NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F100542

Metagenome / Metatranscriptome Family F100542

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F100542
Family Type Metagenome / Metatranscriptome
Number of Sequences 102
Average Sequence Length 44 residues
Representative Sequence DYAFPKGTPLEGLVATFRYSWLHQDGSPQTAPQLRAYLNYDVRF
Number of Associated Samples 87
Number of Associated Scaffolds 102

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 4.90 %
% of genes near scaffold ends (potentially truncated) 95.10 %
% of genes from short scaffolds (< 2000 bps) 92.16 %
Associated GOLD sequencing projects 81
AlphaFold2 3D model prediction Yes
3D model pTM-score0.30

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (70.588 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil
(8.823 % of family members)
Environment Ontology (ENVO) Unclassified
(51.961 % of family members)
Earth Microbiome Project Ontology (EMPO) Host-associated → Plant → Plant rhizosphere
(50.000 % of family members)


 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      

 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 0.00%    β-sheet: 19.44%    Coil/Unstructured: 80.56%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  		pTM-score: 0.30
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.

 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 102 Family Scaffolds
PF05013FGase 14.71
PF067253D 7.84
PF00497SBP_bac_3 6.86
PF03372Exo_endo_phos 5.88
PF11742DUF3302 3.92
PF05433Rick_17kDa_Anti 3.92
PF00583Acetyltransf_1 2.94
PF00375SDF 2.94
PF00939Na_sulph_symp 2.94
PF01557FAA_hydrolase 1.96
PF03330DPBB_1 1.96
PF12447DUF3683 1.96
PF00561Abhydrolase_1 0.98
PF06826Asp-Al_Ex 0.98
PF01515PTA_PTB 0.98
PF01266DAO 0.98
PF01070FMN_dh 0.98
PF02530Porin_2 0.98
PF05990DUF900 0.98
PF01551Peptidase_M23 0.98
PF00230MIP 0.98
PF00892EamA 0.98
PF03449GreA_GreB_N 0.98
PF04552Sigma54_DBD 0.98
PF00072Response_reg 0.98

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 102 Family Scaffolds
COG3741N-formylglutamate amidohydrolaseAmino acid transport and metabolism [E] 14.71
COG3931Predicted N-formylglutamate amidohydrolaseAmino acid transport and metabolism [E] 14.71
COG0471Di- and tricarboxylate antiporterCarbohydrate transport and metabolism [G] 2.94
COG1055Na+/H+ antiporter NhaD or related arsenite permeaseInorganic ion transport and metabolism [P] 2.94
COG0069Glutamate synthase domain 2Amino acid transport and metabolism [E] 0.98
COG0280Phosphotransacetylase (includes Pta, EutD and phosphobutyryltransferase)Energy production and conversion [C] 0.98
COG0580Glycerol uptake facilitator or related aquaporin (Major Intrinsic protein Family)Carbohydrate transport and metabolism [G] 0.98
COG0782Transcription elongation factor, GreA/GreB familyTranscription [K] 0.98
COG1304FMN-dependent dehydrogenase, includes L-lactate dehydrogenase and type II isopentenyl diphosphate isomeraseEnergy production and conversion [C] 0.98
COG1508DNA-directed RNA polymerase specialized sigma subunit, sigma54 homologTranscription [K] 0.98
COG2985Uncharacterized membrane protein YbjL, putative transporterGeneral function prediction only [R] 0.98
COG3637Opacity protein LomR and related surface antigensCell wall/membrane/envelope biogenesis [M] 0.98
COG4782Esterase/lipase superfamily enzymeGeneral function prediction only [R] 0.98

 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms70.59 %
UnclassifiedrootN/A29.41 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
3300001213|JGIcombinedJ13530_106027454All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium517Open in IMG/M
3300004114|Ga0062593_101871341All Organisms → cellular organisms → Bacteria662Open in IMG/M
3300004643|Ga0062591_100666757All Organisms → cellular organisms → Bacteria → Proteobacteria934Open in IMG/M
3300005288|Ga0065714_10497576Not Available525Open in IMG/M
3300005333|Ga0070677_10288734Not Available829Open in IMG/M
3300005338|Ga0068868_102273856Not Available517Open in IMG/M
3300005347|Ga0070668_100359718All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria1234Open in IMG/M
3300005347|Ga0070668_100595546Not Available966Open in IMG/M
3300005356|Ga0070674_101501303All Organisms → cellular organisms → Bacteria → Proteobacteria606Open in IMG/M
3300005364|Ga0070673_100213513All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales1667Open in IMG/M
3300005365|Ga0070688_101245491All Organisms → cellular organisms → Bacteria599Open in IMG/M
3300005438|Ga0070701_10292509All Organisms → cellular organisms → Bacteria → Proteobacteria998Open in IMG/M
3300005459|Ga0068867_101700502All Organisms → cellular organisms → Bacteria → Proteobacteria592Open in IMG/M
3300005543|Ga0070672_101459273All Organisms → cellular organisms → Bacteria → Proteobacteria613Open in IMG/M
3300005553|Ga0066695_10273934All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium1066Open in IMG/M
3300005564|Ga0070664_100356216All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales1332Open in IMG/M
3300005564|Ga0070664_101506150All Organisms → cellular organisms → Bacteria637Open in IMG/M
3300005574|Ga0066694_10149344All Organisms → cellular organisms → Bacteria1108Open in IMG/M
3300005719|Ga0068861_101305201Not Available706Open in IMG/M
3300005829|Ga0074479_11121275Not Available525Open in IMG/M
3300005834|Ga0068851_10159214All Organisms → cellular organisms → Bacteria → Proteobacteria1239Open in IMG/M
3300005844|Ga0068862_100039517All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales4007Open in IMG/M
3300005844|Ga0068862_100090987All Organisms → cellular organisms → Bacteria → Proteobacteria2657Open in IMG/M
3300006871|Ga0075434_100211386All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria1960Open in IMG/M
3300006881|Ga0068865_100420539Not Available1099Open in IMG/M
3300009091|Ga0102851_11526746All Organisms → cellular organisms → Bacteria → Proteobacteria745Open in IMG/M
3300009177|Ga0105248_12829190All Organisms → cellular organisms → Bacteria → Proteobacteria553Open in IMG/M
3300009179|Ga0115028_10430373All Organisms → cellular organisms → Bacteria937Open in IMG/M
3300009527|Ga0114942_1323945All Organisms → cellular organisms → Bacteria597Open in IMG/M
3300009553|Ga0105249_10665027Not Available1100Open in IMG/M
3300010400|Ga0134122_10375710Not Available1247Open in IMG/M
3300010403|Ga0134123_13455199All Organisms → cellular organisms → Bacteria → Proteobacteria511Open in IMG/M
3300011106|Ga0151489_1664128All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales517Open in IMG/M
3300011405|Ga0137340_1052416Not Available779Open in IMG/M
3300011436|Ga0137458_1171070Not Available656Open in IMG/M
3300012212|Ga0150985_102741838All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium550Open in IMG/M
3300012893|Ga0157284_10064387All Organisms → cellular organisms → Bacteria → Proteobacteria874Open in IMG/M
3300012896|Ga0157303_10207633All Organisms → cellular organisms → Bacteria → Proteobacteria570Open in IMG/M
3300012989|Ga0164305_11617294All Organisms → cellular organisms → Bacteria → Proteobacteria579Open in IMG/M
3300013308|Ga0157375_10485103All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales1401Open in IMG/M
3300013308|Ga0157375_11127604Not Available919Open in IMG/M
3300014298|Ga0075341_1006219All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Vibrionales → Vibrionaceae → Vibrio1361Open in IMG/M
3300014326|Ga0157380_10418462All Organisms → cellular organisms → Bacteria → Proteobacteria1277Open in IMG/M
3300014326|Ga0157380_12545282All Organisms → cellular organisms → Bacteria → Proteobacteria578Open in IMG/M
3300014968|Ga0157379_11309243Not Available700Open in IMG/M
3300014968|Ga0157379_11740276Not Available611Open in IMG/M
3300014969|Ga0157376_10274872All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria1584Open in IMG/M
3300015374|Ga0132255_102567164All Organisms → cellular organisms → Bacteria778Open in IMG/M
3300018476|Ga0190274_13053044Not Available562Open in IMG/M
3300018476|Ga0190274_13161918All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria554Open in IMG/M
3300018476|Ga0190274_13467709Not Available532Open in IMG/M
3300019362|Ga0173479_10338036All Organisms → cellular organisms → Bacteria → Proteobacteria702Open in IMG/M
3300024055|Ga0247794_10203785All Organisms → cellular organisms → Bacteria639Open in IMG/M
3300025321|Ga0207656_10195002All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium ADurb.Bin100976Open in IMG/M
3300025321|Ga0207656_10495701All Organisms → cellular organisms → Bacteria620Open in IMG/M
3300025893|Ga0207682_10393270Not Available655Open in IMG/M
3300025907|Ga0207645_10733895All Organisms → cellular organisms → Bacteria → Proteobacteria671Open in IMG/M
3300025919|Ga0207657_10247972All Organisms → cellular organisms → Bacteria → Proteobacteria1420Open in IMG/M
3300025919|Ga0207657_11363710All Organisms → cellular organisms → Bacteria → Proteobacteria534Open in IMG/M
3300025934|Ga0207686_10206931All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria1408Open in IMG/M
3300025940|Ga0207691_10199243All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales1743Open in IMG/M
3300025972|Ga0207668_10478133All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria1068Open in IMG/M
3300025972|Ga0207668_12163331Not Available501Open in IMG/M
3300026035|Ga0207703_11359126Not Available683Open in IMG/M
3300026061|Ga0208541_1000286All Organisms → cellular organisms → Bacteria2796Open in IMG/M
3300026075|Ga0207708_10806690All Organisms → cellular organisms → Bacteria → Proteobacteria808Open in IMG/M
3300026088|Ga0207641_10154741All Organisms → cellular organisms → Bacteria → Proteobacteria2079Open in IMG/M
3300026089|Ga0207648_10320313Not Available1393Open in IMG/M
3300026095|Ga0207676_10137274All Organisms → cellular organisms → Bacteria → Proteobacteria2088Open in IMG/M
3300026118|Ga0207675_101393308Not Available722Open in IMG/M
3300026142|Ga0207698_10052382All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales3126Open in IMG/M
3300027902|Ga0209048_10383713All Organisms → cellular organisms → Bacteria → Proteobacteria967Open in IMG/M
3300027902|Ga0209048_10477263All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Gammaproteobacteria incertae sedis → Candidatus Competibacteraceae → Candidatus Contendobacter → Candidatus Contendobacter odensis846Open in IMG/M
3300028379|Ga0268266_10296991All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales1506Open in IMG/M
3300028608|Ga0247819_10572465All Organisms → cellular organisms → Bacteria → Proteobacteria677Open in IMG/M
3300028741|Ga0302256_10079013All Organisms → cellular organisms → Bacteria859Open in IMG/M
3300028809|Ga0247824_10634752All Organisms → cellular organisms → Bacteria → Proteobacteria645Open in IMG/M
3300029984|Ga0311332_10869602Not Available720Open in IMG/M
3300030002|Ga0311350_10630030Not Available963Open in IMG/M
3300030010|Ga0302299_10363968Not Available743Open in IMG/M
3300030114|Ga0311333_10502572Not Available993Open in IMG/M
3300030294|Ga0311349_11299624Not Available677Open in IMG/M
3300031170|Ga0307498_10475466All Organisms → cellular organisms → Bacteria506Open in IMG/M
3300031226|Ga0307497_10626582All Organisms → cellular organisms → Bacteria → Proteobacteria547Open in IMG/M
3300031707|Ga0315291_10740621All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria866Open in IMG/M
3300031720|Ga0307469_10019633All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiaceae3635Open in IMG/M
3300031720|Ga0307469_11334169Not Available682Open in IMG/M
3300031740|Ga0307468_100738443All Organisms → cellular organisms → Bacteria → Proteobacteria829Open in IMG/M
3300031918|Ga0311367_10671238All Organisms → cellular organisms → Bacteria → Proteobacteria1054Open in IMG/M
3300031918|Ga0311367_10957188All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria859Open in IMG/M
3300032143|Ga0315292_11057153All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria672Open in IMG/M
3300032164|Ga0315283_11722655Not Available633Open in IMG/M
3300032180|Ga0307471_103648325All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiaceae → Burkholderia → Burkholderia glumae545Open in IMG/M
3300032205|Ga0307472_100007106All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiaceae5333Open in IMG/M
3300032275|Ga0315270_10322539All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Comamonadaceae → Variovorax → unclassified Variovorax → Variovorax sp. URHB0020973Open in IMG/M
3300032516|Ga0315273_10910178All Organisms → cellular organisms → Bacteria1134Open in IMG/M
3300032516|Ga0315273_11942448All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria701Open in IMG/M
3300032829|Ga0335070_11851490All Organisms → cellular organisms → Bacteria545Open in IMG/M
3300032897|Ga0335071_11099908All Organisms → cellular organisms → Bacteria741Open in IMG/M
3300033414|Ga0316619_12241366Not Available500Open in IMG/M
3300033419|Ga0316601_101675403Not Available641Open in IMG/M
3300033493|Ga0316631_10438745All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium544Open in IMG/M


 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil8.82%
FenEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Fen7.84%
Switchgrass RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere6.86%
SedimentEnvironmental → Aquatic → Freshwater → Lake → Sediment → Sediment5.88%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere5.88%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere5.88%
Hardwood Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil4.90%
SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Soil4.90%
Corn RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere3.92%
Miscanthus RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere3.92%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere3.92%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere3.92%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere2.94%
Freshwater Lake SedimentEnvironmental → Aquatic → Freshwater → Lentic → Sediment → Freshwater Lake Sediment1.96%
SoilEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Soil1.96%
Terrestrial SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil1.96%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil1.96%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Soil1.96%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural → Soil1.96%
Natural And Restored WetlandsEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Natural And Restored Wetlands1.96%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere1.96%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere1.96%
WetlandEnvironmental → Aquatic → Freshwater → Sediment → Unclassified → Wetland0.98%
Freshwater WetlandsEnvironmental → Aquatic → Freshwater → Wetlands → Unclassified → Freshwater Wetlands0.98%
GroundwaterEnvironmental → Aquatic → Freshwater → Groundwater → Unclassified → Groundwater0.98%
WetlandEnvironmental → Aquatic → Marine → Wetlands → Sediment → Wetland0.98%
Sediment (Intertidal)Environmental → Aquatic → Sediment → Unclassified → Unclassified → Sediment (Intertidal)0.98%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil0.98%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil0.98%
Switchgrass RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere0.98%
Arabidopsis RhizosphereHost-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere0.98%
Miscanthus RhizosphereHost-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Miscanthus Rhizosphere0.98%
Avena Fatua RhizosphereHost-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Avena Fatua Rhizosphere0.98%
Populus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere0.98%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere0.98%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
3300001213Combined assembly of wetland microbial communities from Twitchell Island in the Sacramento Delta (Jan 2013 JGI Velvet Assembly)EnvironmentalOpen in IMG/M
3300004114Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of AARS Block 5EnvironmentalOpen in IMG/M
3300004643Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Combined assembly of AARS Block 3EnvironmentalOpen in IMG/M
3300005288Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1Host-AssociatedOpen in IMG/M
3300005333Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaGHost-AssociatedOpen in IMG/M
3300005338Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2Host-AssociatedOpen in IMG/M
3300005347Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaGHost-AssociatedOpen in IMG/M
3300005356Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaGHost-AssociatedOpen in IMG/M
3300005364Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaGHost-AssociatedOpen in IMG/M
3300005365Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaGEnvironmentalOpen in IMG/M
3300005438Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaGEnvironmentalOpen in IMG/M
3300005459Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2Host-AssociatedOpen in IMG/M
3300005543Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaGHost-AssociatedOpen in IMG/M
3300005553Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_144EnvironmentalOpen in IMG/M
3300005564Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaGHost-AssociatedOpen in IMG/M
3300005574Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_143EnvironmentalOpen in IMG/M
3300005719Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2Host-AssociatedOpen in IMG/M
3300005829Microbial communities from Cathlamet Bay sediment, Columbia River estuary, Oregon - S.190_CBCEnvironmentalOpen in IMG/M
3300005834Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2Host-AssociatedOpen in IMG/M
3300005844Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2Host-AssociatedOpen in IMG/M
3300006871Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3Host-AssociatedOpen in IMG/M
3300006881Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2Host-AssociatedOpen in IMG/M
3300009091Freshwater wetland microbial communities from Ohio, USA, analyzing the effect of biotic and abiotic controls - Mud 3 Core 4 Depth 3 metaG (Illumina Assembly)EnvironmentalOpen in IMG/M
3300009177Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaGHost-AssociatedOpen in IMG/M
3300009179Wetland microbial communities from Old Woman Creek Reserve in Ohio, USA - Plant_0915_D1EnvironmentalOpen in IMG/M
3300009527Groundwater microbial communities from Cold Creek, Nevada to study Microbial Dark Matter (Phase II) - Lower Cold CreekEnvironmentalOpen in IMG/M
3300009553Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaGHost-AssociatedOpen in IMG/M
3300010400Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-2EnvironmentalOpen in IMG/M
3300010403Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-3EnvironmentalOpen in IMG/M
3300011106Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtLMC (Metagenome Metatranscriptome) (version 2)EnvironmentalOpen in IMG/M
3300011405Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMLT400_2EnvironmentalOpen in IMG/M
3300011436Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMGT642_2EnvironmentalOpen in IMG/M
3300012212Combined assembly of Hopland grassland soilHost-AssociatedOpen in IMG/M
3300012893Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S059-202B-1EnvironmentalOpen in IMG/M
3300012896Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S118-311C-2EnvironmentalOpen in IMG/M
3300012989Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_237_MGEnvironmentalOpen in IMG/M
3300013308Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaGHost-AssociatedOpen in IMG/M
3300014298Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - RushMan_ThreeSqB_D1EnvironmentalOpen in IMG/M
3300014326Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaGHost-AssociatedOpen in IMG/M
3300014968Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaGHost-AssociatedOpen in IMG/M
3300014969Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaGHost-AssociatedOpen in IMG/M
3300015374Col-0 rhizosphere combined assemblyHost-AssociatedOpen in IMG/M
3300018476Populus adjacent soil microbial communities from riparian zone of Yellowstone River, Montana, USA - 531 TEnvironmentalOpen in IMG/M
3300019362Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S104-311B-1 (version 2)EnvironmentalOpen in IMG/M
3300024055Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-S046-202B-6EnvironmentalOpen in IMG/M
3300025321Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300025893Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025907Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025919Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025934Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025940Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025972Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300026035Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026061Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - RushSE_TuleB_D1 (SPAdes)EnvironmentalOpen in IMG/M
3300026075Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300026088Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026089Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026095Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026118Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026142Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300027902Freshwater lake sediment microbial communities from the University of Notre Dame, USA, for methane emissions studies - CRP12 CR (SPAdes)EnvironmentalOpen in IMG/M
3300028379Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300028608Soil microbial communities from agricultural site in Penn Yan, New York, United States - 13C_Xylose_Day6EnvironmentalOpen in IMG/M
3300028741Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Fen_E3_4EnvironmentalOpen in IMG/M
3300028809Soil microbial communities from agricultural site in Penn Yan, New York, United States - 13C_PalmiticAcid_Day48EnvironmentalOpen in IMG/M
3300029984I_Fen_E1 coassemblyEnvironmentalOpen in IMG/M
3300030002II_Fen_N1 coassemblyEnvironmentalOpen in IMG/M
3300030010Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Fen_N3_4EnvironmentalOpen in IMG/M
3300030114I_Fen_E2 coassemblyEnvironmentalOpen in IMG/M
3300030294II_Fen_E3 coassemblyEnvironmentalOpen in IMG/M
3300031170Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 12_SEnvironmentalOpen in IMG/M
3300031226Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 10_SEnvironmentalOpen in IMG/M
3300031707Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G12_20EnvironmentalOpen in IMG/M
3300031720Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM2C_515EnvironmentalOpen in IMG/M
3300031740Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gases AM2C_05EnvironmentalOpen in IMG/M
3300031918III_Fen_N3 coassemblyEnvironmentalOpen in IMG/M
3300032143Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G13_0EnvironmentalOpen in IMG/M
3300032164Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G09_0EnvironmentalOpen in IMG/M
3300032180Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515EnvironmentalOpen in IMG/M
3300032205Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_05EnvironmentalOpen in IMG/M
3300032275Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - C1_bottomEnvironmentalOpen in IMG/M
3300032516Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G02_0EnvironmentalOpen in IMG/M
3300032829Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_1.3EnvironmentalOpen in IMG/M
3300032897Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_1.5EnvironmentalOpen in IMG/M
3300033414Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_M1_C1_D4_BEnvironmentalOpen in IMG/M
3300033419Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_soil_day5_noCTEnvironmentalOpen in IMG/M
3300033493Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_May_M1_C1_D3_AEnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap


 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
JGIcombinedJ13530_10602745423300001213WetlandKGSLLEGLVATFRYSWLREDGAAQTGTQLRAYLNYAVRF*
Ga0062593_10187134113300004114SoilPNRSETDVRVDYAIGKGTPLEGLVATLRYSWLHQEGSPQTAPQLRAYINYAVRF*
Ga0062591_10066675723300004643SoilDRQETDLRADYAFAKGTPLAGLVGTLRGGWLHQDGSPTAFQLRIYVNYVVPF*
Ga0065714_1049757613300005288Miscanthus RhizosphereRSETDVRVDYAIGKGTPLEGLVATLRYSWLHQEGSPQTAPQLRAYINYAVRF*
Ga0070677_1028873413300005333Miscanthus RhizosphereSNGAPLPNHNETDVRGDYAFAKGTLLEGLVATFRYSWLKQDGAAQTQTDLRAILNYGVRF
Ga0068868_10227385613300005338Miscanthus RhizosphereNHNETDVRGDYAFAKGTLLEGLVATFRYSWLKQDGAAQTQTDLRAILNYGVRF*
Ga0070668_10035971813300005347Switchgrass RhizosphereDYAIGKGTPLEGLVATLRYSWLHQEGSPQTAPQLRAYINYAVRF*
Ga0070668_10059554623300005347Switchgrass RhizosphereVRGDYAFAKGTWAEGLVATFRYSWLHQDGSPQTQTDLRAILNYVVRF*
Ga0070674_10150130313300005356Miscanthus RhizosphereAFPKGTPLEGLVATFRYSWLHQDGSPQTAPQLRAYLNYDVRF*
Ga0070673_10021351313300005364Switchgrass RhizospherePKGTALEGLVATFRYSWLHQDGSPQTAPQLRAYLNYDVRF*
Ga0070688_10124549113300005365Switchgrass RhizosphereFPKGTALEGLVATARYAWLHQGGSPQTAPQLRLYINYVARF*
Ga0070701_1029250913300005438Corn, Switchgrass And Miscanthus RhizosphereADYAFAKDSALSGLVATLRGGWLHQDGSPTAFQLRIYVNYVVPS*
Ga0068867_10170050223300005459Miscanthus RhizosphereFAKGTMLEGLVATLRYSWLHQDGSPQTAPQLRAYINYDVRF*
Ga0070672_10145927313300005543Miscanthus RhizosphereLEGLVATFRYSWLHQDGSPQTAPQLRAYLNYDVRF*
Ga0066695_1027393413300005553SoilARRLVATFRYAWTHQHRAPQNGNQLRAYLNYLVRF*
Ga0070664_10035621613300005564Corn RhizospherePLEGLVATLRYSWLHQEGSPQTAPQLRAYINYAVRF*
Ga0070664_10150615013300005564Corn RhizosphereFAKDSAFKGLVATLRGAWLHQDGSPTAFQLRIILNYAVPF*
Ga0066694_1014934413300005574SoilRRLVATFRYAWTHQDGAPQNRNQLRAYLNYVVRF*
Ga0068861_10130520113300005719Switchgrass RhizosphereYAFPKGTPLEGLVATFRYSWLHQDGSPQTAPQLRAYLNYDVRF*
Ga0074479_1112127523300005829Sediment (Intertidal)KGSLLEGLSATVRYSWLHQDGALQTGTQLRAYLNYGVRF*
Ga0068851_1015921413300005834Corn RhizosphereRVDYAIGKGTPLEGLVATLRYSWLHQEGSPQTAPQLRAYINYAVRF*
Ga0068862_10003951773300005844Switchgrass RhizosphereADYAFAKDSALSGLVATLRGGWLHQDGSPTAFQLRVYVNYSVPF*
Ga0068862_10009098733300005844Switchgrass RhizosphereRADYAFAKGTWAEGFVATFRYSWLHQDGSPQTQTDLRAILNYVVRF*
Ga0075434_10021138623300006871Populus RhizosphereVRADYALAKGTLLEGLVALRYSWLRQDGAAQTQTDFRAILNYLVRF*
Ga0068865_10042053923300006881Miscanthus RhizosphereDLRADYAFAKGTWAEGFVATFRYSWLHQDGSPQTQTDLRAILNYVVRF*
Ga0102851_1152674633300009091Freshwater WetlandsGKGTLLEGLVATFRYAWLHQDGSPQTHTQLRAILNYAVRF*
Ga0105248_1282919023300009177Switchgrass RhizosphereEGLVATLKYSWLHQDGSPQTATQLRAYINYDVRF*
Ga0115028_1043037313300009179WetlandDYAFPKGTLFEGLTATVRYAWTHEDGAAQTGTQLRAILNYAVRF*
Ga0114942_132394513300009527GroundwaterILEGLVATLRYSWLHQDGSPQTATQLRAYINYAIRF*
Ga0105249_1066502723300009553Switchgrass RhizosphereRQETDLRADYAFAKGTPLAGLVGTLRGSWLHQDGSPTAFQFRVIVNYNIPF*
Ga0134122_1037571023300010400Terrestrial SoilFAKGTWADGFVATFRYSWLHQDGSPQTQTDLRAILNYVVRF*
Ga0134123_1345519923300010403Terrestrial SoilYAFPKGTMLQGLVATLRYSWLHQDGSPQTAPQLRAYVSYDVRF*
Ga0151489_166412813300011106SoilAFAKGSVLEGLVATIRYSWLQQDGAPQTGTQLRAYVNYAARF*
Ga0137340_105241623300011405SoilRFDFAFAKGTALEGLVATLRGSWLHQSGSPQTAPQLRAILNYAVRF*
Ga0137458_117107013300011436SoilTALEGLVATLRSSWLHQSGSPQTAPQMRAILNYAVRF*
Ga0150985_10274183823300012212Avena Fatua RhizosphereWETDVRGDYAFAKGAWAEGFVATFRYSWLHQDGSPQIQTDLRAILNYNVHF*
Ga0157284_1006438713300012893SoilDYAFPKGTPLEGLVATFRYSWLHQDGSPQTAPQLRAYLNYDVRF*
Ga0157303_1020763313300012896SoilTNIRADYAFPKGTPLEGLVATFRYSWLHQDGSPQTAPQLRAYLNYDVRF*
Ga0164305_1161729413300012989SoilEGLVATLRYSWLHQDGSPQTAPQLRAYVNYDLRF*
Ga0157375_1048510333300013308Miscanthus RhizospherePKGTPLEGLVATFRYSWLHQDGSPQTAPQLRAYLNYDVRF*
Ga0157375_1112760423300013308Miscanthus RhizosphereRADYAFAKGTWAEGLVATFRYSWLHEQGALQTQTDLRAILNYVVRF*
Ga0075341_100621923300014298Natural And Restored WetlandsGNQDETDVRVDYAFPKSSLLEGLVATLRYAWTHQDGTLQNGHQLRAYLNYEVRF*
Ga0157380_1041846233300014326Switchgrass RhizosphereRADYAFAKGTPLAGLVGTLRGSWLHQDGSPTAFQLRVYVNYSVPF*
Ga0157380_1254528213300014326Switchgrass RhizosphereDYAFAKDSALNGLVATLRGAWLHQDGSPTAFQLRVVLNYAVPF*
Ga0157379_1130924313300014968Switchgrass RhizosphereLRADYAFAKGTWADGFVATFRYSWLHQDGSPQTQTDLRAILNYVVRF*
Ga0157379_1174027613300014968Switchgrass RhizosphereDHWETDVRADYAFAKGTWAEGFVATFRYSWLHQDGSPQIQTDLRAILNYNVHF*
Ga0157376_1027487233300014969Miscanthus RhizosphereLLEGLVATFRYSWLKQDGAAQTQTDLRAILNYGVRF*
Ga0132255_10256716423300015374Arabidopsis RhizosphereGKGTLLEGLVATFRYSWLHQDGSPQIATQLRAYVNYEFRF*
Ga0190274_1305304423300018476SoilRADYAFAKGNVLEGFVATFRYSWLHQDGSPQTQTDLRAILNYGIRF
Ga0190274_1316191823300018476SoilDRKETDLRADYAFAKDSALSGLVATLRGGWLHQDGSPTAYQLRVILNYAVPL
Ga0190274_1346770913300018476SoilADYAFAKGTLFEGLVATFRYSWLHQDGAAQTQTDLRAILNYGVRF
Ga0173479_1033803613300019362SoilTDLRADYAFAKGTPLAGLVGTLRGGWLHQDGSPTAFQLRIYVNYVVPF
Ga0247794_1020378513300024055SoilRVDYAIGKGTPLEGLVATLRYSWLHQEGSPQTAPQLRAYINYAVRF
Ga0207656_1019500213300025321Corn RhizosphereTDVRVDYAIGKGTPLEGLVATLRYSWLHQEGSPQTAPQLRAYINYAVRF
Ga0207656_1049570123300025321Corn RhizosphereLRADYAFAKDSALKGLVATLRGAWLHQDGSPTAFQLRIILNYAVPF
Ga0207682_1039327013300025893Miscanthus RhizosphereDVRGDYAFAKGTLLEGLVATFRYSWLKQDGAAQTQTDLRAILNYGVRF
Ga0207645_1073389523300025907Miscanthus RhizosphereDYAFPKGTALEGLVATFRYSWLHQDGSPQTAPQLRAYLNYDVRF
Ga0207657_1024797223300025919Corn RhizosphereMLQGLVATLRYSWLHQDGSPQTAPQLRAYVNYDVRF
Ga0207657_1136371013300025919Corn RhizosphereYAFPKGTALEGLVATFRYSWLHQDGSPQTAPQLRAYLNYDVRF
Ga0207686_1020693123300025934Miscanthus RhizosphereWAEGFVATFRYSWLHQDGSPQTQTDLRAILNYVVRF
Ga0207691_1019924313300025940Miscanthus RhizosphereFAKGTMLEGLVATLKYSWLHQDGSPQTATQLRAYINYDVRF
Ga0207668_1047813323300025972Switchgrass RhizosphereDYAIGKGTPLEGLVATLRYSWLHQEGSPQTAPQLRAYINYAVRF
Ga0207668_1216333113300025972Switchgrass RhizosphereFAKGTLLEGLVATFRYSWLKQDGAAQTQTDLRAILNYGVRF
Ga0207703_1135912623300026035Switchgrass RhizosphereAKGTWADGFVATFRYSWLHQDGSPQTQTDLRAILNYVVRF
Ga0208541_100028613300026061Natural And Restored WetlandsMRVDYAFAKGTLFEGLVATFRYAWTHQDGTLQNGHQLRAYLNYEVRF
Ga0207708_1080669013300026075Corn, Switchgrass And Miscanthus RhizosphereTVLEGLVATFRYAWTHDGGPQTGQQLRAYLNYAFRF
Ga0207641_1015474113300026088Switchgrass RhizosphereAKGTWAEGFVATFRYSWLHQDGSPQIQTDLRAILNYNVHF
Ga0207648_1032031313300026089Miscanthus RhizosphereSWAEGLVATLRYSWLHQDGSPQTQTDLRAILNYVVRF
Ga0207676_1013727413300026095Switchgrass RhizosphereGDYAFAKGTLLEGLVATFRYSWLKQDGAAQTQTDLRAILNYGVRF
Ga0207675_10139330813300026118Switchgrass RhizosphereKGTWADGFVATFRYSWLHQDGSPQTQTDLRAILNYVVRF
Ga0207698_1005238263300026142Corn RhizosphereADYAFAKGTPLAGLVGTLRGGWLHQDGSPTAFQLRIYVNYVVPF
Ga0209048_1038371313300027902Freshwater Lake SedimentVRLDYAFAKGTPLAGLVATFRYAWAHQDGAPQRGNQLRAYLNYVVPF
Ga0209048_1047726313300027902Freshwater Lake SedimentPLPNRNETDVRVDYAIGKGTFLEGLVATFRYSWLHQEGSPQTATQLRAYLNYAVRF
Ga0268266_1029699113300028379Switchgrass RhizosphereLEGLVATFRYSWLHQDGSPQTAPQLRAYLNYDVRF
Ga0247819_1057246513300028608SoilEYAFAKGTVLEGLVATLRYSWLHQDGSPQTAPQLRAYVNYDVRF
Ga0302256_1007901313300028741FenADYLFPKGHVLEGLSATIRYSWQVQDGSPQTATQLRAYLNYDVRF
Ga0247824_1063475223300028809SoilLEGLVATLRYSWLHQDGSPQTAPQLRAYVNYDFRF
Ga0311332_1086960223300029984FenADYAFGKGTMLEGLIATFRYSWLRQEGLPMNTQLRAIINYAVRF
Ga0311350_1063003023300030002FenDYAFGKGTMLEGLIATFRYSWLRQEGLPMNTQLRAIINYAVRF
Ga0302299_1036396813300030010FenDYLFPKGHVLEGLSATIRYSWQVQDGSPQTATQLRAYLNYDVRF
Ga0311333_1050257223300030114FenDQNETNVRADYAFGKGTMLEGLIATFRYSWLRQEGLPMNTQLRAIINYAVRF
Ga0311349_1129962423300030294FenAFGKGTMLEGLIATFRYSWLRQEGLPMNTQLRAIINYAVRF
Ga0307498_1047546623300031170SoilRNETDIRFDYAFAKGTVLEGLIATLRASWLHQNGSPQTATDLRAYLNYVVRF
Ga0307497_1062658223300031226SoilRADYAFAKGTMLEGLVATLRYSWLHQDGSLQTAPQLRAYVNYDVRF
Ga0315291_1074062123300031707SedimentYAIGKGTFLEGLVATFRYSWLRQDGSPQTGTQLRAYLNYAVRF
Ga0307469_1001963313300031720Hardwood Forest SoilARGARLRNHNETDVRADYAFAKGTLLEGLVAALRYSWLRQDGAAQTQTDFRAILNYLVRF
Ga0307469_1133416913300031720Hardwood Forest SoilLAGLVATFRYSWQQQDGSPHTATQMRAILNYAVAF
Ga0307468_10073844313300031740Hardwood Forest SoilETDVRLDYAFAKGTVLEGLVATFRYAWTHDGGPQTGQQLRAYLNYAFRF
Ga0311367_1067123813300031918FenVRADYLFPKGHVLEGLSATIRYSWQVQDGSPQTATQLRAYLNYDVRF
Ga0311367_1095718813300031918FenVRADYAFGKGTMLEGLIATFRYSWLRQEGLPMNTQLRAIINYAVRF
Ga0315292_1105715313300032143SedimentGTFLEGLVATFRYSWLRQDGSPQTGTQLRAYLNYAVRF
Ga0315283_1172265513300032164SedimentYAVGKGTFLEGLVATFRYSWLRQDGSPQTGTQLRAYLNYAVRF
Ga0307471_10364832513300032180Hardwood Forest SoilVRADYAFAKRTLLEGLVAALRYSWLRQDGAAQTQTDFRAILNYLVRF
Ga0307472_10000710623300032205Hardwood Forest SoilVRADYAFAKRTLLEGLVAALRHSWLRQDGAAQTQTDFRAILNYLVRF
Ga0315270_1032253933300032275SedimentTFLEGLVATFRYSWLRQDGSPQTGTQLRAYLNYAVRF
Ga0315273_1091017813300032516SedimentRVDYAIGRGSFLEGLVATFRYSWLHQEGSPQTATQLRAYLNYAVRF
Ga0315273_1194244823300032516SedimentVDYAIGKGTFLEGLVATFRYSWLRQDGSPQTGTQLRAYLNYAVRF
Ga0335070_1185149023300032829SoilLHGLSATVRYSWLHQDGAPQTATQLRAYINYEVAFR
Ga0335071_1109990813300032897SoilADYAIPFPKDHILHGLSATVRYSWLHQDGAPQTATQLRAYMNYEVAFR
Ga0316619_1224136613300033414SoilAVGKGSVLEGMVATVRYSWLRQDGAQQTAPQLRIYVNYPIRF
Ga0316601_10167540323300033419SoilVGKGSVLEGMVATVRYSWLRQDGSPQTAPQLRIHLNLPIRF
Ga0316631_1043874523300033493SoilSLFEGLAATFRYSWLQQDGAPQTGTQLRAYVNYAVKF

 ⦗Top⦘


Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.