| Basic Information | |
|---|---|
| Family ID | F100608 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 102 |
| Average Sequence Length | 46 residues |
| Representative Sequence | LVLHRHRRDAFPSTGCPHLAQTVVSVIGDGGRRRRLRLPGRGRRSPA |
| Number of Associated Samples | 70 |
| Number of Associated Scaffolds | 102 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 0.00 % |
| % of genes near scaffold ends (potentially truncated) | 100.00 % |
| % of genes from short scaffolds (< 2000 bps) | 93.14 % |
| Associated GOLD sequencing projects | 68 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.14 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (93.137 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Serpentine Soil (31.372 % of family members) |
| Environment Ontology (ENVO) | Unclassified (34.314 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (46.078 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 4.00% β-sheet: 0.00% Coil/Unstructured: 96.00% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.14 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 102 Family Scaffolds |
|---|---|---|
| PF03779 | SPW | 2.94 |
| PF00211 | Guanylate_cyc | 2.94 |
| PF13460 | NAD_binding_10 | 2.94 |
| PF00484 | Pro_CA | 2.94 |
| PF01872 | RibD_C | 2.94 |
| PF07883 | Cupin_2 | 2.94 |
| PF00903 | Glyoxalase | 2.94 |
| PF06772 | LtrA | 1.96 |
| PF04545 | Sigma70_r4 | 1.96 |
| PF00291 | PALP | 1.96 |
| PF13649 | Methyltransf_25 | 1.96 |
| PF03706 | LPG_synthase_TM | 1.96 |
| PF08240 | ADH_N | 1.96 |
| PF00440 | TetR_N | 1.96 |
| PF01551 | Peptidase_M23 | 0.98 |
| PF12857 | TOBE_3 | 0.98 |
| PF13463 | HTH_27 | 0.98 |
| PF00532 | Peripla_BP_1 | 0.98 |
| PF12681 | Glyoxalase_2 | 0.98 |
| PF12697 | Abhydrolase_6 | 0.98 |
| PF07690 | MFS_1 | 0.98 |
| PF03537 | Glyco_hydro_114 | 0.98 |
| PF13669 | Glyoxalase_4 | 0.98 |
| PF06803 | DUF1232 | 0.98 |
| PF00312 | Ribosomal_S15 | 0.98 |
| PF03061 | 4HBT | 0.98 |
| PF00717 | Peptidase_S24 | 0.98 |
| PF00528 | BPD_transp_1 | 0.98 |
| PF08327 | AHSA1 | 0.98 |
| PF11253 | DUF3052 | 0.98 |
| PF00583 | Acetyltransf_1 | 0.98 |
| PF12344 | UvrB | 0.98 |
| PF14572 | Pribosyl_synth | 0.98 |
| PF06224 | HTH_42 | 0.98 |
| PF03309 | Pan_kinase | 0.98 |
| PF13418 | Kelch_4 | 0.98 |
| PF13527 | Acetyltransf_9 | 0.98 |
| PF03950 | tRNA-synt_1c_C | 0.98 |
| PF02604 | PhdYeFM_antitox | 0.98 |
| PF00072 | Response_reg | 0.98 |
| COG ID | Name | Functional Category | % Frequency in 102 Family Scaffolds |
|---|---|---|---|
| COG0262 | Dihydrofolate reductase | Coenzyme transport and metabolism [H] | 2.94 |
| COG0288 | Carbonic anhydrase | Inorganic ion transport and metabolism [P] | 2.94 |
| COG1985 | Pyrimidine reductase, riboflavin biosynthesis | Coenzyme transport and metabolism [H] | 2.94 |
| COG2114 | Adenylate cyclase, class 3 | Signal transduction mechanisms [T] | 2.94 |
| COG0392 | Predicted membrane flippase AglD2/YbhN, UPF0104 family | Cell wall/membrane/envelope biogenesis [M] | 1.96 |
| COG4292 | Low temperature requirement protein LtrA (function unknown) | Function unknown [S] | 1.96 |
| COG0008 | Glutamyl- or glutaminyl-tRNA synthetase | Translation, ribosomal structure and biogenesis [J] | 0.98 |
| COG0184 | Ribosomal protein S15P/S13E | Translation, ribosomal structure and biogenesis [J] | 0.98 |
| COG1521 | Pantothenate kinase type III | Coenzyme transport and metabolism [H] | 0.98 |
| COG2161 | Antitoxin component YafN of the YafNO toxin-antitoxin module, PHD/YefM family | Defense mechanisms [V] | 0.98 |
| COG2342 | Endo alpha-1,4 polygalactosaminidase, GH114 family (was erroneously annotated as Cys-tRNA synthetase) | Carbohydrate transport and metabolism [G] | 0.98 |
| COG3214 | DNA glycosylase YcaQ, repair of DNA interstrand crosslinks | Replication, recombination and repair [L] | 0.98 |
| COG3339 | Uncharacterized membrane protein YkvA, DUF1232 family | Function unknown [S] | 0.98 |
| COG3868 | Alpha-1,4 polygalactosaminidase, glycosyl hydrolase family GH114 | Carbohydrate transport and metabolism [G] | 0.98 |
| COG4118 | Antitoxin component of toxin-antitoxin stability system, DNA-binding transcriptional repressor | Defense mechanisms [V] | 0.98 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 93.14 % |
| Unclassified | root | N/A | 6.86 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300002568|C688J35102_119588667 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 726 | Open in IMG/M |
| 3300002568|C688J35102_120968987 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 3625 | Open in IMG/M |
| 3300004463|Ga0063356_104309951 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 612 | Open in IMG/M |
| 3300005181|Ga0066678_10368126 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 950 | Open in IMG/M |
| 3300005294|Ga0065705_10227344 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1289 | Open in IMG/M |
| 3300005546|Ga0070696_102008699 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 502 | Open in IMG/M |
| 3300005615|Ga0070702_100602143 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Geodermatophilales → Geodermatophilaceae → unclassified Geodermatophilaceae → Geodermatophilaceae bacterium | 824 | Open in IMG/M |
| 3300005719|Ga0068861_102162838 | All Organisms → cellular organisms → Bacteria | 557 | Open in IMG/M |
| 3300005840|Ga0068870_10094880 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1675 | Open in IMG/M |
| 3300006844|Ga0075428_101883112 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 622 | Open in IMG/M |
| 3300006845|Ga0075421_102408116 | Not Available | 551 | Open in IMG/M |
| 3300006852|Ga0075433_10790213 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 829 | Open in IMG/M |
| 3300006854|Ga0075425_101357594 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 805 | Open in IMG/M |
| 3300006894|Ga0079215_11472867 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → unclassified Solirubrobacterales → Solirubrobacterales bacterium | 535 | Open in IMG/M |
| 3300009094|Ga0111539_11947820 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 681 | Open in IMG/M |
| 3300009094|Ga0111539_13281787 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 521 | Open in IMG/M |
| 3300009100|Ga0075418_11025698 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 893 | Open in IMG/M |
| 3300009148|Ga0105243_10180115 | All Organisms → cellular organisms → Bacteria | 1837 | Open in IMG/M |
| 3300009153|Ga0105094_10672510 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia | 606 | Open in IMG/M |
| 3300009157|Ga0105092_10254086 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 988 | Open in IMG/M |
| 3300009176|Ga0105242_10811642 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → unclassified Thermoleophilia → Thermoleophilia bacterium | 927 | Open in IMG/M |
| 3300009545|Ga0105237_12684884 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 509 | Open in IMG/M |
| 3300009553|Ga0105249_13038559 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 539 | Open in IMG/M |
| 3300009553|Ga0105249_13535978 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 503 | Open in IMG/M |
| 3300009610|Ga0105340_1347142 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Acidimicrobiia → unclassified Acidimicrobiia → Acidimicrobiia bacterium | 656 | Open in IMG/M |
| 3300009789|Ga0126307_11413978 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 564 | Open in IMG/M |
| 3300009789|Ga0126307_11491891 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 548 | Open in IMG/M |
| 3300009840|Ga0126313_10304913 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1246 | Open in IMG/M |
| 3300009840|Ga0126313_11295034 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 602 | Open in IMG/M |
| 3300009840|Ga0126313_11441378 | All Organisms → cellular organisms → Bacteria | 571 | Open in IMG/M |
| 3300010036|Ga0126305_10311764 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Rubrobacteria → Rubrobacterales → Baekduiaceae → Baekduia → Baekduia soli | 1023 | Open in IMG/M |
| 3300010036|Ga0126305_10343735 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 976 | Open in IMG/M |
| 3300010036|Ga0126305_10378757 | All Organisms → cellular organisms → Bacteria | 930 | Open in IMG/M |
| 3300010036|Ga0126305_11183932 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 528 | Open in IMG/M |
| 3300010036|Ga0126305_11185450 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 527 | Open in IMG/M |
| 3300010037|Ga0126304_10028146 | All Organisms → cellular organisms → Bacteria | 3279 | Open in IMG/M |
| 3300010037|Ga0126304_10102860 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1808 | Open in IMG/M |
| 3300010037|Ga0126304_10329536 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1014 | Open in IMG/M |
| 3300010037|Ga0126304_10534949 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 788 | Open in IMG/M |
| 3300010037|Ga0126304_10895139 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 603 | Open in IMG/M |
| 3300010037|Ga0126304_11241049 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 511 | Open in IMG/M |
| 3300010038|Ga0126315_10089324 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1749 | Open in IMG/M |
| 3300010039|Ga0126309_10005578 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → unclassified Solirubrobacterales → Solirubrobacterales bacterium URHD0059 | 4882 | Open in IMG/M |
| 3300010039|Ga0126309_10756898 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 630 | Open in IMG/M |
| 3300010040|Ga0126308_10730606 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 682 | Open in IMG/M |
| 3300010040|Ga0126308_10743866 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 676 | Open in IMG/M |
| 3300010040|Ga0126308_11025923 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 579 | Open in IMG/M |
| 3300010041|Ga0126312_10226314 | All Organisms → cellular organisms → Bacteria | 1310 | Open in IMG/M |
| 3300010041|Ga0126312_10287477 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1158 | Open in IMG/M |
| 3300010041|Ga0126312_11408447 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 517 | Open in IMG/M |
| 3300010042|Ga0126314_10286718 | All Organisms → cellular organisms → Bacteria | 1173 | Open in IMG/M |
| 3300010042|Ga0126314_10902033 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 653 | Open in IMG/M |
| 3300010042|Ga0126314_11136561 | Not Available | 582 | Open in IMG/M |
| 3300010045|Ga0126311_10551472 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 908 | Open in IMG/M |
| 3300010145|Ga0126321_1021883 | All Organisms → cellular organisms → Bacteria | 730 | Open in IMG/M |
| 3300010166|Ga0126306_10072603 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 2436 | Open in IMG/M |
| 3300010166|Ga0126306_10973868 | Not Available | 690 | Open in IMG/M |
| 3300010166|Ga0126306_11752946 | Not Available | 519 | Open in IMG/M |
| 3300010396|Ga0134126_10965911 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 955 | Open in IMG/M |
| 3300012502|Ga0157347_1069870 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 517 | Open in IMG/M |
| 3300012902|Ga0157291_10073387 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 869 | Open in IMG/M |
| 3300012905|Ga0157296_10200220 | Not Available | 637 | Open in IMG/M |
| 3300012986|Ga0164304_10474010 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 908 | Open in IMG/M |
| 3300014265|Ga0075314_1162802 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 524 | Open in IMG/M |
| 3300014969|Ga0157376_10261318 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1622 | Open in IMG/M |
| 3300014969|Ga0157376_11922419 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → unclassified Thermoleophilia → Thermoleophilia bacterium | 629 | Open in IMG/M |
| 3300015258|Ga0180093_1165956 | Not Available | 561 | Open in IMG/M |
| 3300015372|Ga0132256_100602907 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 1213 | Open in IMG/M |
| 3300017792|Ga0163161_10256205 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1365 | Open in IMG/M |
| 3300018422|Ga0190265_10096079 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 2762 | Open in IMG/M |
| 3300018422|Ga0190265_10107255 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 2635 | Open in IMG/M |
| 3300018422|Ga0190265_11978270 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 688 | Open in IMG/M |
| 3300018465|Ga0190269_11812667 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 521 | Open in IMG/M |
| 3300018469|Ga0190270_10522794 | All Organisms → cellular organisms → Bacteria | 1137 | Open in IMG/M |
| 3300018469|Ga0190270_11676152 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 689 | Open in IMG/M |
| 3300018469|Ga0190270_12057207 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 630 | Open in IMG/M |
| 3300018469|Ga0190270_13291105 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 512 | Open in IMG/M |
| 3300018481|Ga0190271_11737917 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 737 | Open in IMG/M |
| 3300018481|Ga0190271_12416818 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 629 | Open in IMG/M |
| 3300018481|Ga0190271_13238636 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 546 | Open in IMG/M |
| 3300019356|Ga0173481_10067499 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1283 | Open in IMG/M |
| 3300019377|Ga0190264_10176605 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1142 | Open in IMG/M |
| 3300023102|Ga0247754_1026549 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1288 | Open in IMG/M |
| 3300025908|Ga0207643_10814904 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 605 | Open in IMG/M |
| 3300025918|Ga0207662_10238902 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1189 | Open in IMG/M |
| 3300025920|Ga0207649_11409383 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 551 | Open in IMG/M |
| 3300025928|Ga0207700_10294258 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1400 | Open in IMG/M |
| 3300025935|Ga0207709_10112980 | All Organisms → cellular organisms → Bacteria | 1820 | Open in IMG/M |
| 3300026067|Ga0207678_10135659 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2100 | Open in IMG/M |
| 3300026075|Ga0207708_10452400 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1070 | Open in IMG/M |
| 3300028592|Ga0247822_10400175 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1070 | Open in IMG/M |
| 3300028875|Ga0307289_10307270 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 652 | Open in IMG/M |
| 3300028884|Ga0307308_10473801 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 600 | Open in IMG/M |
| 3300030336|Ga0247826_10461109 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 952 | Open in IMG/M |
| 3300031229|Ga0299913_11496755 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 628 | Open in IMG/M |
| 3300031548|Ga0307408_100327801 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1292 | Open in IMG/M |
| 3300031740|Ga0307468_101073956 | All Organisms → cellular organisms → Bacteria | 715 | Open in IMG/M |
| 3300031847|Ga0310907_10803110 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 527 | Open in IMG/M |
| 3300031901|Ga0307406_10302639 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1229 | Open in IMG/M |
| 3300032002|Ga0307416_100229690 | All Organisms → cellular organisms → Bacteria | 1788 | Open in IMG/M |
| 3300032013|Ga0310906_10075583 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1765 | Open in IMG/M |
| 3300032075|Ga0310890_11295561 | Not Available | 596 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Serpentine Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Serpentine Soil | 31.37% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 17.65% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 6.86% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 4.90% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 3.92% |
| Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere | 2.94% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 2.94% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Freshwater Sediment | 1.96% |
| Soil | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Soil | 1.96% |
| Soil | Environmental → Terrestrial → Soil → Loam → Grasslands → Soil | 1.96% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 1.96% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 1.96% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 1.96% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere | 1.96% |
| Soil | Environmental → Aquatic → Freshwater → Groundwater → Unclassified → Soil | 0.98% |
| Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 0.98% |
| Switchgrass Rhizosphere | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.98% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 0.98% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 0.98% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 0.98% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 0.98% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Uranium Contaminated → Soil | 0.98% |
| Natural And Restored Wetlands | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Natural And Restored Wetlands | 0.98% |
| Switchgrass Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere | 0.98% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 0.98% |
| Arabidopsis Thaliana Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Thaliana Rhizosphere | 0.98% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 0.98% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Roots → Rhizosphere → Unclassified → Arabidopsis Rhizosphere | 0.98% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 0.98% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Arabidopsis Rhizosphere | 0.98% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300002568 | Grasslands soil microbial communities from Hopland, California, USA - 2 | Environmental | Open in IMG/M |
| 3300004463 | Combined assembly of Arabidopsis thaliana microbial communities | Host-Associated | Open in IMG/M |
| 3300005181 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_127 | Environmental | Open in IMG/M |
| 3300005294 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 Bulk Soil | Environmental | Open in IMG/M |
| 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Environmental | Open in IMG/M |
| 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Environmental | Open in IMG/M |
| 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Host-Associated | Open in IMG/M |
| 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Host-Associated | Open in IMG/M |
| 3300006844 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Host-Associated | Open in IMG/M |
| 3300006845 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD5 | Host-Associated | Open in IMG/M |
| 3300006852 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Host-Associated | Open in IMG/M |
| 3300006854 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD4 | Host-Associated | Open in IMG/M |
| 3300006894 | Agricultural soil microbial communities from Utah to study Nitrogen management - NC Control | Environmental | Open in IMG/M |
| 3300009094 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) | Host-Associated | Open in IMG/M |
| 3300009100 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD2 | Host-Associated | Open in IMG/M |
| 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Host-Associated | Open in IMG/M |
| 3300009153 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P8 Core (3) Depth 10-12cm March2015 | Environmental | Open in IMG/M |
| 3300009157 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (1) Depth 19-21cm March2015 | Environmental | Open in IMG/M |
| 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Host-Associated | Open in IMG/M |
| 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Host-Associated | Open in IMG/M |
| 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Host-Associated | Open in IMG/M |
| 3300009610 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMLT700 | Environmental | Open in IMG/M |
| 3300009789 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot28 | Environmental | Open in IMG/M |
| 3300009840 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot105A | Environmental | Open in IMG/M |
| 3300010036 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot26 | Environmental | Open in IMG/M |
| 3300010037 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot25 | Environmental | Open in IMG/M |
| 3300010038 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot106 | Environmental | Open in IMG/M |
| 3300010039 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot56 | Environmental | Open in IMG/M |
| 3300010040 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot55 | Environmental | Open in IMG/M |
| 3300010041 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot104A | Environmental | Open in IMG/M |
| 3300010042 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot105B | Environmental | Open in IMG/M |
| 3300010045 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot61 | Environmental | Open in IMG/M |
| 3300010145 | Soil microbial communities from Hawaii, USA to study soil gas exchange rates - KP-HI-INT metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300010166 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot27 | Environmental | Open in IMG/M |
| 3300010396 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-2 | Environmental | Open in IMG/M |
| 3300012502 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.2.yng.040610 | Host-Associated | Open in IMG/M |
| 3300012902 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S169-409C-1 | Environmental | Open in IMG/M |
| 3300012905 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S013-104B-2 | Environmental | Open in IMG/M |
| 3300012986 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_217_MG | Environmental | Open in IMG/M |
| 3300014265 | Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberryNE_CattailC_D2 | Environmental | Open in IMG/M |
| 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Host-Associated | Open in IMG/M |
| 3300015258 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaG ERMLIBT45_16_1Da | Environmental | Open in IMG/M |
| 3300015372 | Soil combined assembly | Host-Associated | Open in IMG/M |
| 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Host-Associated | Open in IMG/M |
| 3300018422 | Populus adjacent soil microbial communities from riparian zone of Indian Creek, Utah, USA - 124 T | Environmental | Open in IMG/M |
| 3300018465 | Populus adjacent soil microbial communities from riparian zone of Blue River, Arizona, USA - 249 IS | Environmental | Open in IMG/M |
| 3300018469 | Populus adjacent soil microbial communities from riparian zone of Weber River, Utah, USA - 320 T | Environmental | Open in IMG/M |
| 3300018481 | Populus adjacent soil microbial communities from riparian zone of Weber River, Utah, USA - 356 T | Environmental | Open in IMG/M |
| 3300019356 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S073-202C-2 (version 2) | Environmental | Open in IMG/M |
| 3300019377 | Populus adjacent soil microbial communities from riparian zone of Indian Creek, Utah, USA - 112 T | Environmental | Open in IMG/M |
| 3300023102 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-S184-509B-5 | Environmental | Open in IMG/M |
| 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300028592 | Soil microbial communities from agricultural site in Penn Yan, New York, United States - 13C_Cellulose_Day30 | Environmental | Open in IMG/M |
| 3300028875 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_143 | Environmental | Open in IMG/M |
| 3300028884 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_195 | Environmental | Open in IMG/M |
| 3300030336 | Soil microbial communities from agricultural site in Penn Yan, New York, United States - 12C_Control_Day1 | Environmental | Open in IMG/M |
| 3300031229 | Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT155D38 | Environmental | Open in IMG/M |
| 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Host-Associated | Open in IMG/M |
| 3300031740 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gases AM2C_05 | Environmental | Open in IMG/M |
| 3300031847 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C48D4 | Environmental | Open in IMG/M |
| 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Host-Associated | Open in IMG/M |
| 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Host-Associated | Open in IMG/M |
| 3300032013 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C48D3 | Environmental | Open in IMG/M |
| 3300032075 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T20D3 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| C688J35102_1195886671 | 3300002568 | Soil | HRRDAFPSTGCPHLAQTVVSVIGDGGRGPRLRLPGRGRRSPA* |
| C688J35102_1209689878 | 3300002568 | Soil | SGDAPAGDLFLMLHRHRRDGFPSTGCPHLAQTIVSVIGERGRRRRLRVPGL* |
| Ga0063356_1043099511 | 3300004463 | Arabidopsis Thaliana Rhizosphere | GDLFLVLHRHRRDAFPRVGCPHLAQTVVSVVGDGGRKRFGLR* |
| Ga0066678_103681263 | 3300005181 | Soil | VTVAFLILHRHRRDAFPSTGCPHLAQTVVSVIGDGGRSRRLRLPGREGRSPAER* |
| Ga0065705_102273443 | 3300005294 | Switchgrass Rhizosphere | DLFLVLHRHRRDAFPSTGCPHLGQTVVSVIGDGGRRRRLRLGRSAGNPDRLPTPE* |
| Ga0070696_1020086992 | 3300005546 | Corn, Switchgrass And Miscanthus Rhizosphere | LFLVLHRHRRDAFPTIGCPHLSQTVVSVIGDGGRRRLGLPGRGSRSPT* |
| Ga0070702_1006021431 | 3300005615 | Corn, Switchgrass And Miscanthus Rhizosphere | RDAFPSTGCPHLAQTVVSVIGDGGRRRRLRLPGRGRRSPA* |
| Ga0068861_1021628381 | 3300005719 | Switchgrass Rhizosphere | YEDAPAGDLFLLLHRHRRDAFPRIGCPHLAQTVVSVIGDGGRRRRLRLPGRRSRSRA* |
| Ga0068870_100948804 | 3300005840 | Miscanthus Rhizosphere | GDLFLLLHRHRRDAFPSTGCPHLGQTVVSVIGDGGRRRRLRLGRSGRNPEPAPE* |
| Ga0075428_1018831121 | 3300006844 | Populus Rhizosphere | IGCPHLAQTVVSVIGDGMRRGRLRLRGRGRRSPA* |
| Ga0075421_1024081161 | 3300006845 | Populus Rhizosphere | DAPPGDLFLVLHRHRRDAFPSTGCPHLAQTVVSVIGDGERRRRLRLPGRGGGSPASE* |
| Ga0075433_107902132 | 3300006852 | Populus Rhizosphere | LVLHRHRRDAFPSTGCPHLAQTVVSVIAVGARRHRLRWPGRAGRDHLLRE* |
| Ga0075425_1013575941 | 3300006854 | Populus Rhizosphere | HRHRRDAFPSTGCPHLAQTVVSVIGVGARRHRLRWPGRAGRDHLLRE* |
| Ga0079215_114728672 | 3300006894 | Agricultural Soil | PSTGCVHLAQTVVSVIGDGGRRGRLRLPGRGRPS* |
| Ga0111539_119478203 | 3300009094 | Populus Rhizosphere | RDAFPSTGCPHLAQTVVSVIGDGGRRRRLRLPGRGGG* |
| Ga0111539_132817872 | 3300009094 | Populus Rhizosphere | YRDAAPGDLFLILHRHRRDAFPSTGCPHLAQTVVSVIGDDEPRRRLRLPGRRP* |
| Ga0075418_110256981 | 3300009100 | Populus Rhizosphere | STGCPHLAQTVVSVIGDSARRRRLRLPGRGGRSPA* |
| Ga0105243_101801151 | 3300009148 | Miscanthus Rhizosphere | FPSIGCPHLAQTVVSVIGDSVQRRLRLPGRGRLTA* |
| Ga0105094_106725102 | 3300009153 | Freshwater Sediment | AFPSTGCPHLAQTVVSVVADGLQRRRLRMPGRGSRSPA* |
| Ga0105092_102540861 | 3300009157 | Freshwater Sediment | VLHRHRRDAFPSTGCPHLAQTVVSVIGDGGRRRRLRLPGRGGRSPA* |
| Ga0105242_108116422 | 3300009176 | Miscanthus Rhizosphere | DLFLVLHRHRRDAFPSTGCPHLAQTVVSVIGNGERRRPLRLPRRGRRSPAEP* |
| Ga0105237_126848842 | 3300009545 | Corn Rhizosphere | LYRDAPPGDLFLILHRHRRDAFPSTGCPHLAQTVVSVIGDGGRRRRLRLPGRGRRSPA* |
| Ga0105249_130385592 | 3300009553 | Switchgrass Rhizosphere | LHRHRRDAFPSTGCPHLAQTVVSVIGDGGRRRRLRLPGRGGRSPS* |
| Ga0105249_135359782 | 3300009553 | Switchgrass Rhizosphere | VLHRHRRDAYPSTGCPHLAQTVVSVIGDGGRRRLLRLPGRGSRAGA* |
| Ga0105340_13471421 | 3300009610 | Soil | RHRRDAFPSTGCPHLAQTVVSVIGDGGRRRRLRLPGGGRRSPAWP* |
| Ga0126307_114139781 | 3300009789 | Serpentine Soil | HRHRRDAFPSTGCPHLAQTVVSVIGDGGRRRRLRLPGRGRRSPA* |
| Ga0126307_114918911 | 3300009789 | Serpentine Soil | HRHRRDAFPSTGCPHLAQTVVSVIGDGGRRRRLRLPGRGRRPPA* |
| Ga0126313_103049133 | 3300009840 | Serpentine Soil | STGCPHLAQTVVSVIGDGGRRGWLRLPGRGDRSLAKR* |
| Ga0126313_112950342 | 3300009840 | Serpentine Soil | DAFPSTGCPHLAQTVVSVIGDAGRRRRLRLPGRGRRSPA* |
| Ga0126313_114413782 | 3300009840 | Serpentine Soil | TGCPHLAQTVVSVIGDGGRSRRLRLPGRGSRSAA* |
| Ga0126305_103117641 | 3300010036 | Serpentine Soil | LFLVLHRHRRDAFPSTGCPHLAQTVVSVVGDGGRRRRLRLPSRGGRSPA* |
| Ga0126305_103437353 | 3300010036 | Serpentine Soil | GDLFLVLHRHRRDAFPSTGCPHLAQTVVSVIGDDGRRRRLRLPGRGRRPPA* |
| Ga0126305_103787572 | 3300010036 | Serpentine Soil | DAFPSTGCPHLAQTVVSVIGDGGRRRRLRLPGRGRRSPA* |
| Ga0126305_111839322 | 3300010036 | Serpentine Soil | PAGDLFLVLQRHRRDAFPSTGCPHLAQTVVSVIGDNARRRRLRLPGRRDGSTA* |
| Ga0126305_111854503 | 3300010036 | Serpentine Soil | PSTGCPHLAQTVVSVIGDGGRRRRLRLPGRGRRSPA* |
| Ga0126304_100281465 | 3300010037 | Serpentine Soil | VLHRHRRDAFPSTGCPHLAQTVVSVIGDDGRRRRLRLPGRRRRSTA* |
| Ga0126304_101028603 | 3300010037 | Serpentine Soil | LHRHRRDAFPSTGCPHLAQTVVSVIGDDGRRRRLRLPGRGRRPPA* |
| Ga0126304_103295362 | 3300010037 | Serpentine Soil | DLFLVLHRHRRDAFPSTGCPHLAQTVVSVVGDGGRRRRLRLPSRGGRSPA* |
| Ga0126304_105349492 | 3300010037 | Serpentine Soil | DAFPSTGCPHLAQTVVSVIGDDGRRRRLRLPGRGRRSPA* |
| Ga0126304_108951393 | 3300010037 | Serpentine Soil | LVLHRHRRDAFPSTGCPHLAQTVVSVIGDGGRRRRLRLPGRGRRSPA* |
| Ga0126304_112410491 | 3300010037 | Serpentine Soil | LVLHRHRRDAFPSTGCPHLAQTVVSVIGDGGRRRRLRLPGRGRRPPA* |
| Ga0126315_100893245 | 3300010038 | Serpentine Soil | DLFLVLHRHRRDAFPSTGCPHLAQTVVSVIGDGGRRRRLRLPGRR* |
| Ga0126309_100055781 | 3300010039 | Serpentine Soil | LLHRHRRDAFPSTGCPHLAQTVVSVIGDDGRRRRLRLPGRGRRSPT* |
| Ga0126309_107568981 | 3300010039 | Serpentine Soil | PGDLFLVLHRHRRDAFPSTGCPHLAQTVVSVIGDGGRRRRLPFLGRRRSTA* |
| Ga0126308_107306061 | 3300010040 | Serpentine Soil | YRDAPPGDLFLVLHRHRRDAFPSTGCPHLAQTVVSVIGDGARRRRLRLPGRGGRSPA* |
| Ga0126308_107438662 | 3300010040 | Serpentine Soil | FLVLHRHRRDAFPSTGCPHLAQTVVSVIGDGGRRRRLRLPGRASRSPAQP* |
| Ga0126308_110259231 | 3300010040 | Serpentine Soil | DAFPSTGCPHLAQTVVSVIGDGGRRGWLRLPGRGDRSLAKR* |
| Ga0126312_102263143 | 3300010041 | Serpentine Soil | FPSTGCPHLAQTVVSVIGDGGRRRRPRLPGRGRGSQA* |
| Ga0126312_102874773 | 3300010041 | Serpentine Soil | FLVLHRHRRDAFPSTGCPHLAQTVVSVIGDGGRRRRLRLPGRGRRSPA* |
| Ga0126312_114084472 | 3300010041 | Serpentine Soil | DLFLVLHRNRRDAFPRIGCPHLAQTVVSVIGDGMRRRRLRLPGRLRRSSAEAQS* |
| Ga0126314_102867183 | 3300010042 | Serpentine Soil | FLVLHRHRRDAFPSTGCPHLAQTVVSVIGDGVRHRRLRLPGRGRRSPA* |
| Ga0126314_109020331 | 3300010042 | Serpentine Soil | DLFLVLHRHRRDAFPSTGCPHLAQTVVSVIGDDGRRRRLRLTGRGRRPLA* |
| Ga0126314_111365611 | 3300010042 | Serpentine Soil | STGCPHLAQTVVSVIGDGGRRRRLRLPGRRGRSPA* |
| Ga0126311_105514721 | 3300010045 | Serpentine Soil | RHRRDAFPSTGCPHLAQTVVSVIGDGEPRRRLRLPGRGGRS* |
| Ga0126321_10218831 | 3300010145 | Soil | LVLHRHRRDAFPRIGCPHLAQTVVSVVGDGGRRLRLRLPGRGGRSPA* |
| Ga0126306_100726031 | 3300010166 | Serpentine Soil | DLFLVLHRHRRDAFPSTGCPHLAQTVVSVIGDGGRRGWLRLPGRGDRSLAKR* |
| Ga0126306_109738681 | 3300010166 | Serpentine Soil | AFPSTGCPHLAQTVVSVIGDAKPRRRLRLPGRAKRSPA* |
| Ga0126306_117529461 | 3300010166 | Serpentine Soil | PSTGCPHLAQTVVSVIGDGGRRRWLRLPGRGAGSPV* |
| Ga0134126_109659112 | 3300010396 | Terrestrial Soil | DAFPSTGCPHLAQTVVSVIGEGGRRRRLRFPGHTGRSRA* |
| Ga0157347_10698702 | 3300012502 | Arabidopsis Rhizosphere | RDAPAGDLFLVLHRHRRDAFPSTGCPHLAQTVVSVIGDVGRRRRLRLRGRGSTT* |
| Ga0157291_100733871 | 3300012902 | Soil | AFPRIGCPHLAQTVVSVIGDLEKPRRLRLPGRRSPG* |
| Ga0157296_102002202 | 3300012905 | Soil | CPHLSQTVVSVIGDGGRRRRLRLPRRGGRSQAQQ* |
| Ga0164304_104740101 | 3300012986 | Soil | DLFLVLHRHRRDAFPSIGCPHLAQTVVSVIGDSGRSRLRLPGRGRLTA* |
| Ga0075314_11628022 | 3300014265 | Natural And Restored Wetlands | LDRDTPPGDLFLVLHRHRRDAFPSTGCPHLAQTVVSVIGDGGRRRRLRLPGRGRRSPA* |
| Ga0157376_102613181 | 3300014969 | Miscanthus Rhizosphere | APLGDLFLVLHRHRRNVFPSTGCTHLAQTVVSVLGDDARRNRLRLPNRRRASSTILTRQP |
| Ga0157376_119224192 | 3300014969 | Miscanthus Rhizosphere | CPHLAQTVVSVIGNGERRRPLPLPRRGRRSPAEP* |
| Ga0180093_11659562 | 3300015258 | Soil | VLHRHRRDAFPTIGCPHLSQTVVFVIGDGGRRRRLRLPGRGSRSRAQQ* |
| Ga0132256_1006029073 | 3300015372 | Arabidopsis Rhizosphere | PSTGCPHLAQTVVSVIGDVGRRRRLRLRGRGSTT* |
| Ga0163161_102562053 | 3300017792 | Switchgrass Rhizosphere | DAFPSTGCPHLAQTVVSVIGDGGRRRRLWLPGRGRRSPA |
| Ga0190265_100960794 | 3300018422 | Soil | PPGDLFLVLHRHRRDAFPSTGCPHLAQTVVSVIGDSGRRRLRLPGRAGGSPA |
| Ga0190265_101072551 | 3300018422 | Soil | GDLFLVLHRHRRDAFPKTGCLHLAQTVVSVIGDGGRRRRLRLPGRLGRSVGHPLQ |
| Ga0190265_119782701 | 3300018422 | Soil | LFLVLHRHRRDAFPSTGCPHLAQTVVSVIGDGGRHRRRRVPGRGGRSPA |
| Ga0190269_118126671 | 3300018465 | Soil | HRHRRDAFPRVGCPHLAQTVVSVIGDGGQRRRLRLPGRGRRSPA |
| Ga0190270_105227943 | 3300018469 | Soil | HRHRRDAFPSTGCPHLAQTVVSVIGDSGRRRRLRWPGRGSS |
| Ga0190270_116761521 | 3300018469 | Soil | HRRDAFPSTGCPHLAQTVVSVIGDGGRRRRLRLPGRWGRPPA |
| Ga0190270_120572071 | 3300018469 | Soil | HRHRRDAFPSTGCPHLAQTVVSVIGDSGRRRRLRLPGGGRVTFPHS |
| Ga0190270_132911052 | 3300018469 | Soil | LFLVLHRHRRDAFPSTGCPHLAQTVVSVIGESEHRRRLRLRLRAR |
| Ga0190271_117379171 | 3300018481 | Soil | FVVLHRHRRDAFPSTGCPHLAQTVVSVIGDGGRRRLRLPGRRGRSPA |
| Ga0190271_124168182 | 3300018481 | Soil | HRRDAFPSTGCPHLAQTVVSVIGDGGRRRPLRLPGRGGRSPD |
| Ga0190271_132386362 | 3300018481 | Soil | DLFLVLHRHRRDAFPSTGCPHLAQTVVSVIGDGGRRRRLRLPGRWGRPPA |
| Ga0173481_100674992 | 3300019356 | Soil | LHRHRRDAFPSIGCPHLAQTVVSVIGDSGRRRLRLPGRGRLTA |
| Ga0190264_101766053 | 3300019377 | Soil | APPGDLFLVLHRHRRDAFPSTGCPHLAQTVVSVIGDSGRRRLRLPGRAGGSPA |
| Ga0247754_10265491 | 3300023102 | Soil | LFLALHRHRRDAFPSTGCPHLAQTVVSVIGDGRRRRRLRLPARGRRSTA |
| Ga0207643_108149041 | 3300025908 | Miscanthus Rhizosphere | HRDAPAGDLFLVLHRHRRDAFPSTGCPHLAQTVVSVIGNGERRRPLRLPRRGRRSPAEP |
| Ga0207662_102389022 | 3300025918 | Switchgrass Rhizosphere | DAPPGDLFLVLHRHRRDAFPSTGCPHLAQTVVSVIGDGGQRRRLRLPGRGRRSPA |
| Ga0207649_114093832 | 3300025920 | Corn Rhizosphere | RLHRSAPSGDLFLVLHRHRRDAFPSIGCPHLAQTVVSVIGDAGRRRLRLPGRGWLSA |
| Ga0207700_102942583 | 3300025928 | Corn, Switchgrass And Miscanthus Rhizosphere | APPGDLFLILHRHRRDAFPSTGCPHLAQTVVSVIGDGGRRRRLRLPGRGRRSPA |
| Ga0207709_101129801 | 3300025935 | Miscanthus Rhizosphere | FPSIGCPHLAQTVVSVIGDSVQRRLRLPGRGRLTA |
| Ga0207678_101356591 | 3300026067 | Corn Rhizosphere | STGCLHLAQTVVSVIGDDARRPRLRLPGRGSRAPHEL |
| Ga0207708_104524001 | 3300026075 | Corn, Switchgrass And Miscanthus Rhizosphere | APPGDLFLVLHRHRRDAFPSTGCPHLAQTVVSVIGDGGQRRRLRLPGRGRQRADS |
| Ga0247822_104001751 | 3300028592 | Soil | DAFPRIGCPHLAQTVVSVIGDGGRRRRLRLPGRRSRSRA |
| Ga0307289_103072702 | 3300028875 | Soil | LVLHRHRRDAFPSTGCPHLAQTVVSVIGDGGRRRRLRLPGRGSRSPA |
| Ga0307308_104738011 | 3300028884 | Soil | RDAPPGDLFLVLHRHRRDAFPSTGCPHLAQTVVSVIGDGGRRRRLRLPGRGRRSPA |
| Ga0247826_104611091 | 3300030336 | Soil | PGDLFLILHRHRRHAFPSTGCLHLAQTVVSVIGDDARRPRLRLPGRGTRAPHEL |
| Ga0299913_114967551 | 3300031229 | Soil | LFLVLHRHRRDAFPSTGCPHLAQTVVSVIGDGARRRRLRLPGRGRPSPA |
| Ga0307408_1003278011 | 3300031548 | Rhizosphere | TGCPHLAQTVVSVIGDGGRRGWLRLPGRGDRSLAKR |
| Ga0307468_1010739561 | 3300031740 | Hardwood Forest Soil | APPGDLFLVLHRHRRDAFPSTGCPHLGQTGVSVIGDGGRRRRLRLPGRRSRSRA |
| Ga0310907_108031102 | 3300031847 | Soil | DEDVPSGDLFLVLHRHRRDAFPSTGCPHLAQTVVSVIGDGGRRRRLRFPGRRRRSTA |
| Ga0307406_103026391 | 3300031901 | Rhizosphere | PSTGCPHLAQTVVSVIGDGGRRGWLRLPGRGDRSLAKR |
| Ga0307416_1002296901 | 3300032002 | Rhizosphere | FLVLHRHRRDGFPSTGCPHLAQTVVSVIGDARPRRRLRLPGRANRSPA |
| Ga0310906_100755833 | 3300032013 | Soil | RDAFPSTGCPHLAQTVVSVIGDGGRRRRLRFPGRRRRSTA |
| Ga0310890_112955611 | 3300032075 | Soil | QHRRDAFPTLGCPHLSQTVVSVIGDSGRRRRLRWPGRGSRSQAQQ |
| ⦗Top⦘ |