSAADAVAMLAPVGGNFIPAGYR |
| Ga0302229_100259305 | 3300028879 | Palsa | RVDRAGDALLTELAGEVTGWPDAPSAADACAMLTPVSENFIPAGYR |
| Ga0308309_107423832 | 3300028906 | Soil | AFLQELAAEVAGWPDAPSEAEIAAMLRPVGRNFIPDRYR |
| Ga0307495_102385811 | 3300031199 | Soil | DSGLLQELAAEVAGWPDAPSQAETAAMLEPVGRNFIPDRYR |
| Ga0318516_100697483 | 3300031543 | Soil | GGGLLTELAAEVASWPDAPSGSEVAAMFRPVGGSFVPPGYR |
| Ga0318541_103517112 | 3300031545 | Soil | GLLTELAAEVASWPDAPSGSEVAAMFRPVGGSFVPPGYR |
| Ga0318538_103321411 | 3300031546 | Soil | AGGRLLQDLAAEVGSWPDAPSAADAAAMLAPVGETFIPAGYR |
| Ga0318573_101685921 | 3300031564 | Soil | TGGGLLTELAAEVASWPDAPSGSEVAAMFRPVGGSFVPPGYR |
| Ga0318515_102433841 | 3300031572 | Soil | LQELAAEVAGWPDAPTDADAAAMLAPAGNGQGENFIPAGYR |
| Ga0318542_101788132 | 3300031668 | Soil | VQELAAEVTSWPDAPSEAQAAAMLRPVGQNFIPNGYR |
| Ga0318574_101041491 | 3300031680 | Soil | TELAAEVASWPDAPSGSEVAAMFRPVGGSFVPPGYR |
| Ga0318572_101204911 | 3300031681 | Soil | GCHLLRDLAAEVAGWPDAPSAADAAAMLAPLGENFIPAGYR |
| Ga0318560_103392291 | 3300031682 | Soil | LLQDLAAEVASWPDAPSAADAAAMLAPTGYEQGRNFIPAGYR |
| Ga0318496_100400263 | 3300031713 | Soil | ELAAEVAGWPDAPTDADAAAMLAPAGNGQGENFIPAGYR |
| Ga0318492_100662121 | 3300031748 | Soil | GGLLTELAAEVASWPDAPSGSEVAAMFRPVGGSFVPPGYR |
| Ga0318492_102706611 | 3300031748 | Soil | RSSRRADTGLLQELAAEVAGWPDAPSEAEIAAMLRPVGRNFIPDRYR |
| Ga0318535_100249553 | 3300031764 | Soil | DRTGCLLLQDLAVQVASWPDAPSAADAAAMLAPTGNEQGANFIPAGYQ |
| Ga0318498_103338161 | 3300031778 | Soil | DDRAGCRLLQNLAAEVAGWPDAPSAADAAAMLAPAGENFIPAGYR |
| Ga0318547_106646961 | 3300031781 | Soil | RLLQELAAEVAGWPDAPTDADAAAMLAPAGNGQGENFIPAGYR |
| Ga0318550_101327851 | 3300031797 | Soil | DRTGGGLLTELAAEVASWPDAPSGSEVAAMFRPVGGSFVPPGYR |
| Ga0318522_102067541 | 3300031894 | Soil | GRGLLTELAAEVAGWPDAPSDSETASMLRPVGANFIPLEYR |
| Ga0310912_108052722 | 3300031941 | Soil | GCLLLQDLAVQVASWPDAPSAADAAAMLAPTGNEPGNEQGANFIPAGYQ |
| Ga0318531_101790781 | 3300031981 | Soil | LQDLAVQVASWPDAPSAADAAAMLAPTGNEPGNEQGANFIPAGYQ |
| Ga0318563_102588211 | 3300032009 | Soil | GTTLLQELAAEVASWPDAPSETETAAMLRPVGRNFIPPGYR |
| Ga0318563_102704932 | 3300032009 | Soil | DRTGRGLLTELAAEVAGWPDAPSDSETASMLRPVGANFIPLEYR |
| Ga0310911_108989092 | 3300032035 | Soil | DRAGTTLLQELAAEVASWPDAPSETETAAMLRPVGRNFIPPGYR |
| Ga0310911_109323771 | 3300032035 | Soil | RAGCRLLRDLAAEVAGWPDAPSAADAAAMLAPIGENFIPAGYR |
| Ga0318505_105960601 | 3300032060 | Soil | LLTELAAEVAGWPDAPSDSETASMLRPVGANFIPLEYR |
| Ga0318510_102340912 | 3300032064 | Soil | LQELAAEVAGWPDAPSEAEIAAMLRPVGRNFIPDRYR |
| Ga0318524_106741111 | 3300032067 | Soil | TELAAEVASWPDAPSEEDIAAMLQPVGENFIPHGYR |
| Ga0318553_104105342 | 3300032068 | Soil | AHRLLQELAAEVAGWPDAPTDADAAAMLAPAGNGQGENFIPAGYR |
| Ga0306924_100483966 | 3300032076 | Soil | WPDAPSAADAAAMLAPTGNEPGNEQGANFIPAGYQ |
| Ga0318518_103945212 | 3300032090 | Soil | LRDLAAEVAGWPDAPSAADAAAMLAPLGENFIPAGYR |
| Ga0307471_1026946362 | 3300032180 | Hardwood Forest Soil | RDDRTDSGLLQELAAEVASWPDAPSQAETAAMLEPVGRNFIPDRYR |
| Ga0335078_120599202 | 3300032805 | Soil | GSRLLQDLAAEVASWPDAPTDADAAAMLQRVGENFIPAGYR |
| Ga0335070_103068191 | 3300032829 | Soil | TALLRELAAEVASWPDTPSEAETEAMLRPVGRNFIPDRYR |
| Ga0335073_118527481 | 3300033134 | Soil | LLQELAAEVASWPDAPSPAETAAMLEPVGRNFIPDRYR |
| Ga0335077_112809011 | 3300033158 | Soil | LQELAAEVAGWPDAPSEAEIGAMLRPVGRSFVPPGYR |
| Ga0310914_113910792 | 3300033289 | Soil | ADRTGGGLLTELAAEVASWPDAPSGSEVAAMFRPVGGSFVPPGYR |
| Ga0310914_118965892 | 3300033289 | Soil | DTALLQELAAEVAGWPDTPSEAEIGAMLRPVGRSFVPPGYR |
| Ga0318519_103760462 | 3300033290 | Soil | RVPRGPTLLQELAAEVAGWPDAPSEAEIGAMLKPVGRSFVPPGYR |
| ⦗Top⦘ |