NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F100609

Metagenome / Metatranscriptome Family F100609

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F100609
Family Type Metagenome / Metatranscriptome
Number of Sequences 102
Average Sequence Length 53 residues
Representative Sequence MVEYALLLASTSFGGLAGEFGAWASHVNWHALGYGLFALVALRIAFWAFRSSDY
Number of Associated Samples 90
Number of Associated Scaffolds 102

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 81.37 %
% of genes near scaffold ends (potentially truncated) 17.65 %
% of genes from short scaffolds (< 2000 bps) 89.22 %
Associated GOLD sequencing projects 83
AlphaFold2 3D model prediction Yes
3D model pTM-score0.44

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (99.020 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil
(11.765 % of family members)
Environment Ontology (ENVO) Unclassified
(22.549 % of family members)
Earth Microbiome Project Ontology (EMPO) Host-associated → Plant → Plant rhizosphere
(34.314 % of family members)


 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      

 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Transmembrane (alpha-helical) Signal Peptide: No Secondary Structure distribution: α-helix: 60.98%    β-sheet: 0.00%    Coil/Unstructured: 39.02%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  		pTM-score: 0.44
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.

 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 102 Family Scaffolds
PF01074Glyco_hydro_38N 48.04
PF13378MR_MLE_C 35.29
PF09261Alpha-mann_mid 4.90
PF00701DHDPS 0.98
PF00528BPD_transp_1 0.98

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 102 Family Scaffolds
COG0383Alpha-mannosidaseCarbohydrate transport and metabolism [G] 52.94
COG03294-hydroxy-tetrahydrodipicolinate synthase/N-acetylneuraminate lyaseCell wall/membrane/envelope biogenesis [M] 1.96

 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms100.00 %
UnclassifiedrootN/A0.00 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
3300000891|JGI10214J12806_11068810All Organisms → cellular organisms → Bacteria1896Open in IMG/M
3300003267|soilL1_10094537All Organisms → cellular organisms → Bacteria2013Open in IMG/M
3300003987|Ga0055471_10255008All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium557Open in IMG/M
3300003990|Ga0055455_10042784All Organisms → cellular organisms → Bacteria1217Open in IMG/M
3300004463|Ga0063356_104612431All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium592Open in IMG/M
3300004479|Ga0062595_101938024All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes566Open in IMG/M
3300004778|Ga0062383_10385820All Organisms → cellular organisms → Bacteria687Open in IMG/M
3300004780|Ga0062378_10150121All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes616Open in IMG/M
3300005178|Ga0066688_10161019All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → unclassified Gemmatimonadales → Gemmatimonadales bacterium1410Open in IMG/M
3300005186|Ga0066676_10769467All Organisms → cellular organisms → Bacteria654Open in IMG/M
3300005336|Ga0070680_100769040All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes829Open in IMG/M
3300005347|Ga0070668_101529763All Organisms → cellular organisms → Bacteria610Open in IMG/M
3300005445|Ga0070708_100225790All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → unclassified Gemmatimonadales → Gemmatimonadales bacterium1757Open in IMG/M
3300005455|Ga0070663_100653860All Organisms → cellular organisms → Bacteria889Open in IMG/M
3300005467|Ga0070706_100857738All Organisms → cellular organisms → Bacteria840Open in IMG/M
3300005471|Ga0070698_101258249All Organisms → cellular organisms → Bacteria690Open in IMG/M
3300005536|Ga0070697_100757431All Organisms → cellular organisms → Bacteria858Open in IMG/M
3300005536|Ga0070697_101765079All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes553Open in IMG/M
3300005536|Ga0070697_101957761All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes524Open in IMG/M
3300005546|Ga0070696_100040508All Organisms → cellular organisms → Bacteria3217Open in IMG/M
3300005546|Ga0070696_100612435All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes879Open in IMG/M
3300005558|Ga0066698_10428838All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → unclassified Gemmatimonadales → Gemmatimonadales bacterium905Open in IMG/M
3300005559|Ga0066700_10410046All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → unclassified Gemmatimonadales → Gemmatimonadales bacterium955Open in IMG/M
3300005568|Ga0066703_10525224All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes699Open in IMG/M
3300005598|Ga0066706_11219806All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium571Open in IMG/M
3300005843|Ga0068860_101525152All Organisms → cellular organisms → Bacteria690Open in IMG/M
3300005874|Ga0075288_1013544All Organisms → cellular organisms → Bacteria1106Open in IMG/M
3300005889|Ga0075290_1045806All Organisms → cellular organisms → Bacteria594Open in IMG/M
3300006844|Ga0075428_101460762All Organisms → cellular organisms → Bacteria717Open in IMG/M
3300006846|Ga0075430_100497395All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes1006Open in IMG/M
3300006846|Ga0075430_100592939All Organisms → cellular organisms → Bacteria914Open in IMG/M
3300009012|Ga0066710_104001281All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes551Open in IMG/M
3300009087|Ga0105107_10984799All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium587Open in IMG/M
3300009098|Ga0105245_11944641All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes641Open in IMG/M
3300009789|Ga0126307_11508694All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes545Open in IMG/M
3300009840|Ga0126313_10567691All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes912Open in IMG/M
3300010040|Ga0126308_10756399All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium671Open in IMG/M
3300010041|Ga0126312_10879646All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium652Open in IMG/M
3300010042|Ga0126314_10887286All Organisms → cellular organisms → Archaea659Open in IMG/M
3300010044|Ga0126310_11318300All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes585Open in IMG/M
3300010045|Ga0126311_10630981All Organisms → cellular organisms → Bacteria851Open in IMG/M
3300010166|Ga0126306_10704576All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium810Open in IMG/M
3300010166|Ga0126306_10750818All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes785Open in IMG/M
3300010371|Ga0134125_10282213All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes1845Open in IMG/M
3300010371|Ga0134125_12773510All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium533Open in IMG/M
3300010396|Ga0134126_10162218All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes2701Open in IMG/M
3300012929|Ga0137404_10382373All Organisms → cellular organisms → Bacteria1238Open in IMG/M
3300012929|Ga0137404_12164785All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium520Open in IMG/M
3300012930|Ga0137407_10069938All Organisms → cellular organisms → Bacteria2920Open in IMG/M
3300012931|Ga0153915_11238409All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes872Open in IMG/M
3300015264|Ga0137403_10336484All Organisms → cellular organisms → Bacteria1399Open in IMG/M
3300015264|Ga0137403_10733235All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes847Open in IMG/M
3300015371|Ga0132258_10731806All Organisms → cellular organisms → Bacteria2491Open in IMG/M
3300018028|Ga0184608_10054353All Organisms → cellular organisms → Bacteria1585Open in IMG/M
3300018051|Ga0184620_10196216All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium669Open in IMG/M
3300018059|Ga0184615_10190664All Organisms → cellular organisms → Bacteria1154Open in IMG/M
3300018071|Ga0184618_10109273All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → unclassified Gemmatimonadales → Gemmatimonadales bacterium1094Open in IMG/M
3300018076|Ga0184609_10355972All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes683Open in IMG/M
3300018429|Ga0190272_10766545All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → unclassified Gemmatimonadales → Gemmatimonadales bacterium881Open in IMG/M
3300018466|Ga0190268_11079338All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium650Open in IMG/M
3300018476|Ga0190274_12443716All Organisms → cellular organisms → Bacteria620Open in IMG/M
3300019377|Ga0190264_11317216All Organisms → cellular organisms → Bacteria611Open in IMG/M
3300020059|Ga0193745_1122350All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes540Open in IMG/M
3300020082|Ga0206353_11465999All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes686Open in IMG/M
3300021078|Ga0210381_10262905All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes616Open in IMG/M
3300021080|Ga0210382_10002284All Organisms → cellular organisms → Bacteria6286Open in IMG/M
3300022694|Ga0222623_10222988All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium730Open in IMG/M
3300022756|Ga0222622_10317707All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes1077Open in IMG/M
3300025325|Ga0209341_10443852All Organisms → cellular organisms → Bacteria1044Open in IMG/M
3300025552|Ga0210142_1006385All Organisms → cellular organisms → Bacteria2140Open in IMG/M
3300025910|Ga0207684_10721765All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes846Open in IMG/M
3300025912|Ga0207707_10815295All Organisms → cellular organisms → Bacteria777Open in IMG/M
3300025922|Ga0207646_10160083All Organisms → cellular organisms → Bacteria2031Open in IMG/M
3300025922|Ga0207646_10398208All Organisms → cellular organisms → Bacteria1244Open in IMG/M
3300026003|Ga0208284_1015996All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes609Open in IMG/M
3300026041|Ga0207639_10807391All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → unclassified Gemmatimonadales → Gemmatimonadales bacterium874Open in IMG/M
3300026067|Ga0207678_11984337All Organisms → cellular organisms → Bacteria507Open in IMG/M
3300026497|Ga0257164_1059209All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium625Open in IMG/M
3300027716|Ga0209682_10016883All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → unclassified Gemmatimonadales → Gemmatimonadales bacterium1763Open in IMG/M
3300027735|Ga0209261_10011058All Organisms → cellular organisms → Bacteria2282Open in IMG/M
3300027840|Ga0209683_10400385All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium631Open in IMG/M
3300028381|Ga0268264_11056886All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → unclassified Gemmatimonadales → Gemmatimonadales bacterium819Open in IMG/M
3300028587|Ga0247828_10704178All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium629Open in IMG/M
3300028608|Ga0247819_10581183All Organisms → cellular organisms → Bacteria672Open in IMG/M
3300028710|Ga0307322_10186934All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes562Open in IMG/M
3300028716|Ga0307311_10093555All Organisms → cellular organisms → Bacteria835Open in IMG/M
3300028718|Ga0307307_10100012All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes884Open in IMG/M
3300028803|Ga0307281_10174861All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes763Open in IMG/M
3300028881|Ga0307277_10223852All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes828Open in IMG/M
3300030336|Ga0247826_10637458All Organisms → cellular organisms → Bacteria821Open in IMG/M
3300031548|Ga0307408_100823376All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes844Open in IMG/M
3300031548|Ga0307408_102419024All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium510Open in IMG/M
3300031824|Ga0307413_10403726All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → unclassified Gemmatimonadales → Gemmatimonadales bacterium1071Open in IMG/M
3300031901|Ga0307406_10592512All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes913Open in IMG/M
3300031901|Ga0307406_10777600All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes806Open in IMG/M
3300031938|Ga0308175_100208686All Organisms → cellular organisms → Bacteria1929Open in IMG/M
3300031944|Ga0310884_10881575All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes551Open in IMG/M
3300031965|Ga0326597_10004617All Organisms → cellular organisms → Bacteria19319Open in IMG/M
3300031965|Ga0326597_10300179All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes1827Open in IMG/M
3300032017|Ga0310899_10265180All Organisms → cellular organisms → Bacteria785Open in IMG/M
3300033480|Ga0316620_12057367All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium568Open in IMG/M
3300033513|Ga0316628_100172353All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes2564Open in IMG/M


 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil11.76%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere10.78%
Serpentine SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Serpentine Soil8.82%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Soil6.86%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural → Soil5.88%
Wetland SedimentEnvironmental → Aquatic → Freshwater → Wetlands → Unclassified → Wetland Sediment4.90%
Groundwater SedimentEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment4.90%
Vadose Zone SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil4.90%
RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere4.90%
Natural And Restored WetlandsEnvironmental → Aquatic → Marine → Wetlands → Unclassified → Natural And Restored Wetlands2.94%
Terrestrial SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil2.94%
Rice Paddy SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Rice Paddy Soil2.94%
Populus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere2.94%
Groundwater SedimentEnvironmental → Aquatic → Freshwater → Sediment → Unclassified → Groundwater Sediment1.96%
Groundwater SedimentEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment1.96%
SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Soil1.96%
Corn RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere1.96%
Switchgrass RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere1.96%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere1.96%
Freshwater SedimentEnvironmental → Aquatic → Freshwater → Sediment → Unclassified → Freshwater Sediment0.98%
Freshwater WetlandsEnvironmental → Aquatic → Freshwater → Wetlands → Unclassified → Freshwater Wetlands0.98%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Corn, Switchgrass And Miscanthus Rhizosphere0.98%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil0.98%
Sugarcane Root And Bulk SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Sugarcane Root And Bulk Soil0.98%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil0.98%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil0.98%
SoilEnvironmental → Terrestrial → Soil → Loam → Unclassified → Soil0.98%
Arabidopsis RhizosphereHost-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere0.98%
Corn RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere0.98%
Arabidopsis Thaliana RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Thaliana Rhizosphere0.98%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere0.98%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere0.98%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
3300000891Soil microbial communities from Great Prairies - Wisconsin, Continuous corn soilEnvironmentalOpen in IMG/M
3300003267Sugarcane bulk soil Sample L1EnvironmentalOpen in IMG/M
3300003987Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberryNW_TuleB_D2EnvironmentalOpen in IMG/M
3300003990Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - Goodyear_PhragC_D2EnvironmentalOpen in IMG/M
3300004463Combined assembly of Arabidopsis thaliana microbial communitiesHost-AssociatedOpen in IMG/M
3300004479Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of All WPAsEnvironmentalOpen in IMG/M
3300004778Wetland sediment microbial communities from St. Louis River estuary, USA, under dissolved organic matter induced mercury methylation - T4Bare3FreshEnvironmentalOpen in IMG/M
3300004780Wetland sediment microbial communities from St. Louis River estuary, USA, under dissolved organic matter induced mercury methylation - T0Bare1FreshEnvironmentalOpen in IMG/M
3300005178Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_137EnvironmentalOpen in IMG/M
3300005186Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_125EnvironmentalOpen in IMG/M
3300005336Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaGEnvironmentalOpen in IMG/M
3300005347Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaGHost-AssociatedOpen in IMG/M
3300005445Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaGEnvironmentalOpen in IMG/M
3300005455Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaGHost-AssociatedOpen in IMG/M
3300005467Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaGEnvironmentalOpen in IMG/M
3300005471Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaGEnvironmentalOpen in IMG/M
3300005536Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaGEnvironmentalOpen in IMG/M
3300005546Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaGEnvironmentalOpen in IMG/M
3300005558Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_147EnvironmentalOpen in IMG/M
3300005559Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_149EnvironmentalOpen in IMG/M
3300005568Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_152EnvironmentalOpen in IMG/M
3300005598Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_155EnvironmentalOpen in IMG/M
3300005843Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2Host-AssociatedOpen in IMG/M
3300005874Rice paddy soil microbial communities from Twitchell Island, California, USA - SF_Rice_20C_0N_404EnvironmentalOpen in IMG/M
3300005889Rice paddy soil microbial communities from Twitchell Island, California, USA - SF_Rice_20C_80N_201EnvironmentalOpen in IMG/M
3300006844Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2Host-AssociatedOpen in IMG/M
3300006846Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4Host-AssociatedOpen in IMG/M
3300009012Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_159EnvironmentalOpen in IMG/M
3300009087Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P8 Core (1) Depth 19-21cm September2015EnvironmentalOpen in IMG/M
3300009098Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaGHost-AssociatedOpen in IMG/M
3300009789Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot28EnvironmentalOpen in IMG/M
3300009840Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot105AEnvironmentalOpen in IMG/M
3300010040Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot55EnvironmentalOpen in IMG/M
3300010041Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot104AEnvironmentalOpen in IMG/M
3300010042Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot105BEnvironmentalOpen in IMG/M
3300010044Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot60EnvironmentalOpen in IMG/M
3300010045Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot61EnvironmentalOpen in IMG/M
3300010166Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot27EnvironmentalOpen in IMG/M
3300010371Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-1EnvironmentalOpen in IMG/M
3300010396Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-2EnvironmentalOpen in IMG/M
3300012929Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Illumina Assembly)EnvironmentalOpen in IMG/M
3300012930Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_2_16fungal (Illumina Assembly)EnvironmentalOpen in IMG/M
3300012931Freshwater wetland microbial communities from Ohio, USA - Open water 3 Core 3 Depth 3 metaGEnvironmentalOpen in IMG/M
3300015264Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Hybrid Assembly)EnvironmentalOpen in IMG/M
3300015371Combined assembly of cpr5 and col0 rhizosphere and soilHost-AssociatedOpen in IMG/M
3300018028Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_30_coexEnvironmentalOpen in IMG/M
3300018051Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_5_b1EnvironmentalOpen in IMG/M
3300018059Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM4_65_coexEnvironmentalOpen in IMG/M
3300018071Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_30_b1EnvironmentalOpen in IMG/M
3300018076Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_60_coexEnvironmentalOpen in IMG/M
3300018429Populus adjacent soil microbial communities from riparian zone of Shoshone River, Wyoming, USA - 504 TEnvironmentalOpen in IMG/M
3300018466Populus adjacent soil microbial communities from riparian zone of Blue River, Arizona, USA - 249 TEnvironmentalOpen in IMG/M
3300018476Populus adjacent soil microbial communities from riparian zone of Yellowstone River, Montana, USA - 531 TEnvironmentalOpen in IMG/M
3300019377Populus adjacent soil microbial communities from riparian zone of Indian Creek, Utah, USA - 112 TEnvironmentalOpen in IMG/M
3300020059Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L1a2EnvironmentalOpen in IMG/M
3300020082Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2)EnvironmentalOpen in IMG/M
3300021078Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_5_coex redoEnvironmentalOpen in IMG/M
3300021080Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_60_coex redoEnvironmentalOpen in IMG/M
3300022694Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM2_30_coexEnvironmentalOpen in IMG/M
3300022756Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM2_5_b1EnvironmentalOpen in IMG/M
3300025325Soil microbial communities from Rifle, Colorado - Rifle CSP2_sed 13_2 (SPAdes)EnvironmentalOpen in IMG/M
3300025552Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - Goodyear_PhragC_D2 (SPAdes)EnvironmentalOpen in IMG/M
3300025910Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025912Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025922Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300026003Rice paddy soil microbial communities from Twitchell Island, California, USA - SF_Rice_20C_80N_201 (SPAdes)EnvironmentalOpen in IMG/M
3300026041Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026067Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300026497Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - CO-08-BEnvironmentalOpen in IMG/M
3300027716Wetland sediment microbial communities from St. Louis River estuary, USA, under dissolved organic matter induced mercury methylation - T0Bare2Fresh (SPAdes)EnvironmentalOpen in IMG/M
3300027735Wetland sediment microbial communities from St. Louis River estuary, USA, under dissolved organic matter induced mercury methylation - T0Bare1Fresh (SPAdes)EnvironmentalOpen in IMG/M
3300027840Wetland sediment microbial communities from St. Louis River estuary, USA, under dissolved organic matter induced mercury methylation - T4Bare2Fresh (SPAdes)EnvironmentalOpen in IMG/M
3300028381Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300028587Soil microbial communities from agricultural site in Penn Yan, New York, United States - 12C_Control_Day3EnvironmentalOpen in IMG/M
3300028608Soil microbial communities from agricultural site in Penn Yan, New York, United States - 13C_Xylose_Day6EnvironmentalOpen in IMG/M
3300028710Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_380EnvironmentalOpen in IMG/M
3300028716Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_198EnvironmentalOpen in IMG/M
3300028718Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_194EnvironmentalOpen in IMG/M
3300028803Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_120EnvironmentalOpen in IMG/M
3300028881Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_116EnvironmentalOpen in IMG/M
3300030336Soil microbial communities from agricultural site in Penn Yan, New York, United States - 12C_Control_Day1EnvironmentalOpen in IMG/M
3300031548Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3Host-AssociatedOpen in IMG/M
3300031824Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2Host-AssociatedOpen in IMG/M
3300031901Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2Host-AssociatedOpen in IMG/M
3300031938Soil microbial communities from UC Gill Tract Community Farm, Albany, California, United States - DLSLS.C.R1EnvironmentalOpen in IMG/M
3300031944Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T60D1EnvironmentalOpen in IMG/M
3300031965Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT100D185EnvironmentalOpen in IMG/M
3300032017Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C8D4EnvironmentalOpen in IMG/M
3300033480Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_M1_C1_D5_BEnvironmentalOpen in IMG/M
3300033513Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_M2_C1_D5_CEnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap


 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
JGI10214J12806_1106881023300000891SoilMVEYALLLASTSFQGLAGELAIWSSQVNWNVLGYLALALLALRIAFWAFRSSDY*
soilL1_1009453723300003267Sugarcane Root And Bulk SoilMVEYALLLASTSLRTFALDVGDWASRLNWHALAYALFGLVSLRIAFWAFRSSDH*
Ga0055471_1025500823300003987Natural And Restored WetlandsMVEYALLLASSSFRTLAADVGAWAERLNWQALGYALFALVALRIAFWAFRSSDY*
Ga0055455_1004278423300003990Natural And Restored WetlandsMVEYALLLASTSFGGLAGEFGVWASKVNWHALGYALLALVALRIAFWAFRSSEY*
Ga0063356_10461243123300004463Arabidopsis Thaliana RhizosphereMVEYALLLASTSFQGLAGELALWSSQVNWNVLGYLALALVALRIAFWAFRSSDY*
Ga0062595_10193802423300004479SoilMVEYALLLASTSFGGLAAKFGVWASDVNWHALGYALLALVALRIAFWAFRSSEY*
Ga0062383_1038582023300004778Wetland SedimentMVEYALLLASTSFGGLAGAATAWASHINWHALGYALFGLVALRIAFWAFRSSEY*
Ga0062378_1015012123300004780Wetland SedimentEYALLLANLAGTSFRSFAAEVASWASGLNWHALSYGLLGLVAFRIAFWAFRPRDH*
Ga0066688_1016101913300005178SoilMVEYALLLASTSFRGLAGDVADWASHVNWHALSYGLLALVALRIAFWAFRTSDY*
Ga0066676_1076946723300005186SoilMVEYALLLASTSFRGLAGDVADWASHVNWHALSYGLLALVALRIAFWASRTSDY*
Ga0070680_10076904023300005336Corn RhizosphereMVEYALLLASTSFGSLAAKFAVWASDVNWHALGYALLALVALRIAFWAFRSSEY*
Ga0070668_10152976323300005347Switchgrass RhizosphereMVEYALLLASTSVGGFAGAFQAWASNLNWHALGYGLFALVALRIAFWAFRSSEY*
Ga0070708_10022579013300005445Corn, Switchgrass And Miscanthus RhizosphereMVEYALLLASTSFGGLAGELEVWASNLNWHALGYALLALVALRIAFWAFRSSEY*
Ga0070663_10065386023300005455Corn RhizosphereMVEYALLLASTSFQGLAGELAIWSSQVNWNVLGYLALALVALRIAFWAFRSSDY*
Ga0070706_10085773823300005467Corn, Switchgrass And Miscanthus RhizosphereMVEYALLLASTSFGGLAGELGVWASNLNWHALGYALLALVALRIAFWAFRSSEY*
Ga0070698_10125824923300005471Corn, Switchgrass And Miscanthus RhizosphereMVEYALLLASTSVGGFAGAFGAWASNLNWHALGYGLFALVALRIAFWAFRSSEY*
Ga0070697_10075743123300005536Corn, Switchgrass And Miscanthus RhizosphereMVEYALLLASTSVRSFAAEAEAWASSLDWHVLIYALFGLIALRIIWAFRPSDR*
Ga0070697_10176507913300005536Corn, Switchgrass And Miscanthus RhizosphereMVEYALLLASTSFGGLAERFGVWAADVNWHALGYALLALVALRIAFWAFRSSEY*
Ga0070697_10195776113300005536Corn, Switchgrass And Miscanthus RhizosphereMVEYALLLASTSFGDLAARFGVWASDVNWHALGYALLALVALRIAFWAFRSSEY*
Ga0070696_10004050823300005546Corn, Switchgrass And Miscanthus RhizosphereMVEYALLLASTSIRSFAVEVGAWASSLNWHALSYGLLALVALRIAFWAFRPSDR*
Ga0070696_10061243523300005546Corn, Switchgrass And Miscanthus RhizosphereVEYALLLASTSVRSFAAEAEAWASSLDWHVLIYALFGLIALRIIWAFRPSDR*
Ga0066698_1042883813300005558SoilMVEYALLLASTSFRGLAGEVADWASHVNWHALSYGLLALVALRIAFWAFRTSDY*
Ga0066700_1041004613300005559SoilMVEYALLLASTSFRGLAGDVADWASHVNWHALSYGLL
Ga0066703_1052522423300005568SoilTMVEYALLLASTSFRGLAGDVADWASHVNWHALSYGLLALVALRIAFWAFRTSDY*
Ga0066706_1121980613300005598SoilYIRSTMVEYALLLASTSFRGLAGDVADWASHVNWHALSYGLLALVALRIAFWAFRTSDY*
Ga0068860_10152515223300005843Switchgrass RhizosphereMVEYALLLASTSVGGFAGAFEAWASNLNWHALGYGLFALVALRIAFWAFRSSEY*
Ga0075288_101354423300005874Rice Paddy SoilMVEYALLLASTSFRGVAGDIGAWAAGLNWHALGYGLLALVALRIAFWAFRTSDY*
Ga0075290_104580623300005889Rice Paddy SoilMVEYALLLASTSFRGIAGDIGAWAAGLNWHALGYGLLALVALRIAFWAFRTSDY*
Ga0075428_10146076223300006844Populus RhizosphereMVEYALLLASTSIRGFAGEIGAWASTVNWRALGYVLLALVALRIAFWAFHRSEY*
Ga0075430_10049739513300006846Populus RhizosphereMVEYALLLASTSIRGFAGEIGAWASTVNWRALGYVLLALVSLRIAFWAFHRSEY*
Ga0075430_10059293923300006846Populus RhizosphereMVEYALLLASTSIRSFAGEAGAWASTIDWHAVGYALLALVGLWIAVRAFRRSEY*
Ga0066710_10400128123300009012Grasslands SoilMVEYALLLASTSFRGLAGDVADWASHVNWHALSYGLLAL
Ga0105107_1098479923300009087Freshwater SedimentMVEYALLLASTSFGGIAGAASAWASHINWHALGYALFGLVALRIAFWAFRSSEY*
Ga0105245_1194464113300009098Miscanthus RhizosphereMVEYALLLASTSVGGFAGAFQAWASNLNWHALGYGLFALVALRIA
Ga0126307_1150869423300009789Serpentine SoilMVEYALLLASTSFQGLAGELAVWSSQVNWSVLGYLALALVALRVAFWAFRSSDY*
Ga0126313_1056769123300009840Serpentine SoilMVEYALLLASTSFQGLAGELATWSSQVNWNVLGYLALALVALRIAFWAFHSSDY*
Ga0126308_1075639923300010040Serpentine SoilMVEYALLLASTSFRGLAGDVGVWASGLNWHALGYALFALVALRIAFWAFRSSEH*
Ga0126312_1087964623300010041Serpentine SoilMVEYALLLASTSVGGFAGAFEAWASSLNWHALAYGLFALVALRIAFWAFRSSEY*
Ga0126314_1088728623300010042Serpentine SoilMVEYALLLASTSFRGLAGEVDVWAARINWHALGYGLIALVVLRIVVRVFRASDT*
Ga0126310_1131830023300010044Serpentine SoilMVEYALLLASTSFGGLAGEFGAWASHVNWHALGYGLFALVALRIAFWAFRSSDY*
Ga0126311_1063098123300010045Serpentine SoilMVEYALLLASTSFGGLAGDVEAWAAHVNWHALGYALFALVALRIAFWAFSSSDY*
Ga0126306_1070457623300010166Serpentine SoilMVEYALLLASTSFRGFAGEFGVWADRLNWHALGYALFALVALRIAFWAFRSSEY*
Ga0126306_1075081823300010166Serpentine SoilMVEYALLLASTSFGGLAGEFGAWAAHVNWHALGYGLFALVALRIAFWAFRSSDY*
Ga0134125_1028221313300010371Terrestrial SoilMVEYALLLASTSIRGFAGEIGAWASTVNWPALGYVLLALVVLRIAVRLFRRSEY*
Ga0134125_1277351013300010371Terrestrial SoilHMVEYALILGNLAGTSFRTVAADVGAWASGIGWDVLSYGLLALVALRIAFWAFGPSDS*
Ga0134126_1016221833300010396Terrestrial SoilMVEYAALLAGIAGASLRTYADQVGIWASAINWRALTYALLGLVALRIAFWAFRPSSR*
Ga0137404_1038237323300012929Vadose Zone SoilMVEYALLLASTSLGGLAGEFGAWASNLNWHALGYGLLALVALRIAFWAFRSSEY*
Ga0137404_1216478523300012929Vadose Zone SoilMVEYALLLASTSVRSFAVEADAWASSLDWHVLIYGLFGLIALRIIWAFRPSDR*
Ga0137407_1006993823300012930Vadose Zone SoilMVEYALLLASTSFRGLAGDVADWASHVNWHALSYGLLSLVALRIAFWAFRTSDY*
Ga0153915_1123840923300012931Freshwater WetlandsMVEYAILLATTSFRGFAREIADWASGLNWNVLGYGLLALVALRIAYWAFRTSD*
Ga0137403_1033648423300015264Vadose Zone SoilMVEYALLLASTSFRGLAGDVADWASHVNWHALSYGLLALVALRIAFWAFRSSEY*
Ga0137403_1073323523300015264Vadose Zone SoilMVEYALLLASTSVRSFAVEAEAWASSLDWHVLIYGLFGLIALRIIWAFRPSDR*
Ga0132258_1073180633300015371Arabidopsis RhizosphereMVEYALLLASTSIRGFAGEIGAWAATVNWHALGYVLLALGALRIAFWAVHRSEY*
Ga0184608_1005435323300018028Groundwater SedimentMVEYALLLASTSFGGLAAKFGVWASDVNWHALGYALLALVALRIAFWAFRSSEY
Ga0184620_1019621623300018051Groundwater SedimentMVEYALLLASTSFGGLAARFGVWASDVNWHALGYALLALVALRIAFWAFRSSEY
Ga0184615_1019066423300018059Groundwater SedimentMVEYALLLASTSFGGLAGAFGAWASNLNWHALGYGLFALVALRIAFWAFRSSDY
Ga0184618_1010927313300018071Groundwater SedimentMVEYALLLASTSVGGFAGAFGAWASNLNWHALGYGLFAL
Ga0184609_1035597213300018076Groundwater SedimentMVEYALLLASTSFGGLAAKSGVWASDVNWHALGYALLALVALRIAFWAFRSSEY
Ga0190272_1076654513300018429SoilMVEYALLLASTSFGGLAAKFGVWASDVNWHALGYALLALVALRIAFW
Ga0190268_1107933823300018466SoilMVEYALLLASTSVRGLAGEFGAWASHLNWDALGYALLALVALRIAFWAFRSSEY
Ga0190274_1244371623300018476SoilMVEYALLLASTSIRSFAGEAGAWASTIDWHAVGYALLALVGLWIAVRAFRRSEY
Ga0190264_1131721623300019377SoilMVEYALLLASTSFGGLAAKFEVWASDVNWHALGYALLALVALRIAFWAFRSSEY
Ga0193745_112235023300020059SoilMVEYALLLASTSLGGLAGQVGAWASNLNWHALGYGLFALVALRIAFWAFRSSEY
Ga0206353_1146599913300020082Corn, Switchgrass And Miscanthus RhizosphereMVEYALLLASTSFRTFATDAETWAAGLNWHALGYALFALVALRIAFWAFRTSDY
Ga0210381_1026290523300021078Groundwater SedimentMVEYALLLASTSIRSFAGEVGAWASTIDWHALGYVLLALVGLWIAVRAFRRSEY
Ga0210382_1000228423300021080Groundwater SedimentMVEYALLLASTSFGGLAGEFEVWASDVNWHALGYALLALVALRIAFWAFRSSEY
Ga0222623_1022298823300022694Groundwater SedimentMVEYALLLATTSFRGLAGEFGAWASHLNWDALGYALFALVALRIAFWAFRSSEY
Ga0222622_1031770723300022756Groundwater SedimentMVEYALLLASTSVGGFAGAFGAWASNLNWHALGYGLFALVALRIAFWAFRSSEY
Ga0209341_1044385223300025325SoilMVEYALLLANLAGTSFRSFAAEVVAWASGLNWHALGYGLLGLVALRIAFWAFRPSDH
Ga0210142_100638523300025552Natural And Restored WetlandsMVEYALLLASTSFGGLAGEFGVWASKVNWHALGYALLALVALRIAFWAFRSSEY
Ga0207684_1072176523300025910Corn, Switchgrass And Miscanthus RhizosphereMVEYALLLASTSFGGLAGELGVWASNLNWHALGYALLALVALRIAFWAFRSSEY
Ga0207707_1081529523300025912Corn RhizosphereMVEYALLLASTSFGSLAAKFAVWASDVNWHALGYALLALVALRIAFWAFRSSEY
Ga0207646_1016008333300025922Corn, Switchgrass And Miscanthus RhizosphereMVEYALLLASTSFGGLAGELEVWASNLNWHALGYALLALVALRI
Ga0207646_1039820823300025922Corn, Switchgrass And Miscanthus RhizosphereMVEYALLLASTSFGGLAAKVGVWASDVNWHALGYALLALVALRIAFWAFRSSEY
Ga0208284_101599623300026003Rice Paddy SoilMVEYALLLASTSFRGIAGDIGAWAAGLNWHALGYGLLALVALRIAFWAFRTSDY
Ga0207639_1080739123300026041Corn RhizosphereMVEYALLLASTSFGSLAAKFAVWASDVNWHALGYALLALVAL
Ga0207678_1198433723300026067Corn RhizosphereDEGQFLASTSFQGLAGELAIWSSQVNWNVLGYLALALVALRIAFWAFRSSDY
Ga0257164_105920923300026497SoilMVEYALLLASTSLGGLAGEFGAWASNLNWHALGYGLLALVALRIAFWAFRSSEY
Ga0209682_1001688333300027716Wetland SedimentMVEYALLLANLAGTSFRSFAAEVASWASGLNWHALSYGLLGLVAFRIAFWAFRPRDH
Ga0209261_1001105823300027735Wetland SedimentMVEYALLLANLAGTSFRSFAADVTAWASDLNWQALSYGLLGLVAFRIAFWAFRPRDH
Ga0209683_1040038523300027840Wetland SedimentMVEYALLLASTSFGGLAGAATAWASHINWHALGYALFGLVALRIAFWAFRSSEY
Ga0268264_1105688623300028381Switchgrass RhizosphereMVEYALLLASTSVGGFAGAFEAWASNLNWHALGYGLFALVA
Ga0247828_1070417823300028587SoilMVEYALILASTSFRGLAGDLDAWAANVNWHALGYGVLALVALRIAFWAFRSSDY
Ga0247819_1058118323300028608SoilMVEYALILASTSFRGLAGDLDAWAANVNWHALGYGVLALVALRIAFWAFRSSEY
Ga0307322_1018693423300028710SoilMVEYALLLASTSFGGLAARFGVWASDVNWHALGYALLALVALRIAFWAFHSSEY
Ga0307311_1009355523300028716SoilMVEYALLLASTSVGSFAGAFGAWASNLNWHALGYGLFALVALRIAFWAFRSSEY
Ga0307307_1010001223300028718SoilMVEYALLLASTSFGALAARFGVWASDVNWHALGYALLALVALRIAFWAFHSSEY
Ga0307281_1017486123300028803SoilMVEYALLLASTSLGGLAGELGAWASSLNWHALGYGLFALVALRIAFLAFRSSEY
Ga0307277_1022385213300028881SoilMVEYALLLASTSFGGLAAKFGVWASDLNWHALGYALLALVALRIAFWAFRSSEY
Ga0247826_1063745823300030336SoilMVEYALLLASTSVGGFAGAFEAWASNLNWHALGYGLFALVALRIAFWAFRSSEY
Ga0307408_10082337623300031548RhizosphereLLASTSFRDLAGDVGAWAAGLNWHALGYGLLALVTLRIAFWAFRTSDY
Ga0307408_10241902423300031548RhizosphereMVEYALLLSSTSFRTFAADVGAWAAGLNWHALGYALFALVALRIAFWAFRTSDY
Ga0307413_1040372623300031824RhizosphereMVEYALLLASTSFQGLAGELATWSSQVNWNVLGYLALALVALRIAFWAFHSSDY
Ga0307406_1059251223300031901RhizosphereMVEYALLLASTSFRGLAGDVGVWASGLNWHALGYALFALVALRIAFWAFRSSEH
Ga0307406_1077760013300031901RhizosphereMVEYALLLASTSFRDLAGDVGAWAAGLNWHALGYGLLALVTLRIAFWAFRTSDY
Ga0308175_10020868623300031938SoilMVEYALLLASTSFRTFATDAETWAAGVNWHALGYALFALVALRIAFWAFRTSDY
Ga0310884_1088157523300031944SoilMVEYALILASTSFRGLAGDLDAWAANVNWHALGYGVLALVALRIAFWA
Ga0326597_1000461743300031965SoilMVEYALLLASTSFRTFVVNAGAWAAGLNWRYIGYALLGLAAFLFARWAFRSPH
Ga0326597_1030017923300031965SoilMVEYALLLANSAGTSVRAFAAEVTAWASGLNWHALSYGLLALVALRIAFWAFRPSDR
Ga0310899_1026518023300032017SoilMVEYALLLASTSFRGLAGDINAWAAHVNWHALGYALFALVALRIAFWAFRSSDY
Ga0316620_1205736713300033480SoilMVEYAILLATTSFRGFAREIADWASGLNWDVLGYGLLALVALRIAYWAFRTSD
Ga0316628_10017235313300033513SoilNDMVEYAILLATTSFRGFAREIADWASGLNWNVLGYGLLALVALRIAYWAFRTSD

 ⦗Top⦘


Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.